FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30502

FusionGeneSummary for RARS2_SMAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: RARS2_SMAP1
Fusion gene ID: 30502
HgeneTgene
Gene symbol

RARS2

SMAP1

Gene ID

57038

60682

Gene namearginyl-tRNA synthetase 2, mitochondrialsmall ArfGAP 1
SynonymsArgRS|DALRD2|PCH6|PRO1992|RARSLSMAP-1
Cytomap

6q15

6q13

Type of geneprotein-codingprotein-coding
Descriptionprobable arginine--tRNA ligase, mitochondrialprobable arginyl-tRNA synthetase, mitochondrialstromal membrane-associated protein 1stromal membrane-associated GTPase-activating protein 1
Modification date2018052320180523
UniProtAcc

Q5T160

Q8IYB5

Ensembl transtripts involved in fusion geneENST00000369536, ENST00000497828, 
ENST00000316999, ENST00000370452, 
ENST00000370455, ENST00000422334, 
Fusion gene scores* DoF score4 X 3 X 3=365 X 4 X 4=80
# samples 55
** MAII scorelog2(5/36*10)=0.473931188332412
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RARS2 [Title/Abstract] AND SMAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AR-A24Z-01ARARS2chr6

88299640

-SMAP1chr6

71508360

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000369536ENST00000316999RARS2chr6

88299640

-SMAP1chr6

71508360

+
In-frameENST00000369536ENST00000370452RARS2chr6

88299640

-SMAP1chr6

71508360

+
In-frameENST00000369536ENST00000370455RARS2chr6

88299640

-SMAP1chr6

71508360

+
5CDS-intronENST00000369536ENST00000422334RARS2chr6

88299640

-SMAP1chr6

71508360

+
intron-3CDSENST00000497828ENST00000316999RARS2chr6

88299640

-SMAP1chr6

71508360

+
intron-3CDSENST00000497828ENST00000370452RARS2chr6

88299640

-SMAP1chr6

71508360

+
intron-3CDSENST00000497828ENST00000370455RARS2chr6

88299640

-SMAP1chr6

71508360

+
intron-intronENST00000497828ENST00000422334RARS2chr6

88299640

-SMAP1chr6

71508360

+

Top

FusionProtFeatures for RARS2_SMAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RARS2

Q5T160

SMAP1

Q8IYB5

GTPase activating protein that acts on ARF6. Plays arole in clathrin-dependent endocytosis. May play a role inerythropoiesis (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRARS2chr6:88299640chr6:71508360ENST00000369536-120133_14412579MotifNote="HIGH" region
HgeneRARS2chr6:88299640chr6:71508360ENST00000369536-120133_13512579RegionL-arginine binding
TgeneSMAP1chr6:88299640chr6:71508360ENST00000316999+31018_136138441DomainArf-GAP
TgeneSMAP1chr6:88299640chr6:71508360ENST00000370452+31118_136138437DomainArf-GAP
TgeneSMAP1chr6:88299640chr6:71508360ENST00000370455+41118_136165468DomainArf-GAP
TgeneSMAP1chr6:88299640chr6:71508360ENST00000316999+31033_56138441Zinc fingerC4-type
TgeneSMAP1chr6:88299640chr6:71508360ENST00000370452+31133_56138437Zinc fingerC4-type
TgeneSMAP1chr6:88299640chr6:71508360ENST00000370455+41133_56165468Zinc fingerC4-type


Top

FusionGeneSequence for RARS2_SMAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RARS2_ENST00000369536_chr6_88299640_-_SMAP1_ENST00000316999_chr6_71508360_+_315aa
MACGFRRAIACQKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDL
DIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLTGTGTIQQQSTPGVFMGPTNIPFTS
QAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQ

>In-frame_RARS2_ENST00000369536_chr6_88299640_-_SMAP1_ENST00000370452_chr6_71508360_+_311aa
MACGFRRAIACQKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDL
DIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLTGTGTIQQQSTPGVFMGPTNIPFTS
QAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQ

