FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30314

FusionGeneSummary for RALY_WDR53

check button Fusion gene summary
Fusion gene informationFusion gene name: RALY_WDR53
Fusion gene ID: 30314
HgeneTgene
Gene symbol

RALY

WDR53

Gene ID

22913

348793

Gene nameRALY heterogeneous nuclear ribonucleoproteinWD repeat domain 53
SynonymsHNRPCL2|P542-
Cytomap

20q11.22

3q29

Type of geneprotein-codingprotein-coding
DescriptionRNA-binding protein RalyRNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog)RNA-binding protein (autoantigenic)RNA-binding protein (autoantigenic, hnRNP-associated with lethal yellow)autoantigen p542heterogeneous nuclear rWD repeat-containing protein 53WD domain, G-beta repeat-containing protein
Modification date2018052320180519
UniProtAcc

Q9UKM9

Q7Z5U6

Ensembl transtripts involved in fusion geneENST00000375114, ENST00000246194, 
ENST00000493399, 
ENST00000332629, 
ENST00000429115, ENST00000433160, 
Fusion gene scores* DoF score17 X 10 X 11=18703 X 1 X 2=6
# samples 203
** MAII scorelog2(20/1870*10)=-3.22496636500027
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/6*10)=2.32192809488736
Context

PubMed: RALY [Title/Abstract] AND WDR53 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-ZS-A9CF-01ARALYchr20

32660011

+WDR53chr3

196281678

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375114ENST00000332629RALYchr20

32660011

+WDR53chr3

196281678

-
5CDS-5UTRENST00000375114ENST00000429115RALYchr20

32660011

+WDR53chr3

196281678

-
5CDS-5UTRENST00000375114ENST00000433160RALYchr20

32660011

+WDR53chr3

196281678

-
In-frameENST00000246194ENST00000332629RALYchr20

32660011

+WDR53chr3

196281678

-
5CDS-5UTRENST00000246194ENST00000429115RALYchr20

32660011

+WDR53chr3

196281678

-
5CDS-5UTRENST00000246194ENST00000433160RALYchr20

32660011

+WDR53chr3

196281678

-
3UTR-3CDSENST00000493399ENST00000332629RALYchr20

32660011

+WDR53chr3

196281678

-
3UTR-5UTRENST00000493399ENST00000429115RALYchr20

32660011

+WDR53chr3

196281678

-
3UTR-5UTRENST00000493399ENST00000433160RALYchr20

32660011

+WDR53chr3

196281678

-

Top

FusionProtFeatures for RALY_WDR53


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RALY

Q9UKM9

WDR53

Q7Z5U6

RNA-binding protein that acts as a transcriptionalcofactor for cholesterol biosynthetic genes in the liver. Bindsthe lipid-responsive non-coding RNA LeXis and is required forLeXis-mediated effect on cholesterogenesis (By similarity). May bea heterogeneous nuclear ribonucleoprotein (hnRNP)(PubMed:9376072). {ECO:0000250|UniProtKB:Q64012,ECO:0000269|PubMed:9376072}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneWDR53chr20:32660011chr3:196281678ENST00000332629-24173_225160359RepeatNote=WD 5
TgeneWDR53chr20:32660011chr3:196281678ENST00000332629-24232_270160359RepeatNote=WD 6
TgeneWDR53chr20:32660011chr3:196281678ENST00000332629-24314_355160359RepeatNote=WD 7

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRALYchr20:32660011chr3:196281678ENST00000246194+110183_216-168291Coiled coilOntology_term=ECO:0000255
HgeneRALYchr20:32660011chr3:196281678ENST00000375114+19183_216-193249Coiled coilOntology_term=ECO:0000255
HgeneRALYchr20:32660011chr3:196281678ENST00000246194+110225_251-168291Compositional biasNote=Poly-Gly
HgeneRALYchr20:32660011chr3:196281678ENST00000375114+19225_251-193249Compositional biasNote=Poly-Gly
HgeneRALYchr20:32660011chr3:196281678ENST00000246194+11021_92-168291DomainRRM
HgeneRALYchr20:32660011chr3:196281678ENST00000375114+1921_92-193249DomainRRM
HgeneRALYchr20:32660011chr3:196281678ENST00000246194+110227_253-168291RegionNote=Epitope (recognized by BKRF1 antibodies)
HgeneRALYchr20:32660011chr3:196281678ENST00000375114+19227_253-193249RegionNote=Epitope (recognized by BKRF1 antibodies)
TgeneWDR53chr20:32660011chr3:196281678ENST00000332629-24127_166160359RepeatNote=WD 4
TgeneWDR53chr20:32660011chr3:196281678ENST00000332629-241_38160359RepeatNote=WD 1
TgeneWDR53chr20:32660011chr3:196281678ENST00000332629-2443_80160359RepeatNote=WD 2
TgeneWDR53chr20:32660011chr3:196281678ENST00000332629-2485_123160359RepeatNote=WD 3


Top

FusionGeneSequence for RALY_WDR53


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RALY_ENST00000375114_chr20_32660011_+_WDR53_ENST00000332629_chr3_196281678_-_284aa
MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKTGRVAGCSVHKGTAFVQYSNERHARAAVLGENGRVLAGQTLGDAVE
SSKSPTTLDYKFTGG_NRRNGRPTVTWSALKPCPSPFTLCGFVW_TF_LWCRRW_GSNLSGDGS_V_TGTGI_GPHFRGIPGLLSPRILF
AAYWRE_WEDHVVGCKQ_S_EKTEESHKTYPQEET_KRNLHQAGWKY_RFSNR_GRTWQHFTKAKT_TWRKSELALGYKNKGTPKTISS_

>In-frame_RALY_ENST00000246194_chr20_32660011_+_WDR53_ENST00000332629_chr3_196281678_-_284aa
MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKTGRVAGCSVHKGTAFVQYSNERHARAAVLGENGRVLAGQTLGDAVE
SSKSPTTLDYKFTGG_NRRNGRPTVTWSALKPCPSPFTLCGFVW_TF_LWCRRW_GSNLSGDGS_V_TGTGI_GPHFRGIPGLLSPRILF
AAYWRE_WEDHVVGCKQ_S_EKTEESHKTYPQEET_KRNLHQAGWKY_RFSNR_GRTWQHFTKAKT_TWRKSELALGYKNKGTPKTISS_


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RALY_ENST00000375114_chr20_32660011_+_WDR53_ENST00000332629_chr3_196281678_-_853nt
ATGTCCTTGAAGCTTCAGGCAAGCAATGTAACCAACAAGAATGACCCCAAGTCCATCAACTCTCGAGTCTTCATTGGAAACCTCAACACA
GCTCTGGTGAAGAAATCAGATGTGGAGACCATCTTCTCTAAGTATGGCCGTGTGGCCGGCTGTTCTGTGCACAAGGGCTATGCCTTTGTT
CAGTACTCCAATGAGCGCCATGCCCGGGCAGCTGTGCTGGGAGAGAATGGGCGGGTGCTGGCCGGGCAGACCCTGGGTGATGCTGTGGAG
TCTTCAAAAAGCCCGACCACTCTGGATTACAAATTTACAGGAGGATGAAACAGAAGAAATGGAAGGCCCACAGTCACCTGGTCAGCTCTT
AAACCCTGCCCTAGCCCATTCTATCTCTGTGGCTTCGTGTGGTAATATTTTTAGTTGTGGTGCAGAAGATGGTAAGGTTCGAATCTTTCG
GGTGATGGGAGTTAAGTGTGAACAGGAACTGGGATTTAAGGGCCACACTTCAGGGGTATCCCAGGTCTGCTTTCTCCCAGAATCCTATTT
GCTGCTTACTGGAGGGAATGATGGGAAGATCACGTTGTGGGATGCAAACAGTGAAGTTGAGAAAAAACAGAAGAGTCCCACAAAACGTAC
CCACAGGAAGAAACCTAAAAGAGGAACTTGCACCAAGCAGGGTGGAAATACTAACGCTTCAGTAACAGATGAGGAAGAACATGGCAACAT
TTTACCAAAGCTAAATATTGAACATGGAGAAAAAGTGAACTGGCTCTTGGGTACAAAAATAAAGGGACACCAAAATATATTAGTAGCTGA

>In-frame_RALY_ENST00000246194_chr20_32660011_+_WDR53_ENST00000332629_chr3_196281678_-_853nt
ATGTCCTTGAAGCTTCAGGCAAGCAATGTAACCAACAAGAATGACCCCAAGTCCATCAACTCTCGAGTCTTCATTGGAAACCTCAACACA
GCTCTGGTGAAGAAATCAGATGTGGAGACCATCTTCTCTAAGTATGGCCGTGTGGCCGGCTGTTCTGTGCACAAGGGCTATGCCTTTGTT
CAGTACTCCAATGAGCGCCATGCCCGGGCAGCTGTGCTGGGAGAGAATGGGCGGGTGCTGGCCGGGCAGACCCTGGGTGATGCTGTGGAG
TCTTCAAAAAGCCCGACCACTCTGGATTACAAATTTACAGGAGGATGAAACAGAAGAAATGGAAGGCCCACAGTCACCTGGTCAGCTCTT
AAACCCTGCCCTAGCCCATTCTATCTCTGTGGCTTCGTGTGGTAATATTTTTAGTTGTGGTGCAGAAGATGGTAAGGTTCGAATCTTTCG
GGTGATGGGAGTTAAGTGTGAACAGGAACTGGGATTTAAGGGCCACACTTCAGGGGTATCCCAGGTCTGCTTTCTCCCAGAATCCTATTT
GCTGCTTACTGGAGGGAATGATGGGAAGATCACGTTGTGGGATGCAAACAGTGAAGTTGAGAAAAAACAGAAGAGTCCCACAAAACGTAC
CCACAGGAAGAAACCTAAAAGAGGAACTTGCACCAAGCAGGGTGGAAATACTAACGCTTCAGTAACAGATGAGGAAGAACATGGCAACAT
TTTACCAAAGCTAAATATTGAACATGGAGAAAAAGTGAACTGGCTCTTGGGTACAAAAATAAAGGGACACCAAAATATATTAGTAGCTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RALY_ENST00000375114_chr20_32660011_+_WDR53_ENST00000332629_chr3_196281678_-_1654nt
CTTTGTTCTTTTATGCTAAAAAATAAAATTCCCCAGAGTGCTTACAATCTCTCCTCCCACTCCCTTTTTCCTGCCCTAAATAAATAATGG
CGAATGAGCACCCAGCCAGGGATGTGTCTGATCAAACAATCATGGATCAATAGCTATGTTTGGAGAAGGAATTTGTGGCTGCTCCAGCTA
CTGGGCATTTTGTCTGGTCCAGTTCATGTAATCTCCCAACACCCCATGAAGCAAGGCTTTGTTAATCCTATTTTACTGAAAATGAACTAA
GACTCAGAGAGATAAAGCTGTTGCCCAATGAGCCTTCTTTCTGCCCTCCAGATCCACGGTGCTAATTCCCCTTCCGATGACCTAATGATT
CTGAGCTTGGCAAAGGTCTTATCTCCCAGCTCGCCCAGGCCCAGTGTTCCAGGAATGTGACCTTTGCTGCAGCAGCCGCTGGAGGGGGCA
GAGGGGATGGGCTGGAGGTTGAGCAAACAGAGCAGCAGAAAAGGCAGTTCCTCTTCTCCAGTGCCCTCCTTCCCTGTCTCTGCCTCTCCC
TCCCTTCCTCAGGCATCAGAGCGGAGACTTCAGGGAGACCAGAGCCCAGCTTGCCAGGCACTGAGCTAGAAGCCCTGCCATGGCACCCCT
GAGACCCCTTCTCATACTGGCCCTGCTGGCATGGGTTGCTCTGGCTGACCAAGGTGAGCCCTATTCCCAGAGGCAGGTGGTGCTGACCCT
GTAACCCAAAGGAGGAAACAGCTGGCTAAGCTCATCATTGTTACTGGTGGGCACCATGTCCTTGAAGCTTCAGGCAAGCAATGTAACCAA
CAAGAATGACCCCAAGTCCATCAACTCTCGAGTCTTCATTGGAAACCTCAACACAGCTCTGGTGAAGAAATCAGATGTGGAGACCATCTT
CTCTAAGTATGGCCGTGTGGCCGGCTGTTCTGTGCACAAGGGCTATGCCTTTGTTCAGTACTCCAATGAGCGCCATGCCCGGGCAGCTGT
GCTGGGAGAGAATGGGCGGGTGCTGGCCGGGCAGACCCTGGGTGATGCTGTGGAGTCTTCAAAAAGCCCGACCACTCTGGATTACAAATT
TACAGGAGGATGAAACAGAAGAAATGGAAGGCCCACAGTCACCTGGTCAGCTCTTAAACCCTGCCCTAGCCCATTCTATCTCTGTGGCTT
CGTGTGGTAATATTTTTAGTTGTGGTGCAGAAGATGGTAAGGTTCGAATCTTTCGGGTGATGGGAGTTAAGTGTGAACAGGAACTGGGAT
TTAAGGGCCACACTTCAGGGGTATCCCAGGTCTGCTTTCTCCCAGAATCCTATTTGCTGCTTACTGGAGGGAATGATGGGAAGATCACGT
TGTGGGATGCAAACAGTGAAGTTGAGAAAAAACAGAAGAGTCCCACAAAACGTACCCACAGGAAGAAACCTAAAAGAGGAACTTGCACCA
AGCAGGGTGGAAATACTAACGCTTCAGTAACAGATGAGGAAGAACATGGCAACATTTTACCAAAGCTAAATATTGAACATGGAGAAAAAG
TGAACTGGCTCTTGGGTACAAAAATAAAGGGACACCAAAATATATTAGTAGCTGATCAAACTAGTTGTATATCTGTATACCCCTTAAATG

>In-frame_RALY_ENST00000246194_chr20_32660011_+_WDR53_ENST00000332629_chr3_196281678_-_1654nt
CTTTGTTCTTTTATGCTAAAAAATAAAATTCCCCAGAGTGCTTACAATCTCTCCTCCCACTCCCTTTTTCCTGCCCTAAATAAATAATGG
CGAATGAGCACCCAGCCAGGGATGTGTCTGATCAAACAATCATGGATCAATAGCTATGTTTGGAGAAGGAATTTGTGGCTGCTCCAGCTA
CTGGGCATTTTGTCTGGTCCAGTTCATGTAATCTCCCAACACCCCATGAAGCAAGGCTTTGTTAATCCTATTTTACTGAAAATGAACTAA
GACTCAGAGAGATAAAGCTGTTGCCCAATGAGCCTTCTTTCTGCCCTCCAGATCCACGGTGCTAATTCCCCTTCCGATGACCTAATGATT
CTGAGCTTGGCAAAGGTCTTATCTCCCAGCTCGCCCAGGCCCAGTGTTCCAGGAATGTGACCTTTGCTGCAGCAGCCGCTGGAGGGGGCA
GAGGGGATGGGCTGGAGGTTGAGCAAACAGAGCAGCAGAAAAGGCAGTTCCTCTTCTCCAGTGCCCTCCTTCCCTGTCTCTGCCTCTCCC
TCCCTTCCTCAGGCATCAGAGCGGAGACTTCAGGGAGACCAGAGCCCAGCTTGCCAGGCACTGAGCTAGAAGCCCTGCCATGGCACCCCT
GAGACCCCTTCTCATACTGGCCCTGCTGGCATGGGTTGCTCTGGCTGACCAAGGTGAGCCCTATTCCCAGAGGCAGGTGGTGCTGACCCT
GTAACCCAAAGGAGGAAACAGCTGGCTAAGCTCATCATTGTTACTGGTGGGCACCATGTCCTTGAAGCTTCAGGCAAGCAATGTAACCAA
CAAGAATGACCCCAAGTCCATCAACTCTCGAGTCTTCATTGGAAACCTCAACACAGCTCTGGTGAAGAAATCAGATGTGGAGACCATCTT
CTCTAAGTATGGCCGTGTGGCCGGCTGTTCTGTGCACAAGGGCTATGCCTTTGTTCAGTACTCCAATGAGCGCCATGCCCGGGCAGCTGT
GCTGGGAGAGAATGGGCGGGTGCTGGCCGGGCAGACCCTGGGTGATGCTGTGGAGTCTTCAAAAAGCCCGACCACTCTGGATTACAAATT
TACAGGAGGATGAAACAGAAGAAATGGAAGGCCCACAGTCACCTGGTCAGCTCTTAAACCCTGCCCTAGCCCATTCTATCTCTGTGGCTT
CGTGTGGTAATATTTTTAGTTGTGGTGCAGAAGATGGTAAGGTTCGAATCTTTCGGGTGATGGGAGTTAAGTGTGAACAGGAACTGGGAT
TTAAGGGCCACACTTCAGGGGTATCCCAGGTCTGCTTTCTCCCAGAATCCTATTTGCTGCTTACTGGAGGGAATGATGGGAAGATCACGT
TGTGGGATGCAAACAGTGAAGTTGAGAAAAAACAGAAGAGTCCCACAAAACGTACCCACAGGAAGAAACCTAAAAGAGGAACTTGCACCA
AGCAGGGTGGAAATACTAACGCTTCAGTAACAGATGAGGAAGAACATGGCAACATTTTACCAAAGCTAAATATTGAACATGGAGAAAAAG
TGAACTGGCTCTTGGGTACAAAAATAAAGGGACACCAAAATATATTAGTAGCTGATCAAACTAGTTGTATATCTGTATACCCCTTAAATG


Top

FusionGenePPI for RALY_WDR53


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RALYSPG7, WDR62, USP45, TADA2A, YWHAQ, CAND1, PCBP1, RBMX, PABPC1, HNRNPM, HNRNPU, HNRNPH1, SYNCRIP, HNRNPR, SNRNP40, HNRNPC, RBM39, RNPS1, DHX9, HNRNPA0, MED16, HSP90AB2P, HNRNPD, MED1, ERLIN1, RPS20, FMNL1, FN1, VCAM1, HNRNPK, QKI, KHDRBS1, CELF1, SOX2, TARDBP, PARK2, RPA3, RPA2, RPA1, LIN28A, LIN28B, SHMT2, MOV10, NXF1, PHF6, CUL7, OBSL1, EZH2, SUZ12, EED, RNF2, BMI1, PSME3, RPL6, RALYL, HNRNPA1, ILF2, NTRK1, HNRNPUL2, PRPF8, RANGAP1, RANBP2, SPICE1, HIST1H3E, MATR3, TEAD2, FOXA3, FOXB1, FOXD4, FOXE1, FOXL1, FOXP3, FOXS1, SNW1, CDC5L, U2AF2, ELAVL2, STRBP, APOBEC3D, C11orf57, ZC3H18, STAU1, DGCR8, FBXW11, ZFC3H1, SNRNP70, SNIP1, RPL7, COX15, HSD17B10, FOXA1, TRIM25, BRCA1, LMNAWDR53WDR5, BBS1, RSAD1, EEF1A2, NACAD, BLVRA, MCPH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RALY_WDR53


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RALY_WDR53


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRALYC0236733Amphetamine-Related Disorders1CTD_human