FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30421

FusionGeneSummary for RAPGEF1_MCU

check button Fusion gene summary
Fusion gene informationFusion gene name: RAPGEF1_MCU
Fusion gene ID: 30421
HgeneTgene
Gene symbol

RAPGEF1

MCU

Gene ID

2889

90550

Gene nameRap guanine nucleotide exchange factor 1mitochondrial calcium uniporter
SynonymsC3G|GRF2C10orf42|CCDC109A|HsMCU
Cytomap

9q34.13

10q22.1

Type of geneprotein-codingprotein-coding
Descriptionrap guanine nucleotide exchange factor 1CRK SH3-binding GNRPRap guanine nucleotide exchange factor (GEF) 1guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene)calcium uniporter protein, mitochondrialcoiled-coil domain-containing protein 109A
Modification date2018052220180523
UniProtAcc

Q13905

Q8NE86

Ensembl transtripts involved in fusion geneENST00000372189, ENST00000372195, 
ENST00000372190, ENST00000481260, 
ENST00000373053, ENST00000357157, 
ENST00000536019, ENST00000605416, 
Fusion gene scores* DoF score17 X 14 X 10=23805 X 1 X 4=20
# samples 214
** MAII scorelog2(21/2380*10)=-3.50250034052918
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/20*10)=1
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RAPGEF1 [Title/Abstract] AND MCU [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRAPGEF1

GO:0038180

nerve growth factor signaling pathway

17724123

HgeneRAPGEF1

GO:0043547

positive regulation of GTPase activity

10548487

HgeneRAPGEF1

GO:0071320

cellular response to cAMP

21840392

HgeneRAPGEF1

GO:1990090

cellular response to nerve growth factor stimulus

17724123

TgeneMCU

GO:0006851

mitochondrial calcium ion transmembrane transport

21685888|24560927

TgeneMCU

GO:0019722

calcium-mediated signaling

21685886|21685888

TgeneMCU

GO:0036444

calcium import into the mitochondrion

22925203

TgeneMCU

GO:0051259

protein complex oligomerization

21685886

TgeneMCU

GO:0051561

positive regulation of mitochondrial calcium ion concentration

21685888|24560927


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-58-8386-01ARAPGEF1chr9

134615157

-MCUchr10

74594117

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000372189ENST00000373053RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-3CDSENST00000372189ENST00000357157RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-3CDSENST00000372189ENST00000536019RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-intronENST00000372189ENST00000605416RAPGEF1chr9

134615157

-MCUchr10

74594117

+
In-frameENST00000372195ENST00000373053RAPGEF1chr9

134615157

-MCUchr10

74594117

+
In-frameENST00000372195ENST00000357157RAPGEF1chr9

134615157

-MCUchr10

74594117

+
In-frameENST00000372195ENST00000536019RAPGEF1chr9

134615157

-MCUchr10

74594117

+
5CDS-intronENST00000372195ENST00000605416RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-3CDSENST00000372190ENST00000373053RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-3CDSENST00000372190ENST00000357157RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-3CDSENST00000372190ENST00000536019RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-intronENST00000372190ENST00000605416RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-3CDSENST00000481260ENST00000373053RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-3CDSENST00000481260ENST00000357157RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-3CDSENST00000481260ENST00000536019RAPGEF1chr9

134615157

-MCUchr10

74594117

+
intron-intronENST00000481260ENST00000605416RAPGEF1chr9

134615157

-MCUchr10

74594117

+

Top

FusionProtFeatures for RAPGEF1_MCU


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RAPGEF1

Q13905

MCU

Q8NE86

Guanine nucleotide-releasing protein that binds to SH3domain of CRK and GRB2/ASH. Transduces signals from CRK toactivate RAS. Plays a role in the establishment of basalendothelial barrier function. Plays a role in nerve growth factor(NGF)-induced sustained activation of Rap1 and neurite outgrowth.{ECO:0000269|PubMed:17724123, ECO:0000269|PubMed:21840392,ECO:0000269|PubMed:7806500}. Mitochondrial inner membrane calcium uniporter thatmediates calcium uptake into mitochondria (PubMed:21685888,PubMed:21685886, PubMed:23101630, PubMed:22904319,PubMed:23178883, PubMed:22829870, PubMed:22822213,PubMed:24332854, PubMed:23755363, PubMed:26341627). Constitutesthe pore-forming and calcium-conducting subunit of the uniportercomplex (uniplex) (PubMed:23755363). Activity is regulated byMICU1 and MICU2. At low Ca(2+) levels MCU activity is down-regulated by MICU1 and MICU2; at higher Ca(2+) levels MICU1increases MCU activity (PubMed:24560927, PubMed:26903221).Mitochondrial calcium homeostasis plays key roles in cellularphysiology and regulates cell bioenergetics, cytoplasmic calciumsignals and activation of cell death pathways. Involved inbuffering the amplitude of systolic calcium rises incardiomyocytes (PubMed:22822213). While dispensable for baselinehomeostatic cardiac function, acts as a key regulator of short-term mitochondrial calcium loading underlying a 'fight-or-flight'response during acute stress: acts by mediating a rapid increaseof mitochondrial calcium in pacemaker cells (PubMed:25603276).participates in mitochondrial permeability transition duringischemia-reperfusion injury (By similarity). Regulates glucose-dependent insulin secretion in pancreatic beta-cells by regulatingmitochondrial calcium uptake (PubMed:22904319, PubMed:22829870).Mitochondrial calcium uptake in skeletal muscle cells is involvedin muscle size in adults (By similarity). Regulates synapticvesicle endocytosis kinetics in central nerve terminal (Bysimilarity). Involved in antigen processing and presentation (Bysimilarity). {ECO:0000250|UniProtKB:Q3UMR5,ECO:0000269|PubMed:21685886, ECO:0000269|PubMed:21685888,ECO:0000269|PubMed:22822213, ECO:0000269|PubMed:22829870,ECO:0000269|PubMed:22904319, ECO:0000269|PubMed:23101630,ECO:0000269|PubMed:23178883, ECO:0000269|PubMed:23755363,ECO:0000269|PubMed:24332854, ECO:0000269|PubMed:24560927,ECO:0000269|PubMed:25603276, ECO:0000269|PubMed:26341627,ECO:0000269|PubMed:26903221}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for RAPGEF1_MCU


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RAPGEF1_ENST00000372195_chr9_134615157_-_MCU_ENST00000373053_chr10_74594117_+_322aa
MSGGLGLRRSPEMSGKIEKAGTPEDRFLAEFGSCLLQHCCAL__CYSGLSKWVTCDICEATIPA_TLSVHTQATL_LCWCIFTTTARRGS
GN_QSCTLFTRWCSRCCFNRNRPPPP__L_AGH__LNIPRTTTKKRPLKS_KCSNAE_CKDIGPATIHHTVH_AAPVKQGKGAT_KTRGS
QRAAGSPGKGTN_D_QKS_EEDHFGAMGWPCLHGHTVWHFGPAYLVGIFLGHHGASNILHHLWKCHGNVCIFCNDTPGICLSRSQRQTIL

>In-frame_RAPGEF1_ENST00000372195_chr9_134615157_-_MCU_ENST00000357157_chr10_74594117_+_301aa
MSGGLGLRRSPEMSGKIEKAGTPEDRFLAEFGSCLLQHCCAL__CYSGLSKWVTCDICEATIPA_TLSVHTQATL_LCWCIFTTTARRGS
GN_QSCTLFTRWCSRCCFNRNRPPPP__L_AGH__LNIPRTTTKKSRDGVLPCWPEWF_TPDLKLSTCLSLPKCRDTSRTN_D_QKS_EE
DHFGAMGWPCLHGHTVWHFGPAYLVGIFLGHHGASNILHHLWKCHGNVCIFCNDTPGICLSRSQRQTILTIFP_RSQKVTF_PREIQSTQ

>In-frame_RAPGEF1_ENST00000372195_chr9_134615157_-_MCU_ENST00000536019_chr10_74594117_+_322aa
MSGGLGLRRSPEMSGKIEKAGTPEDRFLAEFGSCLLQHCCAL__CYSGLSKWVTCDICEATIPA_TLSVHTQATL_LCWCIFTTTARRGS
GN_QSCTLFTRWCSRCCFNRNRPPPP__L_AGH__LNIPRTTTKKRPLKS_KCSNAE_CKDIGPATIHHTVH_AAPVKQGKGAT_KTRGS
QRAAGSPGKGTN_D_QKS_EEDHFGAMGWPCLHGHTVWHFGPAYLVGIFLGHHGASNILHHLWKCHGNVCIFCNDTPGICLSRSQRQTIL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RAPGEF1_ENST00000372195_chr9_134615157_-_MCU_ENST00000373053_chr10_74594117_+_967nt
ATGAGCGGCGGCCTCGGCCTCCGGCGCAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAGGTACACCAGAGGATCGCTTCCTGGCAGAA
TTTGGGAGCTGTTTATTGCAGCACTGTTGTGCCCTCTGATGATGTTACAGTGGTTTATCAAAATGGGTTACCTGTGATATCTGTGAGGCT
ACCATCCCGGCGTGAACGCTGTCAGTTCACACTCAAGCCTATCTCTGACTCTGTTGGTGTATTTTTACGACAACTGCAAGAAGAGGATCG
GGGAATTGACAGAGTTGCTATCTATTCACCAGATGGTGTTCGCGTTGCTGCTTCAACAGGAATAGACCTCCTCCTCCTTGATGACTTTAA
GCTGGTCATTAATGACTTAACATACCACGTACGACCACCAAAAAGAGACCTCTTAAGTCATGAAAATGCAGCAACGCTGAATGATGTAAA
GACATTGGTCCAGCAACTATACACCACACTGTGCATTGAGCAGCACCAGTTAAACAAGGAAAGGGAGCTTATTGAAAGACTAGAGGATCT
CAAAGAGCAGCTGGCTCCCCTGGAAAAGGTACGAATTGAGATTAGCAGAAAAGCTGAGAAGAGGACCACTTTGGTGCTATGGGGTGGCCT
TGCCTACATGGCCACACAGTTTGGCATTTTGGCCCGGCTTACCTGGTGGGAATATTCCTGGGACATCATGGAGCCAGTAACATACTTCAT
CACTTATGGAAGTGCCATGGCAATGTATGCATATTTTGTAATGACACGCCAGGAATATGTTTATCCAGAAGCCAGAGACAGACAATACTT
ACTATTTTTCCATAAAGGAGCCAAAAAGTCACGTTTTGACCTAGAGAAATACAATCAACTCAAGGATGCAATTGCTCAGGCAGAAATGGA

>In-frame_RAPGEF1_ENST00000372195_chr9_134615157_-_MCU_ENST00000357157_chr10_74594117_+_904nt
ATGAGCGGCGGCCTCGGCCTCCGGCGCAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAGGTACACCAGAGGATCGCTTCCTGGCAGAA
TTTGGGAGCTGTTTATTGCAGCACTGTTGTGCCCTCTGATGATGTTACAGTGGTTTATCAAAATGGGTTACCTGTGATATCTGTGAGGCT
ACCATCCCGGCGTGAACGCTGTCAGTTCACACTCAAGCCTATCTCTGACTCTGTTGGTGTATTTTTACGACAACTGCAAGAAGAGGATCG
GGGAATTGACAGAGTTGCTATCTATTCACCAGATGGTGTTCGCGTTGCTGCTTCAACAGGAATAGACCTCCTCCTCCTTGATGACTTTAA
GCTGGTCATTAATGACTTAACATACCACGTACGACCACCAAAAAGAGTAGAGATGGGGTTTTGCCATGTTGGCCAGAATGGTTTTGAACT
CCTGACCTCAAGTTATCTACCTGCCTCAGCCTCCCAAAGTGCCGAGATTATAGCCGTACGAATTGAGATTAGCAGAAAAGCTGAGAAGAG
GACCACTTTGGTGCTATGGGGTGGCCTTGCCTACATGGCCACACAGTTTGGCATTTTGGCCCGGCTTACCTGGTGGGAATATTCCTGGGA
CATCATGGAGCCAGTAACATACTTCATCACTTATGGAAGTGCCATGGCAATGTATGCATATTTTGTAATGACACGCCAGGAATATGTTTA
TCCAGAAGCCAGAGACAGACAATACTTACTATTTTTCCATAAAGGAGCCAAAAAGTCACGTTTTGACCTAGAGAAATACAATCAACTCAA
GGATGCAATTGCTCAGGCAGAAATGGACCTTAAGAGACTGAGAGACCCATTACAAGTACATCTGCCTCTCCGACAAATTGGTGAAAAAGA

>In-frame_RAPGEF1_ENST00000372195_chr9_134615157_-_MCU_ENST00000536019_chr10_74594117_+_967nt
ATGAGCGGCGGCCTCGGCCTCCGGCGCAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAGGTACACCAGAGGATCGCTTCCTGGCAGAA
TTTGGGAGCTGTTTATTGCAGCACTGTTGTGCCCTCTGATGATGTTACAGTGGTTTATCAAAATGGGTTACCTGTGATATCTGTGAGGCT
ACCATCCCGGCGTGAACGCTGTCAGTTCACACTCAAGCCTATCTCTGACTCTGTTGGTGTATTTTTACGACAACTGCAAGAAGAGGATCG
GGGAATTGACAGAGTTGCTATCTATTCACCAGATGGTGTTCGCGTTGCTGCTTCAACAGGAATAGACCTCCTCCTCCTTGATGACTTTAA
GCTGGTCATTAATGACTTAACATACCACGTACGACCACCAAAAAGAGACCTCTTAAGTCATGAAAATGCAGCAACGCTGAATGATGTAAA
GACATTGGTCCAGCAACTATACACCACACTGTGCATTGAGCAGCACCAGTTAAACAAGGAAAGGGAGCTTATTGAAAGACTAGAGGATCT
CAAAGAGCAGCTGGCTCCCCTGGAAAAGGTACGAATTGAGATTAGCAGAAAAGCTGAGAAGAGGACCACTTTGGTGCTATGGGGTGGCCT
TGCCTACATGGCCACACAGTTTGGCATTTTGGCCCGGCTTACCTGGTGGGAATATTCCTGGGACATCATGGAGCCAGTAACATACTTCAT
CACTTATGGAAGTGCCATGGCAATGTATGCATATTTTGTAATGACACGCCAGGAATATGTTTATCCAGAAGCCAGAGACAGACAATACTT
ACTATTTTTCCATAAAGGAGCCAAAAAGTCACGTTTTGACCTAGAGAAATACAATCAACTCAAGGATGCAATTGCTCAGGCAGAAATGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RAPGEF1_ENST00000372195_chr9_134615157_-_MCU_ENST00000373053_chr10_74594117_+_3083nt
CGCTGCGCTGCGGCCGGCTCGCGGGCCGGGGGAGCGGCGGCGGGCGCGCGGGAGGCGGAGCGGCGGCGGCGGGCGCGGCGGGAGCGGCTG
GGCCCGGGCGGGCTGGAGCGCGGTCGCCGAGCGCAGGGCCGCGGCCGCGCGGAGCCCGCCATGCCGGCGCGGGTCTGAGGCGTGGCGAGC
CAGGGCCGAGGCGAGCGGCGGGCGCGCCGCCCCTGTCGCCCCGCGGCGGCCCGGCCCGGGCCCGATGAGCGGCGGCCTCGGCCTCCGGCG
CAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAGGTACACCAGAGGATCGCTTCCTGGCAGAATTTGGGAGCTGTTTATTGCAGCACTG
TTGTGCCCTCTGATGATGTTACAGTGGTTTATCAAAATGGGTTACCTGTGATATCTGTGAGGCTACCATCCCGGCGTGAACGCTGTCAGT
TCACACTCAAGCCTATCTCTGACTCTGTTGGTGTATTTTTACGACAACTGCAAGAAGAGGATCGGGGAATTGACAGAGTTGCTATCTATT
CACCAGATGGTGTTCGCGTTGCTGCTTCAACAGGAATAGACCTCCTCCTCCTTGATGACTTTAAGCTGGTCATTAATGACTTAACATACC
ACGTACGACCACCAAAAAGAGACCTCTTAAGTCATGAAAATGCAGCAACGCTGAATGATGTAAAGACATTGGTCCAGCAACTATACACCA
CACTGTGCATTGAGCAGCACCAGTTAAACAAGGAAAGGGAGCTTATTGAAAGACTAGAGGATCTCAAAGAGCAGCTGGCTCCCCTGGAAA
AGGTACGAATTGAGATTAGCAGAAAAGCTGAGAAGAGGACCACTTTGGTGCTATGGGGTGGCCTTGCCTACATGGCCACACAGTTTGGCA
TTTTGGCCCGGCTTACCTGGTGGGAATATTCCTGGGACATCATGGAGCCAGTAACATACTTCATCACTTATGGAAGTGCCATGGCAATGT
ATGCATATTTTGTAATGACACGCCAGGAATATGTTTATCCAGAAGCCAGAGACAGACAATACTTACTATTTTTCCATAAAGGAGCCAAAA
AGTCACGTTTTGACCTAGAGAAATACAATCAACTCAAGGATGCAATTGCTCAGGCAGAAATGGACCTTAAGAGACTGAGAGACCCATTAC
AAGTACATCTGCCTCTCCGACAAATTGGTGAAAAAGATTGATCTGCAAAAAGCCTCTGAATCCTGGCAGAAGGAACACCTGTTTGCCTTT
TTAATTAAAGCATTGCAGGTGGAAGCTGGGAGCCATGTGGGGGGTAGAGCGTTTTTACCTTTAATTATAAAACAAAAACAGAAAGGATCT
GAGGGAAGAAGGGAATGTTAAAACCTGAGGATCAGGCATTGTGGAATATAAGCTCAAAGGGCTTAGTGAATATTGTCTTAACCAAGTATC
TCAGTTTCTGGATGAAAATGATGCAGTTATATAGTTGAGAGATTCATAAAGAGAAAACAATGCTGGGGGTGTTCGTTTCTTGCATCTTCT
TTGCAGAGTCAGCAAAAGAGTAACACACCAGCACCCCACTCGACTCTATTTGTTTTTAATTTAACTGTCCCTATTTTTGACATAGGAGTA
AATAAATATACTAGAAAAGCAAATTCTCATGATATGCTAAAATATCATTAGCATTTATTTTAAATTGGACCCAGTCTCTGCAGAGTTACC
AGGAATCTTTCCTTCCAGCATCCCTTTACTGACCACCTACCTGTACCTCTTGGTTACACTCATTTTTTCCATTTGATAATTGGAACCAAC
TTATAACTGTTTAATAATTGACACTTTAGATTATCTCTTAATACCTTCTTAAATGTCTATATATCCCAGTGCTCTGGATCAGTGTCTAAA
AATCACTGGCAACACTGCATGAGGTTGTTGGTTTTGTTTTGTTTTATTAATTAGTCTTTCACAGGAGGAATAATTGCCCTCCTTTATATA
CTTATCTATTGATAATCCCCTCTCCCTCCAGAACACAAATCAGAGGGAAAGGGGGTGTTCAGCTGTACTACCAAATCAGGAAGATGTAAG
GTTTACAAATTGGCTAAGAATCATGGCTCTGTAGCCATTTCAACCAGAATAATTTTATTGCTAATCTGCTTTGTGTGACAGCATTCCAGG
CCAGCCAGATGGGACTGCCTTGTCTGGAGGCTTTGTTCATCTCGAAGGACACACACTTCCACACTGTTTGTGAGCCCTCCCACCTCCACA
ACTTCAGTTGTAAATCAAGTGTGTGGATCTCAAAGGGTGCAATTTATCTTTATATAGGAATACATTTCTAGGGCTTCCTTCAAGCCCACT
CTCTTCACCCTATTTTTTCTTATCTTAAATTGAGAGAAAGAGAATTAATCTTATACTTTGTCAAAACATTTTCTACCATATTTCCAGATG
ACATCTGCGCTTGAAGAGTCAAAGGAATCTGTGTCTAATATCCTGTTTTTAACTGCTGTAGGGGCAGGATGGAAAGGATGATGGGGGCTG
CCACACCACTGATTGGCCTTTTCTTTCACGTGATTCATCCTTCCTCATTGTGGCAAGGAGTTTCTTTCTCTTTTTCTTCCTCCTTTGGGA
TCATTGTGTATGAAAAGAAAAACTTTAAATGACAAACCCAGACTCCAGGTGCCTTGCAAAGGTTGAAGGCCAGCCAGGATTGCTGCTGCT
GCTGCTACTCCTGCCAACACCCCTTTCATTGGCATGACGGAATGAAAGGATGCATGTCTCCACTTCCTGACCCTCCGCCCACTTCCTTCT
CCCTCCACCACCCCCAGTCGTCAGCTCCTTCCCTCATTTATTTTTGTTAAGTTGTGTGAATTATTTTTAACCCATTTATCCTGTTTGTGC
ATAGGGTTTTTAAGAAGAAACAGCACAGTGCAACGAGCAAATCTTTTTGGGGTGTGTGGGAAGCAAGGGAGGGAGGACATGGAGAAAAGT
TCTTTAAACAAATAGCAAACTATTGAACATGTGTAAAATCCTGTATCATTTATGAAATATGTATAAAAAGCAATGTACCTTCTGGAACAA

>In-frame_RAPGEF1_ENST00000372195_chr9_134615157_-_MCU_ENST00000357157_chr10_74594117_+_3020nt
CGCTGCGCTGCGGCCGGCTCGCGGGCCGGGGGAGCGGCGGCGGGCGCGCGGGAGGCGGAGCGGCGGCGGCGGGCGCGGCGGGAGCGGCTG
GGCCCGGGCGGGCTGGAGCGCGGTCGCCGAGCGCAGGGCCGCGGCCGCGCGGAGCCCGCCATGCCGGCGCGGGTCTGAGGCGTGGCGAGC
CAGGGCCGAGGCGAGCGGCGGGCGCGCCGCCCCTGTCGCCCCGCGGCGGCCCGGCCCGGGCCCGATGAGCGGCGGCCTCGGCCTCCGGCG
CAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAGGTACACCAGAGGATCGCTTCCTGGCAGAATTTGGGAGCTGTTTATTGCAGCACTG
TTGTGCCCTCTGATGATGTTACAGTGGTTTATCAAAATGGGTTACCTGTGATATCTGTGAGGCTACCATCCCGGCGTGAACGCTGTCAGT
TCACACTCAAGCCTATCTCTGACTCTGTTGGTGTATTTTTACGACAACTGCAAGAAGAGGATCGGGGAATTGACAGAGTTGCTATCTATT
CACCAGATGGTGTTCGCGTTGCTGCTTCAACAGGAATAGACCTCCTCCTCCTTGATGACTTTAAGCTGGTCATTAATGACTTAACATACC
ACGTACGACCACCAAAAAGAGTAGAGATGGGGTTTTGCCATGTTGGCCAGAATGGTTTTGAACTCCTGACCTCAAGTTATCTACCTGCCT
CAGCCTCCCAAAGTGCCGAGATTATAGCCGTACGAATTGAGATTAGCAGAAAAGCTGAGAAGAGGACCACTTTGGTGCTATGGGGTGGCC
TTGCCTACATGGCCACACAGTTTGGCATTTTGGCCCGGCTTACCTGGTGGGAATATTCCTGGGACATCATGGAGCCAGTAACATACTTCA
TCACTTATGGAAGTGCCATGGCAATGTATGCATATTTTGTAATGACACGCCAGGAATATGTTTATCCAGAAGCCAGAGACAGACAATACT
TACTATTTTTCCATAAAGGAGCCAAAAAGTCACGTTTTGACCTAGAGAAATACAATCAACTCAAGGATGCAATTGCTCAGGCAGAAATGG
ACCTTAAGAGACTGAGAGACCCATTACAAGTACATCTGCCTCTCCGACAAATTGGTGAAAAAGATTGATCTGCAAAAAGCCTCTGAATCC
TGGCAGAAGGAACACCTGTTTGCCTTTTTAATTAAAGCATTGCAGGTGGAAGCTGGGAGCCATGTGGGGGGTAGAGCGTTTTTACCTTTA
ATTATAAAACAAAAACAGAAAGGATCTGAGGGAAGAAGGGAATGTTAAAACCTGAGGATCAGGCATTGTGGAATATAAGCTCAAAGGGCT
TAGTGAATATTGTCTTAACCAAGTATCTCAGTTTCTGGATGAAAATGATGCAGTTATATAGTTGAGAGATTCATAAAGAGAAAACAATGC
TGGGGGTGTTCGTTTCTTGCATCTTCTTTGCAGAGTCAGCAAAAGAGTAACACACCAGCACCCCACTCGACTCTATTTGTTTTTAATTTA
ACTGTCCCTATTTTTGACATAGGAGTAAATAAATATACTAGAAAAGCAAATTCTCATGATATGCTAAAATATCATTAGCATTTATTTTAA
ATTGGACCCAGTCTCTGCAGAGTTACCAGGAATCTTTCCTTCCAGCATCCCTTTACTGACCACCTACCTGTACCTCTTGGTTACACTCAT
TTTTTCCATTTGATAATTGGAACCAACTTATAACTGTTTAATAATTGACACTTTAGATTATCTCTTAATACCTTCTTAAATGTCTATATA
TCCCAGTGCTCTGGATCAGTGTCTAAAAATCACTGGCAACACTGCATGAGGTTGTTGGTTTTGTTTTGTTTTATTAATTAGTCTTTCACA
GGAGGAATAATTGCCCTCCTTTATATACTTATCTATTGATAATCCCCTCTCCCTCCAGAACACAAATCAGAGGGAAAGGGGGTGTTCAGC
TGTACTACCAAATCAGGAAGATGTAAGGTTTACAAATTGGCTAAGAATCATGGCTCTGTAGCCATTTCAACCAGAATAATTTTATTGCTA
ATCTGCTTTGTGTGACAGCATTCCAGGCCAGCCAGATGGGACTGCCTTGTCTGGAGGCTTTGTTCATCTCGAAGGACACACACTTCCACA
CTGTTTGTGAGCCCTCCCACCTCCACAACTTCAGTTGTAAATCAAGTGTGTGGATCTCAAAGGGTGCAATTTATCTTTATATAGGAATAC
ATTTCTAGGGCTTCCTTCAAGCCCACTCTCTTCACCCTATTTTTTCTTATCTTAAATTGAGAGAAAGAGAATTAATCTTATACTTTGTCA
AAACATTTTCTACCATATTTCCAGATGACATCTGCGCTTGAAGAGTCAAAGGAATCTGTGTCTAATATCCTGTTTTTAACTGCTGTAGGG
GCAGGATGGAAAGGATGATGGGGGCTGCCACACCACTGATTGGCCTTTTCTTTCACGTGATTCATCCTTCCTCATTGTGGCAAGGAGTTT
CTTTCTCTTTTTCTTCCTCCTTTGGGATCATTGTGTATGAAAAGAAAAACTTTAAATGACAAACCCAGACTCCAGGTGCCTTGCAAAGGT
TGAAGGCCAGCCAGGATTGCTGCTGCTGCTGCTACTCCTGCCAACACCCCTTTCATTGGCATGACGGAATGAAAGGATGCATGTCTCCAC
TTCCTGACCCTCCGCCCACTTCCTTCTCCCTCCACCACCCCCAGTCGTCAGCTCCTTCCCTCATTTATTTTTGTTAAGTTGTGTGAATTA
TTTTTAACCCATTTATCCTGTTTGTGCATAGGGTTTTTAAGAAGAAACAGCACAGTGCAACGAGCAAATCTTTTTGGGGTGTGTGGGAAG
CAAGGGAGGGAGGACATGGAGAAAAGTTCTTTAAACAAATAGCAAACTATTGAACATGTGTAAAATCCTGTATCATTTATGAAATATGTA

>In-frame_RAPGEF1_ENST00000372195_chr9_134615157_-_MCU_ENST00000536019_chr10_74594117_+_3081nt
CGCTGCGCTGCGGCCGGCTCGCGGGCCGGGGGAGCGGCGGCGGGCGCGCGGGAGGCGGAGCGGCGGCGGCGGGCGCGGCGGGAGCGGCTG
GGCCCGGGCGGGCTGGAGCGCGGTCGCCGAGCGCAGGGCCGCGGCCGCGCGGAGCCCGCCATGCCGGCGCGGGTCTGAGGCGTGGCGAGC
CAGGGCCGAGGCGAGCGGCGGGCGCGCCGCCCCTGTCGCCCCGCGGCGGCCCGGCCCGGGCCCGATGAGCGGCGGCCTCGGCCTCCGGCG
CAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAGGTACACCAGAGGATCGCTTCCTGGCAGAATTTGGGAGCTGTTTATTGCAGCACTG
TTGTGCCCTCTGATGATGTTACAGTGGTTTATCAAAATGGGTTACCTGTGATATCTGTGAGGCTACCATCCCGGCGTGAACGCTGTCAGT
TCACACTCAAGCCTATCTCTGACTCTGTTGGTGTATTTTTACGACAACTGCAAGAAGAGGATCGGGGAATTGACAGAGTTGCTATCTATT
CACCAGATGGTGTTCGCGTTGCTGCTTCAACAGGAATAGACCTCCTCCTCCTTGATGACTTTAAGCTGGTCATTAATGACTTAACATACC
ACGTACGACCACCAAAAAGAGACCTCTTAAGTCATGAAAATGCAGCAACGCTGAATGATGTAAAGACATTGGTCCAGCAACTATACACCA
CACTGTGCATTGAGCAGCACCAGTTAAACAAGGAAAGGGAGCTTATTGAAAGACTAGAGGATCTCAAAGAGCAGCTGGCTCCCCTGGAAA
AGGTACGAATTGAGATTAGCAGAAAAGCTGAGAAGAGGACCACTTTGGTGCTATGGGGTGGCCTTGCCTACATGGCCACACAGTTTGGCA
TTTTGGCCCGGCTTACCTGGTGGGAATATTCCTGGGACATCATGGAGCCAGTAACATACTTCATCACTTATGGAAGTGCCATGGCAATGT
ATGCATATTTTGTAATGACACGCCAGGAATATGTTTATCCAGAAGCCAGAGACAGACAATACTTACTATTTTTCCATAAAGGAGCCAAAA
AGTCACGTTTTGACCTAGAGAAATACAATCAACTCAAGGATGCAATTGCTCAGGCAGAAATGGACCTTAAGAGACTGAGAGACCCATTAC
AAGTACATCTGCCTCTCCGACAAATTGGTGAAAAAGATTGATCTGCAAAAAGCCTCTGAATCCTGGCAGAAGGAACACCTGTTTGCCTTT
TTAATTAAAGCATTGCAGGTGGAAGCTGGGAGCCATGTGGGGGGTAGAGCGTTTTTACCTTTAATTATAAAACAAAAACAGAAAGGATCT
GAGGGAAGAAGGGAATGTTAAAACCTGAGGATCAGGCATTGTGGAATATAAGCTCAAAGGGCTTAGTGAATATTGTCTTAACCAAGTATC
TCAGTTTCTGGATGAAAATGATGCAGTTATATAGTTGAGAGATTCATAAAGAGAAAACAATGCTGGGGGTGTTCGTTTCTTGCATCTTCT
TTGCAGAGTCAGCAAAAGAGTAACACACCAGCACCCCACTCGACTCTATTTGTTTTTAATTTAACTGTCCCTATTTTTGACATAGGAGTA
AATAAATATACTAGAAAAGCAAATTCTCATGATATGCTAAAATATCATTAGCATTTATTTTAAATTGGACCCAGTCTCTGCAGAGTTACC
AGGAATCTTTCCTTCCAGCATCCCTTTACTGACCACCTACCTGTACCTCTTGGTTACACTCATTTTTTCCATTTGATAATTGGAACCAAC