>In-frame_RARS2_ENST00000369536_chr6_88299640_-_SMAP1_ENST00000370455_chr6_71508360_+_315aa
MACGFRRAIACQKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDL
DIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLTGTGTIQQQSTPGVFMGPTNIPFTS
QAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RARS2_ENST00000369536_chr6_88299640_-_SMAP1_ENST00000316999_chr6_71508360_+_945nt
ATGGCGTGCGGCTTTCGCCGCGCTATTGCTTGCCAGAAAGAAAAGGAAAAAAAAAAGGAAGAGAAAAAGAGAGAAAAGGAGCCAGAAAAG
CCGGCAAAACCACTTACAGCTGAAAAGCTGCAGAAGAAAGATCAGCAACTGGAGCCTAAAAAAAGTACCAGCCCTAAAAAAGCTGCGGAG
CCCACTGTGGATCTTTTAGGACTTGATGGCCCTGCTGTGGCACCAGTGACCAACGGGAACACAACGGTGCCACCCCTGAACGATGATCTG
GACATCTTTGGACCGATGATTTCTAATCCCTTACCTGCAACTGTCATGCCCCCAGCTCAGGGGACACCCTCTGCACCAGCAGCTGCAACC
CTGTCTACAGTAACATCTGGGGATCTAGATTTATTCACTGAGCAAACTACAAAATCAGAAGAAGTGGCAAAGAAACAACTTTCCAAAGAC
TCCATCTTATCTCTGTATGGCACAGGAACCATTCAACAGCAAAGTACTCCTGGTGTATTTATGGGACCCACAAATATACCATTTACCTCA
CAAGCACCAGCTGCATTTCAGGGCTTTCCATCGATGGGCGTGCCTGTGCCTGCAGCTCCTGGCCTTATAGGAAATGTGATGGGACAGAGT
CCAAGCATGATGGTGGGCATGCCCATGCCCAATGGGTTTATGGGAAATGCACAAACTGGTGTGATGCCACTTCCTCAGAACGTTGTTGGC
CCCCAAGGAGGAATGGTGGGACAAATGGGTGCACCCCAGAGTAAGTTTGGCCTGCCGCAAGCTCAGCAGCCCCAGTGGAGCCTCTCACAG
ATGAATCAGCAGATGGCTGGCATGAGTATCAGTAGTGCAACCCCTACTGCAGGTTTTGGCCAGCCCTCCAGCACAACAGCAGGATGGTCT

>In-frame_RARS2_ENST00000369536_chr6_88299640_-_SMAP1_ENST00000370452_chr6_71508360_+_933nt
ATGGCGTGCGGCTTTCGCCGCGCTATTGCTTGCCAGAAAGAAAAGGAAAAAAAAAAGGAAGAGAAAAAGAGAGAAAAGGAGCCAGAAAAG
CCGGCAAAACCACTTACAGCTGAAAAGCTGCAGAAGAAAGATCAGCAACTGGAGCCTAAAAAAAGTACCAGCCCTAAAAAAGCTGCGGAG
CCCACTGTGGATCTTTTAGGACTTGATGGCCCTGCTGTGGCACCAGTGACCAACGGGAACACAACGGTGCCACCCCTGAACGATGATCTG
GACATCTTTGGACCGATGATTTCTAATCCCTTACCTGCAACTGTCATGCCCCCAGCTCAGGGGACACCCTCTGCACCAGCAGCTGCAACC
CTGTCTACAGTAACATCTGGGGATCTAGATTTATTCACTGAGCAAACTACAAAATCAGAAGAAGTGGCAAAGAAACAACTTTCCAAAGAC
TCCATCTTATCTCTGTATGGCACAGGAACCATTCAACAGCAAAGTACTCCTGGTGTATTTATGGGACCCACAAATATACCATTTACCTCA
CAAGCACCAGCTGCATTTCAGGGCTTTCCATCGATGGGCGTGCCTGTGCCTGCAGCTCCTGGCCTTATAGGAAATGTGATGGGACAGAGT
CCAAGCATGATGGTGGGCATGCCCATGCCCAATGGGTTTATGGGAAATGCACAAACTGGTGTGATGCCACTTCCTCAGAACGTTGTTGGC
CCCCAAGGAGGAATGGTGGGACAAATGGGTGCACCCCAGAGTAAGTTTGGCCTGCCGCAAGCTCAGCAGCCCCAGTGGAGCCTCTCACAG
ATAATGCAGAAGGGTGATGCTGTTCTCCAGCACTCCATCAGTGCAATCTACTGGCCAATGACAAGGTGGTTAAAATGTCCTTTAGTAGAT

>In-frame_RARS2_ENST00000369536_chr6_88299640_-_SMAP1_ENST00000370455_chr6_71508360_+_945nt
ATGGCGTGCGGCTTTCGCCGCGCTATTGCTTGCCAGAAAGAAAAGGAAAAAAAAAAGGAAGAGAAAAAGAGAGAAAAGGAGCCAGAAAAG
CCGGCAAAACCACTTACAGCTGAAAAGCTGCAGAAGAAAGATCAGCAACTGGAGCCTAAAAAAAGTACCAGCCCTAAAAAAGCTGCGGAG
CCCACTGTGGATCTTTTAGGACTTGATGGCCCTGCTGTGGCACCAGTGACCAACGGGAACACAACGGTGCCACCCCTGAACGATGATCTG
GACATCTTTGGACCGATGATTTCTAATCCCTTACCTGCAACTGTCATGCCCCCAGCTCAGGGGACACCCTCTGCACCAGCAGCTGCAACC
CTGTCTACAGTAACATCTGGGGATCTAGATTTATTCACTGAGCAAACTACAAAATCAGAAGAAGTGGCAAAGAAACAACTTTCCAAAGAC
TCCATCTTATCTCTGTATGGCACAGGAACCATTCAACAGCAAAGTACTCCTGGTGTATTTATGGGACCCACAAATATACCATTTACCTCA
CAAGCACCAGCTGCATTTCAGGGCTTTCCATCGATGGGCGTGCCTGTGCCTGCAGCTCCTGGCCTTATAGGAAATGTGATGGGACAGAGT
CCAAGCATGATGGTGGGCATGCCCATGCCCAATGGGTTTATGGGAAATGCACAAACTGGTGTGATGCCACTTCCTCAGAACGTTGTTGGC
CCCCAAGGAGGAATGGTGGGACAAATGGGTGCACCCCAGAGTAAGTTTGGCCTGCCGCAAGCTCAGCAGCCCCAGTGGAGCCTCTCACAG
ATGAATCAGCAGATGGCTGGCATGAGTATCAGTAGTGCAACCCCTACTGCAGGTTTTGGCCAGCCCTCCAGCACAACAGCAGGATGGTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RARS2_ENST00000369536_chr6_88299640_-_SMAP1_ENST00000316999_chr6_71508360_+_1823nt
CGAGGCCGGAACTGGCGGACTGCGGCGCACTTCCGTAGAGGTGGACATGGCGTGCGGCTTTCGCCGCGCTATTGCTTGCCAGAAAGAAAA
GGAAAAAAAAAAGGAAGAGAAAAAGAGAGAAAAGGAGCCAGAAAAGCCGGCAAAACCACTTACAGCTGAAAAGCTGCAGAAGAAAGATCA
GCAACTGGAGCCTAAAAAAAGTACCAGCCCTAAAAAAGCTGCGGAGCCCACTGTGGATCTTTTAGGACTTGATGGCCCTGCTGTGGCACC
AGTGACCAACGGGAACACAACGGTGCCACCCCTGAACGATGATCTGGACATCTTTGGACCGATGATTTCTAATCCCTTACCTGCAACTGT
CATGCCCCCAGCTCAGGGGACACCCTCTGCACCAGCAGCTGCAACCCTGTCTACAGTAACATCTGGGGATCTAGATTTATTCACTGAGCA
AACTACAAAATCAGAAGAAGTGGCAAAGAAACAACTTTCCAAAGACTCCATCTTATCTCTGTATGGCACAGGAACCATTCAACAGCAAAG
TACTCCTGGTGTATTTATGGGACCCACAAATATACCATTTACCTCACAAGCACCAGCTGCATTTCAGGGCTTTCCATCGATGGGCGTGCC
TGTGCCTGCAGCTCCTGGCCTTATAGGAAATGTGATGGGACAGAGTCCAAGCATGATGGTGGGCATGCCCATGCCCAATGGGTTTATGGG
AAATGCACAAACTGGTGTGATGCCACTTCCTCAGAACGTTGTTGGCCCCCAAGGAGGAATGGTGGGACAAATGGGTGCACCCCAGAGTAA
GTTTGGCCTGCCGCAAGCTCAGCAGCCCCAGTGGAGCCTCTCACAGATGAATCAGCAGATGGCTGGCATGAGTATCAGTAGTGCAACCCC
TACTGCAGGTTTTGGCCAGCCCTCCAGCACAACAGCAGGATGGTCTGGAAGCTCATCAGGTCAGACTCTCAGCACACAACTGTGGAAATG
AAAACTGCAATACAAGTTTCATCCAGAACTACCACCTGACATTCCTTGCTGAAACGCATCTAGTTCCCCTGTTTATTCATATGCATATTT
TTTTTCTTTTTACCCATTTGTTCATATTAAGAATGATCTGATTGACCGTGTTGGTCTGTACTGATTCAATTTGATGTGGTGAAAAGCAGG
TTGATAAATCATTTTATGTCAAGGGCAGCTTTGCTCATATTTCCCATGATTTCATGTACTGCATTATTTGAGAAGCTGCTCAACTTGCAA
AATCAGTTTTCCTCTCAATAAAATTATAGCTCTAATGTTTGCATATAAGGGAAGTAGTTATCATGTTAGTAATACCTCTAATAGTATAAA
CCCCACCCCAAAATTAGCCAGTAATCCTGTAGGAAGGTACTGTATGATCAAATGTTTAATCATATAAATAGAATGTAAATGTCTCACTGA
GCACTGTTTTCTAGTGTATCAAAATGCTCTTATTTCATCATTCACTTCACTGTGCTGTTGTTATGATGTGCTTAACAGGGAACGTGATTA
GTGAAAGGAAGATAAACGTGGATGTTACTCCAAAACTTCGTTTAATGAATGCTTAAAGAATTCAAATTTTATCTGCCTCTCTTGTAATTT
GGATCTCTTCTTAATGTACATAGTGCTAACATGAAGACCTTTTTCTGCACTATATGCAAACAGGGTAACTAACTAAAACAAAGCCACTTT
CAATCTTCAATCCTTGAAGGTATATCTAGGTTTATGACAGTAATTGTGTTTACATTTTATGGTGCCTAGTATTGACAAAATGTTATTTCC

>In-frame_RARS2_ENST00000369536_chr6_88299640_-_SMAP1_ENST00000370452_chr6_71508360_+_1911nt
CGAGGCCGGAACTGGCGGACTGCGGCGCACTTCCGTAGAGGTGGACATGGCGTGCGGCTTTCGCCGCGCTATTGCTTGCCAGAAAGAAAA
GGAAAAAAAAAAGGAAGAGAAAAAGAGAGAAAAGGAGCCAGAAAAGCCGGCAAAACCACTTACAGCTGAAAAGCTGCAGAAGAAAGATCA
GCAACTGGAGCCTAAAAAAAGTACCAGCCCTAAAAAAGCTGCGGAGCCCACTGTGGATCTTTTAGGACTTGATGGCCCTGCTGTGGCACC
AGTGACCAACGGGAACACAACGGTGCCACCCCTGAACGATGATCTGGACATCTTTGGACCGATGATTTCTAATCCCTTACCTGCAACTGT
CATGCCCCCAGCTCAGGGGACACCCTCTGCACCAGCAGCTGCAACCCTGTCTACAGTAACATCTGGGGATCTAGATTTATTCACTGAGCA
AACTACAAAATCAGAAGAAGTGGCAAAGAAACAACTTTCCAAAGACTCCATCTTATCTCTGTATGGCACAGGAACCATTCAACAGCAAAG
TACTCCTGGTGTATTTATGGGACCCACAAATATACCATTTACCTCACAAGCACCAGCTGCATTTCAGGGCTTTCCATCGATGGGCGTGCC
TGTGCCTGCAGCTCCTGGCCTTATAGGAAATGTGATGGGACAGAGTCCAAGCATGATGGTGGGCATGCCCATGCCCAATGGGTTTATGGG
AAATGCACAAACTGGTGTGATGCCACTTCCTCAGAACGTTGTTGGCCCCCAAGGAGGAATGGTGGGACAAATGGGTGCACCCCAGAGTAA
GTTTGGCCTGCCGCAAGCTCAGCAGCCCCAGTGGAGCCTCTCACAGATAATGCAGAAGGGTGATGCTGTTCTCCAGCACTCCATCAGTGC
AATCTACTGGCCAATGACAAGGTGGTTAAAATGTCCTTTAGTAGATGAATCAGCAGATGGCTGGCATGAGTATCAGTAGTGCAACCCCTA
CTGCAGGTTTTGGCCAGCCCTCCAGCACAACAGCAGGATGGTCTGGAAGCTCATCAGGTCAGACTCTCAGCACACAACTGTGGAAATGAA
AACTGCAATACAAGTTTCATCCAGAACTACCACCTGACATTCCTTGCTGAAACGCATCTAGTTCCCCTGTTTATTCATATGCATATTTTT
TTTCTTTTTACCCATTTGTTCATATTAAGAATGATCTGATTGACCGTGTTGGTCTGTACTGATTCAATTTGATGTGGTGAAAAGCAGGTT
GATAAATCATTTTATGTCAAGGGCAGCTTTGCTCATATTTCCCATGATTTCATGTACTGCATTATTTGAGAAGCTGCTCAACTTGCAAAA
TCAGTTTTCCTCTCAATAAAATTATAGCTCTAATGTTTGCATATAAGGGAAGTAGTTATCATGTTAGTAATACCTCTAATAGTATAAACC
CCACCCCAAAATTAGCCAGTAATCCTGTAGGAAGGTACTGTATGATCAAATGTTTAATCATATAAATAGAATGTAAATGTCTCACTGAGC
ACTGTTTTCTAGTGTATCAAAATGCTCTTATTTCATCATTCACTTCACTGTGCTGTTGTTATGATGTGCTTAACAGGGAACGTGATTAGT
GAAAGGAAGATAAACGTGGATGTTACTCCAAAACTTCGTTTAATGAATGCTTAAAGAATTCAAATTTTATCTGCCTCTCTTGTAATTTGG
ATCTCTTCTTAATGTACATAGTGCTAACATGAAGACCTTTTTCTGCACTATATGCAAACAGGGTAACTAACTAAAACAAAGCCACTTTCA
ATCTTCAATCCTTGAAGGTATATCTAGGTTTATGACAGTAATTGTGTTTACATTTTATGGTGCCTAGTATTGACAAAATGTTATTTCCCT

>In-frame_RARS2_ENST00000369536_chr6_88299640_-_SMAP1_ENST00000370455_chr6_71508360_+_2672nt
CGAGGCCGGAACTGGCGGACTGCGGCGCACTTCCGTAGAGGTGGACATGGCGTGCGGCTTTCGCCGCGCTATTGCTTGCCAGAAAGAAAA
GGAAAAAAAAAAGGAAGAGAAAAAGAGAGAAAAGGAGCCAGAAAAGCCGGCAAAACCACTTACAGCTGAAAAGCTGCAGAAGAAAGATCA
GCAACTGGAGCCTAAAAAAAGTACCAGCCCTAAAAAAGCTGCGGAGCCCACTGTGGATCTTTTAGGACTTGATGGCCCTGCTGTGGCACC
AGTGACCAACGGGAACACAACGGTGCCACCCCTGAACGATGATCTGGACATCTTTGGACCGATGATTTCTAATCCCTTACCTGCAACTGT
CATGCCCCCAGCTCAGGGGACACCCTCTGCACCAGCAGCTGCAACCCTGTCTACAGTAACATCTGGGGATCTAGATTTATTCACTGAGCA
AACTACAAAATCAGAAGAAGTGGCAAAGAAACAACTTTCCAAAGACTCCATCTTATCTCTGTATGGCACAGGAACCATTCAACAGCAAAG
TACTCCTGGTGTATTTATGGGACCCACAAATATACCATTTACCTCACAAGCACCAGCTGCATTTCAGGGCTTTCCATCGATGGGCGTGCC
TGTGCCTGCAGCTCCTGGCCTTATAGGAAATGTGATGGGACAGAGTCCAAGCATGATGGTGGGCATGCCCATGCCCAATGGGTTTATGGG
AAATGCACAAACTGGTGTGATGCCACTTCCTCAGAACGTTGTTGGCCCCCAAGGAGGAATGGTGGGACAAATGGGTGCACCCCAGAGTAA
GTTTGGCCTGCCGCAAGCTCAGCAGCCCCAGTGGAGCCTCTCACAGATGAATCAGCAGATGGCTGGCATGAGTATCAGTAGTGCAACCCC
TACTGCAGGTTTTGGCCAGCCCTCCAGCACAACAGCAGGATGGTCTGGAAGCTCATCAGGTCAGACTCTCAGCACACAACTGTGGAAATG
AAAACTGCAATACAAGTTTCATCCAGAACTACCACCTGACATTCCTTGCTGAAACGCATCTAGTTCCCCTGTTTATTCATATGCATATTT
TTTTTCTTTTTACCCATTTGTTCATATTAAGAATGATCTGATTGACCGTGTTGGTCTGTACTGATTCAATTTGATGTGGTGAAAAGCAGG
TTGATAAATCATTTTATGTCAAGGGCAGCTTTGCTCATATTTCCCATGATTTCATGTACTGCATTATTTGAGAAGCTGCTCAACTTGCAA
AATCAGTTTTCCTCTCAATAAAATTATAGCTCTAATGTTTGCATATAAGGGAAGTAGTTATCATGTTAGTAATACCTCTAATAGTATAAA
CCCCACCCCAAAATTAGCCAGTAATCCTGTAGGAAGGTACTGTATGATCAAATGTTTAATCATATAAATAGAATGTAAATGTCTCACTGA
GCACTGTTTTCTAGTGTATCAAAATGCTCTTATTTCATCATTCACTTCACTGTGCTGTTGTTATGATGTGCTTAACAGGGAACGTGATTA
GTGAAAGGAAGATAAACGTGGATGTTACTCCAAAACTTCGTTTAATGAATGCTTAAAGAATTCAAATTTTATCTGCCTCTCTTGTAATTT
GGATCTCTTCTTAATGTACATAGTGCTAACATGAAGACCTTTTTCTGCACTATATGCAAACAGGGTAACTAACTAAAACAAAGCCACTTT
CAATCTTCAATCCTTGAAGGTATATCTAGGTTTATGACAGTAATTGTGTTTACATTTTATGGTGCCTAGTATTGACAAAATGTTATTTCC
CTACATTAAACATGACTCCATAGACCTTTTCATTTGTGGGTTTTTATTTCCTATGATGTATACTGCCACTAACCTTCCAAAAATTACTTA
GTATTGCAAAGTCAGGAATCATCAGGAACGTTTAGCTGACAAAATACTTGTCTGTTTTAAAAACCTGTTCAAGTCTACCAACCTGTTCAA
GTCTACCAATTATAAGGGCAAATTGGAGAAAAAGAAAAAATATATACTCAAGAGTGGTATCTTGCAGTATCGGCACTGTACAAAAAAATC
TTCCAATTTAGTTGTTGTAGAGAAAACATGCAGAACAAATGAAGACAAAACATACATTTTGTACCAACCATCCAATTAGCTTATGTTAAC
TGACAAGCTCCATTTAAACAGATGTCCATCAGATGACAAGAAAGGCTGCTGTACTGAAGTAAAACAAACAATACCTGAATGCTCTGTAGC
CTAAACTCCAAACATCCTCTTCCATATGGATCCACTGGCTGGACAAACTGCACCAGTTGCTGCTTCAATTTATACCTCAATTTTCACTGT
GTCCAGGTGGTACTTTGGCTCGTTGGCTAGATTAACCTTCTCTGTCCGAGTGTGCCACACGAGAACCTGAAGGGGAAGGAAATAGCTTGG
GTAGCGCACTCTTCATGGTGACACTCGAGGTCGGGCAGCACAAGTGTAATGAATACCTTAGTGCAGTTATTTGCTTTCGGTTCCAGTTCT
TCGACTGTTGTTATCTGTTTGAGAAAGTCAGATTCTTGCATCCCTGGCTGGGATCCACGACGCTTAAATACAGCTTTTGGATTGGACAAA


Top

FusionGenePPI for RARS2_SMAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RARS2PHLDA3, LPAR6, CPS1, ATP12A, GFM2, PITRM1, GLS, PDPR, PCCA, PREPL, PLXDC2, MCCC1, CLN3, ARL8A, AARS2, NSDHL, NTRK1, IL13RA2, NPY2RSMAP1BRF2, PHLDA3, PTP4A3, WRAP73, APP, MICU2, HSPA1L, KLHL18, XPO1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RARS2_SMAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RARS2_SMAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource