FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30522

FusionGeneSummary for RASA3_KCNG2

check button Fusion gene summary
Fusion gene informationFusion gene name: RASA3_KCNG2
Fusion gene ID: 30522
HgeneTgene
Gene symbol

RASA3

KCNG2

Gene ID

22821

26251

Gene nameRAS p21 protein activator 3potassium voltage-gated channel modifier subfamily G member 2
SynonymsGAP1IP4BP|GAPIIIKCNF2|KV6.2
Cytomap

13q34

18q23

Type of geneprotein-codingprotein-coding
Descriptionras GTPase-activating protein 3GTPase activating protein IIIGTPase-activating protein 1 family, inositol 1,3,4,5-tetrakisphosphate-binding proteinIns(1,3,4,5)P4-binding proteinins P4-binding proteinpotassium voltage-gated channel subfamily G member 2cardiac potassium channel subunitpotassium channel, voltage gated modifier subfamily G, member 2potassium voltage-gated channel, subfamily G, member 2voltage-gated potassium channel subunit Kv6.2
Modification date2018051920180523
UniProtAcc

Q14644

Q9UJ96

Ensembl transtripts involved in fusion geneENST00000334062, ENST00000389544, 
ENST00000542651, 
ENST00000316249, 
ENST00000590307, 
Fusion gene scores* DoF score3 X 3 X 3=271 X 1 X 1=1
# samples 31
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: RASA3 [Title/Abstract] AND KCNG2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-FG-A711-01ARASA3chr13

114817527

-KCNG2chr18

77659040

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000334062ENST00000316249RASA3chr13

114817527

-KCNG2chr18

77659040

+
5CDS-3UTRENST00000334062ENST00000590307RASA3chr13

114817527

-KCNG2chr18

77659040

+
Frame-shitENST00000389544ENST00000316249RASA3chr13

114817527

-KCNG2chr18

77659040

+
5CDS-3UTRENST00000389544ENST00000590307RASA3chr13

114817527

-KCNG2chr18

77659040

+
In-frameENST00000542651ENST00000316249RASA3chr13

114817527

-KCNG2chr18

77659040

+
5CDS-3UTRENST00000542651ENST00000590307RASA3chr13

114817527

-KCNG2chr18

77659040

+

Top

FusionProtFeatures for RASA3_KCNG2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RASA3

Q14644

KCNG2

Q9UJ96

Inhibitory regulator of the Ras-cyclic AMP pathway.Binds inositol tetrakisphosphate (IP4) with high affinity. Mightbe a specific IP4 receptor. Potassium channel subunit. Modulates channel activity byshifting the threshold and the half-maximal activation to morenegative values.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for RASA3_KCNG2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RASA3_ENST00000542651_chr13_114817527_-_KCNG2_ENST00000316249_chr18_77659040_+_351aa
MAVEDEGLRVFQSVKIKIGEAKNLPSYPGPSKMRDCYCTVNLDQEEVFRTKIVEKSLCPFYGEDFYCEIPRSFRHLSFYIFDRDVFRRDS
IIGRVLPQVPQPVRAGDRVRGLVLLRVPAALPAGREQVRLPARATQHH_HPGAPAVLRVAAAGAGGRPGRDQAPGARGAGAAAAACAARA
LRDAPGAPLAGAAFAGPDHAPLRARVRAAAAVPLRGHGALRATGAPGRARAGRAPRLLQRARQLLVGRHLHDHRGLRRHGPAQPARAGGG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RASA3_ENST00000542651_chr13_114817527_-_KCNG2_ENST00000316249_chr18_77659040_+_1054nt
ATGGCGGTGGAGGACGAGGGGCTCCGGGTCTTCCAGAGCGTGAAGATCAAGATCGGTGAAGCCAAAAACCTTCCCTCTTACCCGGGGCCG
AGCAAGATGAGGGATTGCTACTGCACGGTGAACCTGGACCAGGAGGAGGTTTTCAGGACCAAAATTGTGGAAAAGTCACTCTGCCCGTTT
TACGGAGAAGACTTTTACTGTGAAATTCCTCGGAGCTTTCGTCACCTGTCCTTCTACATTTTCGATAGAGACGTTTTCCGGAGGGATTCC
ATCATAGGGCGAGTGCTCCCCCAAGTGCCGCAGCCTGTTCGTGCTGGAGACCGTGTGCGTGGCCTGGTTCTCCTTCGAGTTCCTGCTGCG
CTCCCTGCAGGCCGAGAGCAAGTGCGCCTTCCTGCGCGCGCCACTCAACATCATTGACATCCTGGCGCTCCTGCCGTTCTACGTGTCGCT
GCTGCTGGGGCTGGCGGCAGGCCCGGGCGGGACCAAGCTCCTGGAGCGCGCGGGGCTGGTGCTGCGGCTGCTGCGTGCGCTGCGCGTGCT
CTACGTGATGCGCCTGGCGCGCCACTCGCTGGGGCTGCGTTCGCTGGGCCTGACCATGCGCCGCTGCGCGCGCGAGTTCGGGCTGCTGCT
GCTGTTCCTCTGCGTGGCCATGGCGCTCTTCGCGCCACTGGTGCACCTGGCCGAGCGCGAGCTGGGCGCGCGCCGCGACTTCTCCAGCGT
GCCCGCCAGCTATTGGTGGGCCGTCATCTCCATGACCACCGTGGGCTACGGCGACATGGTCCCGCGCAGCCTGCCCGGGCAGGTGGTGGC
GCTCAGCAGCATCCTCAGCGGCATCCTGCTCATGGCCTTCCCGGTCACCTCCATCTTCCACACCTTTTCGCGCTCCTACTCCGAGCTCAA
GGAGCAGCAGCAGCGCGCGGCCAGCCCCGAGCCGGCCCTGCAGGAGGACAGCACGCACTCGGCCACAGCCACCGAGGACAGCTCGCAGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RASA3_ENST00000542651_chr13_114817527_-_KCNG2_ENST00000316249_chr18_77659040_+_1117nt
GGCCTGAGCTGCCCGGGCTCGGCGCGCGCTTGGGGCGAGGCTCGGCGGGCGCGGACGCGCAGCATGGCGGTGGAGGACGAGGGGCTCCGG
GTCTTCCAGAGCGTGAAGATCAAGATCGGTGAAGCCAAAAACCTTCCCTCTTACCCGGGGCCGAGCAAGATGAGGGATTGCTACTGCACG
GTGAACCTGGACCAGGAGGAGGTTTTCAGGACCAAAATTGTGGAAAAGTCACTCTGCCCGTTTTACGGAGAAGACTTTTACTGTGAAATT
CCTCGGAGCTTTCGTCACCTGTCCTTCTACATTTTCGATAGAGACGTTTTCCGGAGGGATTCCATCATAGGGCGAGTGCTCCCCCAAGTG
CCGCAGCCTGTTCGTGCTGGAGACCGTGTGCGTGGCCTGGTTCTCCTTCGAGTTCCTGCTGCGCTCCCTGCAGGCCGAGAGCAAGTGCGC
CTTCCTGCGCGCGCCACTCAACATCATTGACATCCTGGCGCTCCTGCCGTTCTACGTGTCGCTGCTGCTGGGGCTGGCGGCAGGCCCGGG
CGGGACCAAGCTCCTGGAGCGCGCGGGGCTGGTGCTGCGGCTGCTGCGTGCGCTGCGCGTGCTCTACGTGATGCGCCTGGCGCGCCACTC
GCTGGGGCTGCGTTCGCTGGGCCTGACCATGCGCCGCTGCGCGCGCGAGTTCGGGCTGCTGCTGCTGTTCCTCTGCGTGGCCATGGCGCT
CTTCGCGCCACTGGTGCACCTGGCCGAGCGCGAGCTGGGCGCGCGCCGCGACTTCTCCAGCGTGCCCGCCAGCTATTGGTGGGCCGTCAT
CTCCATGACCACCGTGGGCTACGGCGACATGGTCCCGCGCAGCCTGCCCGGGCAGGTGGTGGCGCTCAGCAGCATCCTCAGCGGCATCCT
GCTCATGGCCTTCCCGGTCACCTCCATCTTCCACACCTTTTCGCGCTCCTACTCCGAGCTCAAGGAGCAGCAGCAGCGCGCGGCCAGCCC
CGAGCCGGCCCTGCAGGAGGACAGCACGCACTCGGCCACAGCCACCGAGGACAGCTCGCAGGGCCCCGACAGCGCGGGCCTGGCCGACGA


Top

FusionGenePPI for RASA3_KCNG2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RASA3HCK, GNB2L1, APP, SPTB, ARHGAP19, GAPVD1, EID1, GNAI2, GNAI3KCNG2KCNB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RASA3_KCNG2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RASA3_KCNG2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource