FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30664

FusionGeneSummary for RBFOX2_RAC2

check button Fusion gene summary
Fusion gene informationFusion gene name: RBFOX2_RAC2
Fusion gene ID: 30664
HgeneTgene
Gene symbol

RBFOX2

RAC2

Gene ID

23543

5880

Gene nameRNA binding fox-1 homolog 2Rac family small GTPase 2
SynonymsFOX2|Fox-2|HNRBP2|HRNBP2|RBM9|RTA|dJ106I20.3|fxhEN-7|Gx|HSPC022|p21-Rac2
Cytomap

22q12.3

22q13.1

Type of geneprotein-codingprotein-coding
DescriptionRNA binding protein fox-1 homolog 2RNA binding protein, fox-1 homolog 2RNA-binding motif protein 9fox-1 homolog Bfox-1 homologuehexaribonucleotide-binding protein 2repressor of tamoxifen transcriptional activityras-related C3 botulinum toxin substrate 2Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP-binding protein Rac2)ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)small G protein
Modification date2018052320180523
UniProtAcc

O43251

P15153

Ensembl transtripts involved in fusion geneENST00000405409, ENST00000414461, 
ENST00000449924, ENST00000262829, 
ENST00000397303, ENST00000359369, 
ENST00000416721, ENST00000438146, 
ENST00000249071, ENST00000406508, 
ENST00000405484, ENST00000401529, 
Fusion gene scores* DoF score13 X 8 X 8=8325 X 4 X 5=100
# samples 145
** MAII scorelog2(14/832*10)=-2.57115670119613
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RBFOX2 [Title/Abstract] AND RAC2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRBFOX2

GO:0030520

intracellular estrogen receptor signaling pathway

11875103

HgeneRBFOX2

GO:0045892

negative regulation of transcription, DNA-templated

11875103

TgeneRAC2

GO:0060263

regulation of respiratory burst

16636067


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-EP-A2KA-01ARBFOX2chr22

36205827

-RAC2chr22

37622843

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000405409ENST00000249071RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000405409ENST00000406508RBFOX2chr22

36205827

-RAC2chr22

37622843

-
In-frameENST00000405409ENST00000405484RBFOX2chr22

36205827

-RAC2chr22

37622843

-
5CDS-intronENST00000405409ENST00000401529RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000414461ENST00000249071RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000414461ENST00000406508RBFOX2chr22

36205827

-RAC2chr22

37622843

-
In-frameENST00000414461ENST00000405484RBFOX2chr22

36205827

-RAC2chr22

37622843

-
5CDS-intronENST00000414461ENST00000401529RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000449924ENST00000249071RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000449924ENST00000406508RBFOX2chr22

36205827

-RAC2chr22

37622843

-
In-frameENST00000449924ENST00000405484RBFOX2chr22

36205827

-RAC2chr22

37622843

-
5CDS-intronENST00000449924ENST00000401529RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000262829ENST00000249071RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000262829ENST00000406508RBFOX2chr22

36205827

-RAC2chr22

37622843

-
In-frameENST00000262829ENST00000405484RBFOX2chr22

36205827

-RAC2chr22

37622843

-
5CDS-intronENST00000262829ENST00000401529RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000397303ENST00000249071RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000397303ENST00000406508RBFOX2chr22

36205827

-RAC2chr22

37622843

-
In-frameENST00000397303ENST00000405484RBFOX2chr22

36205827

-RAC2chr22

37622843

-
5CDS-intronENST00000397303ENST00000401529RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000359369ENST00000249071RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000359369ENST00000406508RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000359369ENST00000405484RBFOX2chr22

36205827

-RAC2chr22

37622843

-
5CDS-intronENST00000359369ENST00000401529RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000416721ENST00000249071RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000416721ENST00000406508RBFOX2chr22

36205827

-RAC2chr22

37622843

-
In-frameENST00000416721ENST00000405484RBFOX2chr22

36205827

-RAC2chr22

37622843

-
5CDS-intronENST00000416721ENST00000401529RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000438146ENST00000249071RBFOX2chr22

36205827

-RAC2chr22

37622843

-
Frame-shitENST00000438146ENST00000406508RBFOX2chr22

36205827

-RAC2chr22

37622843

-
In-frameENST00000438146ENST00000405484RBFOX2chr22

36205827

-RAC2chr22

37622843

-
5CDS-intronENST00000438146ENST00000401529RBFOX2chr22

36205827

-RAC2chr22

37622843

-

Top

FusionProtFeatures for RBFOX2_RAC2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RBFOX2

O43251

RAC2

P15153

Plasma membrane-associated small GTPase which cyclesbetween an active GTP-bound and inactive GDP-bound state. Inactive state binds to a variety of effector proteins to regulatecellular responses, such as secretory processes, phagocytose ofapoptotic cells and epithelial cell polarization. Augments theproduction of reactive oxygen species (ROS) by NADPH oxidase.{ECO:0000269|PubMed:1660188}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for RBFOX2_RAC2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RBFOX2_ENST00000405409_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_127aa
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTETGVPHTQDTAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTR_NTW

>In-frame_RBFOX2_ENST00000414461_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_127aa
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTETGVPHTQDTAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTR_NTW

>In-frame_RBFOX2_ENST00000449924_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_127aa
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTETGVPHTQDTAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTR_NTW

>In-frame_RBFOX2_ENST00000262829_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_127aa
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTETGVPHTQDTAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTR_NTW

>In-frame_RBFOX2_ENST00000397303_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_107aa
MVQPFTTIPFPPPPQNGIPTETGVPHTQDTAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTR_NTWSAQLSPREA_KPCSTRPSGP

>In-frame_RBFOX2_ENST00000416721_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_127aa
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTETGVPHTQDTAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTR_NTW

>In-frame_RBFOX2_ENST00000438146_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_197aa
MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGMQNEPLTPGTHGFPARDSQGNQEPTTTPDA
MVQPFTTIPFPPPPQNGIPTETGVPHTQDTAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTR_NTWSAQLSPREA_KPCSTRPSGP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RBFOX2_ENST00000405409_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_383nt
ATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACCATCCCATTT
CCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCATAACCTGACA
CTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGAAATACCTGG
AGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGA

>In-frame_RBFOX2_ENST00000414461_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_383nt
ATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACCATCCCATTT
CCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCATAACCTGACA
CTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGAAATACCTGG
AGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGA

>In-frame_RBFOX2_ENST00000449924_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_383nt
ATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACCATCCCATTT
CCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCATAACCTGACA
CTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGAAATACCTGG
AGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGA

>In-frame_RBFOX2_ENST00000262829_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_383nt
ATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACCATCCCATTT
CCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCATAACCTGACA
CTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGAAATACCTGG
AGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGA

>In-frame_RBFOX2_ENST00000397303_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_323nt
ATGGTTCAGCCTTTTACTACCATCCCATTTCCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTAT
GCCGGCCAGACCGGTGAGCATAACCTGACACTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAAT
GGATCTCTTACGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCG

>In-frame_RBFOX2_ENST00000416721_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_383nt
ATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACCATCCCATTT
CCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCATAACCTGACA
CTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGAAATACCTGG
AGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGA

>In-frame_RBFOX2_ENST00000438146_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_593nt
ATGGCGGAGGGCGCCCAGCCGCATCAGCCGCCTCAGCTCGGGCCCGGCGCCGCCGCCCGGGGCATGAAGCGGGAGTCGGAGCTGGAGCTG
CCGGTGCCCGGAGCGGGAGGAGACGGAGCCGATCCCGGCCTGAGCAAGCGGCCGCGCACTGAGGAGGCGGCGGCCGACGGTGGCGGCGGG
ATGCAGAACGAGCCTCTGACTCCAGGTTATCATGGATTCCCAGCGCGGGACAGCCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCA
ATGGTTCAGCCTTTTACTACCATCCCATTTCCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTAT
GCCGGCCAGACCGGTGAGCATAACCTGACACTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAAT
GGATCTCTTACGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RBFOX2_ENST00000405409_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_752nt
ATTCTCCAGCAGGCCTGCTTCTGGAGTTGGGAGATGTCAGCCTGCTGGGAGGGGGTGGGGGGAGGAGGAAGAGGTGGGGCTCTACTCTGA
TTAATTACCTTAGGCATTCAGGGGTGGGGCTTCCTTCAGCCATCTGCCTGAGATATGGGAGGGAGCTGGAGAAAGAAGGAGGGGGAGAGA
CTGCCAGAGAGGAAGAGAAAAGAAAGGAAGAAACATTAGAAAGAAAAAGGAAGGAAAACGGTATAAAGAGAGATCAATTACCCACCCTTA
AATAGCTAGATTGGGGGGGGAGGGGGGTGGAAAAGAAAGCTGTGGAGGTGTGCCCCAGCACGGCTGCTTTGAAAGGTTTATCATCTATCC
GTTTGGTTTATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACC
ATCCCATTTCCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCAT
AACCTGACACTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGA
AATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGC

>In-frame_RBFOX2_ENST00000414461_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_383nt
ATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACCATCCCATTT
CCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCATAACCTGACA
CTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGAAATACCTGG
AGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGA

>In-frame_RBFOX2_ENST00000449924_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_572nt
CTGCCAGAGAGGAAGAGAAAAGAAAGGAAGAAACATTAGAAAGAAAAAGGAAGGAAAACGGTATAAAGAGAGATCAATTACCCACCCTTA
AATAGCTAGATTGGGGGGGGAGGGGGGTGGAAAAGAAAGCTGTGGAGGTGTGCCCCAGCACGGCTGCTTTGAAAGGTTTATCATCTATCC
GTTTGGTTTATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACC
ATCCCATTTCCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCAT
AACCTGACACTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGA
AATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGC

>In-frame_RBFOX2_ENST00000262829_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_572nt
CTGCCAGAGAGGAAGAGAAAAGAAAGGAAGAAACATTAGAAAGAAAAAGGAAGGAAAACGGTATAAAGAGAGATCAATTACCCACCCTTA
AATAGCTAGATTGGGGGGGGAGGGGGGTGGAAAAGAAAGCTGTGGAGGTGTGCCCCAGCACGGCTGCTTTGAAAGGTTTATCATCTATCC
GTTTGGTTTATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACC
ATCCCATTTCCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCAT
AACCTGACACTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGA
AATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGC

>In-frame_RBFOX2_ENST00000397303_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_356nt
GGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACCATCCCATTTCCACCACCTCCGCAGAATGGAATTCCC
ACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCATAACCTGACACTCTACGGAAGTACGCAAGCCCACGGG
GAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCC

>In-frame_RBFOX2_ENST00000416721_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_449nt
AGAAAGCTGTGGAGGTGTGCCCCAGCACGGCTGCTTTGAAAGGTTTATCATCTATCCGTTTGGTTTATGGAGAAAAAGAAAATGGTAACT
CAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGCCTTTTACTACCATCCCATTTCCACCACCTCCGCAGAATGGAATT
CCCACAGAGTATGGGGTGCCACACACTCAAGACTATGCCGGCCAGACCGGTGAGCATAACCTGACACTCTACGGAAGTACGCAAGCCCAC
GGGGAGCAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAG

>In-frame_RBFOX2_ENST00000438146_chr22_36205827_-_RAC2_ENST00000405484_chr22_37622843_-_593nt
ATGGCGGAGGGCGCCCAGCCGCATCAGCCGCCTCAGCTCGGGCCCGGCGCCGCCGCCCGGGGCATGAAGCGGGAGTCGGAGCTGGAGCTG
CCGGTGCCCGGAGCGGGAGGAGACGGAGCCGATCCCGGCCTGAGCAAGCGGCCGCGCACTGAGGAGGCGGCGGCCGACGGTGGCGGCGGG
ATGCAGAACGAGCCTCTGACTCCAGGTTATCATGGATTCCCAGCGCGGGACAGCCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCA
ATGGTTCAGCCTTTTACTACCATCCCATTTCCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACACTCAAGACTAT
GCCGGCCAGACCGGTGAGCATAACCTGACACTCTACGGAAGTACGCAAGCCCACGGGGAGCAGAGCAGCAACTCACCCAGCACACAAAAT
GGATCTCTTACGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCG


Top

FusionGenePPI for RBFOX2_RAC2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RBFOX2RHOXF2, DAZAP2, DMRTB1, RBPMS, ESR1, ESR2, TOLLIP, POLR3D, ELAVL2, HNRNPAB, ZNF137P, MED7, NR2E3, CHAF1A, GTF2A1L, RBFOX2, BRD7, DEDD2, GLIS2, ELAVL1, CUL3, ATXN1, QKI, RBFOX1, ATN1, ATXN1L, RERE, VCP, SNRPC, SF3A1, U2AF2, RBM23, RBM22, DDX5, HNRNPK, SMN1, HNRNPF, HNRNPH2, RBM42, PTBP1, KHDRBS1, PSMF1, APH1A, RPA1, RPA2, RPA3, CAMK2B, DAB1, PSMA3, RNF8, MAGED1, VAC14, BOLL, C1orf94, NAF1, MAPK1IP1L, BMI1, TRMT61A, PRMT5, EIF4G3, MBNL1, RBPMS2, LARP4B, PUM1, PUM2, RBM38, HELZ, DPH2, GPATCH8, FNDC3B, FAM136A, PRRC2A, ATXN2, COPRS, JMJD4, CLNS1A, ANKRD40, RBMS1, RIOK1, MSI2, OTUD4, HOXA5, UBAP2, PLEKHB1, C19orf52, PJA1, FBXO7, BCS1L, PARL, UNK, NTRK1, CEP164, APC, MATR3, PHF12, GATAD1, RBMS2, NR3C1, TRIM25RAC2CUL1, DEF6, ACTB, DOCK2, NCF2, ICMT, NOS2, ARHGDIB, PAK2, ARHGDIA, CHGB, AFG3L2, VCAM1, ITGA4, CD81, HDAC10, ADAM22, FBXO6, U2AF2, AGAP2, RAC3, DOCK1, ELMO2, RAP1GDS1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RBFOX2_RAC2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RBFOX2_RAC2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRBFOX2C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneRBFOX2C0036095Salivary Gland Neoplasms1CTD_human
TgeneRAC2C0018799Heart Diseases1CTD_human
TgeneRAC2C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneRAC2C0024299Lymphoma1CTD_human
TgeneRAC2C0025202melanoma1CTD_human
TgeneRAC2C0349639Juvenile Myelomonocytic Leukemia1CTD_human
TgeneRAC2C1842398Neutrophil Immunodeficiency Syndrome1CTD_human;ORPHANET;UNIPROT