TTATAACTGTTTAATAATTGACACTTTAGATTATCTCTTAATACCTTCTTAAATGTCTATATATCCCAGTGCTCTGGATCAGTGTCTAAA
AATCACTGGCAACACTGCATGAGGTTGTTGGTTTTGTTTTGTTTTATTAATTAGTCTTTCACAGGAGGAATAATTGCCCTCCTTTATATA
CTTATCTATTGATAATCCCCTCTCCCTCCAGAACACAAATCAGAGGGAAAGGGGGTGTTCAGCTGTACTACCAAATCAGGAAGATGTAAG
GTTTACAAATTGGCTAAGAATCATGGCTCTGTAGCCATTTCAACCAGAATAATTTTATTGCTAATCTGCTTTGTGTGACAGCATTCCAGG
CCAGCCAGATGGGACTGCCTTGTCTGGAGGCTTTGTTCATCTCGAAGGACACACACTTCCACACTGTTTGTGAGCCCTCCCACCTCCACA
ACTTCAGTTGTAAATCAAGTGTGTGGATCTCAAAGGGTGCAATTTATCTTTATATAGGAATACATTTCTAGGGCTTCCTTCAAGCCCACT
CTCTTCACCCTATTTTTTCTTATCTTAAATTGAGAGAAAGAGAATTAATCTTATACTTTGTCAAAACATTTTCTACCATATTTCCAGATG
ACATCTGCGCTTGAAGAGTCAAAGGAATCTGTGTCTAATATCCTGTTTTTAACTGCTGTAGGGGCAGGATGGAAAGGATGATGGGGGCTG
CCACACCACTGATTGGCCTTTTCTTTCACGTGATTCATCCTTCCTCATTGTGGCAAGGAGTTTCTTTCTCTTTTTCTTCCTCCTTTGGGA
TCATTGTGTATGAAAAGAAAAACTTTAAATGACAAACCCAGACTCCAGGTGCCTTGCAAAGGTTGAAGGCCAGCCAGGATTGCTGCTGCT
GCTGCTACTCCTGCCAACACCCCTTTCATTGGCATGACGGAATGAAAGGATGCATGTCTCCACTTCCTGACCCTCCGCCCACTTCCTTCT
CCCTCCACCACCCCCAGTCGTCAGCTCCTTCCCTCATTTATTTTTGTTAAGTTGTGTGAATTATTTTTAACCCATTTATCCTGTTTGTGC
ATAGGGTTTTTAAGAAGAAACAGCACAGTGCAACGAGCAAATCTTTTTGGGGTGTGTGGGAAGCAAGGGAGGGAGGACATGGAGAAAAGT
TCTTTAAACAAATAGCAAACTATTGAACATGTGTAAAATCCTGTATCATTTATGAAATATGTATAAAAAGCAATGTACCTTCTGGAACAA


Top

FusionGenePPI for RAPGEF1_MCU


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RAPGEF1BCAR1, HCK, CRKL, NEDD9, GRB2, CRK, SHC1, CBL, ATXN1, MBIP, RPS15, SLC20A1, MOV10, NXF1, ABL1, EGFR, SPATS2L, RAP1A, RAP2BMCUICT1, ELAVL1, ABCC1, SLC38A2, SLC1A5, ERLIN2, COLEC10, GNAI2, NYX, NDUFA9, MYC, RAB7A, VAPA, GOLT1B, ZNF526, NDUFA4, ASPH, TOR1AIP2, EDEM2, SLC5A8, APLNR, SLC22A6, IRGC, PDCD1, SLC15A1, ARMC6, IL13RA2, SMDT1, EIF2B1, EIF2B2, EIF2B4, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RAPGEF1_MCU


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RAPGEF1_MCU


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource