FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30202

FusionGeneSummary for RAD9A_CLPB

check button Fusion gene summary
Fusion gene informationFusion gene name: RAD9A_CLPB
Fusion gene ID: 30202
HgeneTgene
Gene symbol

RAD9A

CLPB

Gene ID

5883

81570

Gene nameRAD9 checkpoint clamp component AClpB homolog, mitochondrial AAA ATPase chaperonin
SynonymsRAD9ANKCLB|HSP78|MEGCANN|MGCA7|SKD3
Cytomap

11q13.2

11q13.4

Type of geneprotein-codingprotein-coding
Descriptioncell cycle checkpoint control protein RAD9ADNA repair exonuclease rad9 homolog ARAD9 homolog AhRAD9caseinolytic peptidase B protein homologClpB caseinolytic peptidase B homologankyrin-repeat containing bacterial clp fusionsuppressor of potassium transport defect 3testicular secretory protein Li 11
Modification date2018052320180519
UniProtAcc

Q99638

Q9H078

Ensembl transtripts involved in fusion geneENST00000307980, ENST00000535644, 
ENST00000294053, ENST00000538039, 
ENST00000437826, ENST00000340729, 
ENST00000543042, ENST00000445069, 
ENST00000538021, ENST00000542555, 
Fusion gene scores* DoF score8 X 6 X 7=3368 X 7 X 7=392
# samples 88
** MAII scorelog2(8/336*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/392*10)=-2.29278174922785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RAD9A [Title/Abstract] AND CLPB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRAD9A

GO:0006974

cellular response to DNA damage stimulus

9872989

HgeneRAD9A

GO:0071479

cellular response to ionizing radiation

21659603

TgeneCLPB

GO:0034605

cellular response to heat

2745427


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EE-A2GR-06ARAD9Achr11

67159549

+CLPBchr11

72141407

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000307980ENST00000294053RAD9Achr11

67159549

+CLPBchr11

72141407

-
In-frameENST00000307980ENST00000538039RAD9Achr11

67159549

+CLPBchr11

72141407

-
Frame-shitENST00000307980ENST00000437826RAD9Achr11

67159549

+CLPBchr11

72141407

-
In-frameENST00000307980ENST00000340729RAD9Achr11

67159549

+CLPBchr11

72141407

-
5CDS-intronENST00000307980ENST00000543042RAD9Achr11

67159549

+CLPBchr11

72141407

-
5CDS-intronENST00000307980ENST00000445069RAD9Achr11

67159549

+CLPBchr11

72141407

-
5CDS-intronENST00000307980ENST00000538021RAD9Achr11

67159549

+CLPBchr11

72141407

-
5CDS-5UTRENST00000307980ENST00000542555RAD9Achr11

67159549

+CLPBchr11

72141407

-
intron-3CDSENST00000535644ENST00000294053RAD9Achr11

67159549

+CLPBchr11

72141407

-
intron-3CDSENST00000535644ENST00000538039RAD9Achr11

67159549

+CLPBchr11

72141407

-
intron-3CDSENST00000535644ENST00000437826RAD9Achr11

67159549

+CLPBchr11

72141407

-
intron-3CDSENST00000535644ENST00000340729RAD9Achr11

67159549

+CLPBchr11

72141407

-
intron-intronENST00000535644ENST00000543042RAD9Achr11

67159549

+CLPBchr11

72141407

-
intron-intronENST00000535644ENST00000445069RAD9Achr11

67159549

+CLPBchr11

72141407

-
intron-intronENST00000535644ENST00000538021RAD9Achr11

67159549

+CLPBchr11

72141407

-
intron-5UTRENST00000535644ENST00000542555RAD9Achr11

67159549

+CLPBchr11

72141407

-

Top

FusionProtFeatures for RAD9A_CLPB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RAD9A

Q99638

CLPB

Q9H078

Component of the 9-1-1 cell-cycle checkpoint responsecomplex that plays a major role in DNA repair. The 9-1-1 complexis recruited to DNA lesion upon damage by the RAD17-replicationfactor C (RFC) clamp loader complex. Acts then as a sliding clampplatform on DNA for several proteins involved in long-patch baseexcision repair (LP-BER). The 9-1-1 complex stimulates DNApolymerase beta (POLB) activity by increasing its affinity for the3'-OH end of the primer-template and stabilizes POLB to thosesites where LP-BER proceeds; endonuclease FEN1 cleavage activityon substrates with double, nick, or gap flaps of distinctsequences and lengths; and DNA ligase I (LIG1) on long-patch baseexcision repair substrates. The 9-1-1 complex is necessary for therecruitment of RHNO1 to sites of double-stranded breaks (DSB)occurring during the S phase. RAD9A possesses 3'->5' doublestranded DNA exonuclease activity. Its phosphorylation by PRKCDmay be required for the formation of the 9-1-1 complex.{ECO:0000269|PubMed:10713044, ECO:0000269|PubMed:21659603}. May function as a regulatory ATPase and be related tosecretion/protein trafficking process.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCLPBchr11:67159549chr11:72141407ENST00000294053-017381_388134708Nucleotide bindingATP
TgeneCLPBchr11:67159549chr11:72141407ENST00000340729-015381_388134649Nucleotide bindingATP
TgeneCLPBchr11:67159549chr11:72141407ENST00000437826-018381_38853663Nucleotide bindingATP
TgeneCLPBchr11:67159549chr11:72141407ENST00000538039-016381_388134678Nucleotide bindingATP
TgeneCLPBchr11:67159549chr11:72141407ENST00000294053-017133_162134708RepeatNote=ANK 1
TgeneCLPBchr11:67159549chr11:72141407ENST00000294053-017166_195134708RepeatNote=ANK 2
TgeneCLPBchr11:67159549chr11:72141407ENST00000294053-017265_295134708RepeatNote=ANK 3
TgeneCLPBchr11:67159549chr11:72141407ENST00000294053-017298_327134708RepeatNote=ANK 4
TgeneCLPBchr11:67159549chr11:72141407ENST00000340729-015133_162134649RepeatNote=ANK 1
TgeneCLPBchr11:67159549chr11:72141407ENST00000340729-015166_195134649RepeatNote=ANK 2
TgeneCLPBchr11:67159549chr11:72141407ENST00000340729-015265_295134649RepeatNote=ANK 3
TgeneCLPBchr11:67159549chr11:72141407ENST00000340729-015298_327134649RepeatNote=ANK 4
TgeneCLPBchr11:67159549chr11:72141407ENST00000437826-018133_16253663RepeatNote=ANK 1
TgeneCLPBchr11:67159549chr11:72141407ENST00000437826-018166_19553663RepeatNote=ANK 2
TgeneCLPBchr11:67159549chr11:72141407ENST00000437826-018265_29553663RepeatNote=ANK 3
TgeneCLPBchr11:67159549chr11:72141407ENST00000437826-018298_32753663RepeatNote=ANK 4
TgeneCLPBchr11:67159549chr11:72141407ENST00000538039-016133_162134678RepeatNote=ANK 1
TgeneCLPBchr11:67159549chr11:72141407ENST00000538039-016166_195134678RepeatNote=ANK 2
TgeneCLPBchr11:67159549chr11:72141407ENST00000538039-016265_295134678RepeatNote=ANK 3
TgeneCLPBchr11:67159549chr11:72141407ENST00000538039-016298_327134678RepeatNote=ANK 4

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRAD9Achr11:67159549chr11:72141407ENST00000307980+11151_9111392RegionNote=Possesses 3'-5' exonuclease activity


Top

FusionGeneSequence for RAD9A_CLPB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RAD9A_ENST00000307980_chr11_67159549_+_CLPB_ENST00000294053_chr11_72141407_-_585aa
MKCLVTGGNVKDAALLEAARANNMQEVSRLLSEGADVNAKHRLGWTALMVAAINRNNSVVQVLLAAGADPNLGDDFSSVYKTAKEQGIHS
LEDGGQDGASRHITNQWTSALEFRRWLGLPAGVLITREDDFNNRLNNRASFKGCTALHTAVLADDYRTVKELLDGGANPLQRNEMGHTPL
DTAREGEVMKLLRTSEAKYQEKQRKREAEERRRFPLEQRLKEHIIGQESAIATVGAAIRRKENGWYDEEHPLVFLFLGSSGIGKTELAKQ
TAKTMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGKGKT
IDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCH
SELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHTGARSIKHEVERRVVNQLAAATEQDLLPGGCTLRITVEDSDKQLLKS

>In-frame_RAD9A_ENST00000307980_chr11_67159549_+_CLPB_ENST00000538039_chr11_72141407_-_555aa
MKCLVTGGNVKDAALLEAARANNMQEVSRLLSEGADVNAKHRLGWTALMVAAINRNNSVVQVLLAAGADPNLGDDFSSVYKTAKEQGIHS
LEVLITREDDFNNRLNNRASFKGCTALHTAVLADDYRTVKELLDGGANPLQRNEMGHTPLDTAREGEVMKLLRTSEAKYQEKQRKREAEE
RRRFPLEQRLKEHIIGQESAIATVGAAIRRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKTMHKDAKKGFIRLDMSEFQERHEVAKF
IGSPPGYVGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEA
LEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWAKRAKQRHNITLLWDR
EVADVLVDGYNVHTGARSIKHEVERRVVNQLAAATEQDLLPGGCTLRITVEDSDKQLLKSPELPSPQAEKRLPKLRLEIIDKDSKTRRLD

>In-frame_RAD9A_ENST00000307980_chr11_67159549_+_CLPB_ENST00000340729_chr11_72141407_-_526aa
MKCLVTGGNVKDAALLEAARANNMQEVSSVVQVLLAAGADPNLGDDFSSVYKTAKEQGIHSLEVLITREDDFNNRLNNRASFKGCTALHT
AVLADDYRTVKELLDGGANPLQRNEMGHTPLDTAREGEVMKLLRTSEAKYQEKQRKREAEERRRFPLEQRLKEHIIGQESAIATVGAAIR
RKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKTMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVL
FDEVDKAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKE
NVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHTGARSIKHEVERRVVN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RAD9A_ENST00000307980_chr11_67159549_+_CLPB_ENST00000294053_chr11_72141407_-_1755nt
ATGAAGTGCCTGGTCACGGGCGGCAACGTGAAGGATGCAGCCCTGTTGGAAGCTGCCCGTGCCAACAATATGCAAGAAGTCAGCAGGCTG
TTGTCAGAAGGTGCAGATGTCAATGCAAAGCACAGACTTGGCTGGACAGCACTCATGGTGGCAGCCATCAACCGAAACAACAGTGTGGTA
CAGGTCCTGCTTGCTGCTGGGGCTGATCCAAACCTTGGAGATGATTTCAGCAGTGTTTACAAGACTGCCAAGGAACAGGGAATCCATTCT
TTGGAAGATGGGGGACAGGACGGTGCAAGCCGGCACATCACAAACCAGTGGACAAGTGCCCTGGAGTTCAGGAGATGGCTAGGACTCCCC
GCTGGCGTCCTGATCACCCGAGAGGATGACTTCAACAACAGGCTGAACAACCGCGCCAGTTTCAAGGGCTGCACGGCCTTGCACTATGCT
GTTCTTGCTGATGACTACCGCACTGTCAAGGAGCTGCTTGATGGAGGAGCCAACCCCCTGCAGAGGAATGAAATGGGACACACACCCTTG
GATTATGCCCGAGAAGGGGAAGTGATGAAGCTTCTGAGGACTTCTGAAGCCAAGTACCAAGAGAAGCAGCGGAAGCGTGAGGCTGAGGAG
CGGCGCCGCTTCCCCCTGGAGCAGCGACTAAAGGAGCACATCATTGGCCAGGAGAGCGCCATCGCCACAGTGGGTGCTGCGATCCGGAGG
AAGGAGAATGGCTGGTACGATGAAGAACACCCTCTGGTCTTCCTCTTCTTGGGATCATCTGGAATAGGAAAAACAGAGCTGGCCAAGCAG
ACAGCCAAATATATGCACAAAGATGCTAAAAAGGGCTTCATCAGGCTGGACATGTCCGAGTTCCAGGAGCGACACGAGGTGGCCAAGTTT
ATTGGGTCTCCACCAGGCTACGTTGGCCATGAGGAGGGTGGCCAGCTGACCAAGAAGTTGAAGCAGTGCCCCAATGCTGTGGTGCTCTTT
GATGAAGTAGACAAGGCCCATCCAGATGTGCTCACCATCATGCTGCAGCTGTTTGATGAGGGCCGGCTGACAGATGGAAAAGGGAAGACC
ATTGATTGCAAGGACGCCATCTTCATCATGACCTCCAATGTGGCCAGCGACGAGATCGCACAGCACGCGCTGCAGCTGAGGCAGGAAGCT
TTGGAGATGAGCCGTAACCGTATTGCCGAAAACCTGGGGGATGTCCAGATAAGTGACAAGATCACCATCTCAAAGAACTTCAAGGAGAAT
GTGATTCGCCCTATCCTGAAAGCTCACTTCCGGAGGGATGAGTTTCTGGGACGGATCAATGAGATCGTCTACTTCCTCCCCTTCTGCCAC
TCGGAGCTCATCCAACTCGTCAACAAGGAACTAAACTTCTGGGCCAAGAGAGCCAAGCAAAGGCACAACATCACGCTGCTCTGGGACCGC
GAGGTGGCAGATGTGCTGGTCGACGGCTACAATGTGCACTATGGCGCCCGCTCCATCAAACATGAGGTAGAACGCCGTGTGGTGAACCAG
CTGGCAGCAGCCTATGAGCAGGACCTGCTGCCAGGGGGCTGTACTTTGCGCATCACGGTGGAGGACTCAGACAAGCAGCTACTCAAAAGC
CCAGAACTGCCCTCACCCCAGGCTGAGAAGCGCCTCCCCAAGCTGCGTCTGGAGATCATCGACAAGGACAGCAAGACTCGCAGACTGGAC

>In-frame_RAD9A_ENST00000307980_chr11_67159549_+_CLPB_ENST00000538039_chr11_72141407_-_1665nt
ATGAAGTGCCTGGTCACGGGCGGCAACGTGAAGGATGCAGCCCTGTTGGAAGCTGCCCGTGCCAACAATATGCAAGAAGTCAGCAGGCTG
TTGTCAGAAGGTGCAGATGTCAATGCAAAGCACAGACTTGGCTGGACAGCACTCATGGTGGCAGCCATCAACCGAAACAACAGTGTGGTA
CAGGTCCTGCTTGCTGCTGGGGCTGATCCAAACCTTGGAGATGATTTCAGCAGTGTTTACAAGACTGCCAAGGAACAGGGAATCCATTCT
TTGGAAGTCCTGATCACCCGAGAGGATGACTTCAACAACAGGCTGAACAACCGCGCCAGTTTCAAGGGCTGCACGGCCTTGCACTATGCT
GTTCTTGCTGATGACTACCGCACTGTCAAGGAGCTGCTTGATGGAGGAGCCAACCCCCTGCAGAGGAATGAAATGGGACACACACCCTTG
GATTATGCCCGAGAAGGGGAAGTGATGAAGCTTCTGAGGACTTCTGAAGCCAAGTACCAAGAGAAGCAGCGGAAGCGTGAGGCTGAGGAG
CGGCGCCGCTTCCCCCTGGAGCAGCGACTAAAGGAGCACATCATTGGCCAGGAGAGCGCCATCGCCACAGTGGGTGCTGCGATCCGGAGG
AAGGAGAATGGCTGGTACGATGAAGAACACCCTCTGGTCTTCCTCTTCTTGGGATCATCTGGAATAGGAAAAACAGAGCTGGCCAAGCAG
ACAGCCAAATATATGCACAAAGATGCTAAAAAGGGCTTCATCAGGCTGGACATGTCCGAGTTCCAGGAGCGACACGAGGTGGCCAAGTTT
ATTGGGTCTCCACCAGGCTACGTTGGCCATGAGGAGGGTGGCCAGCTGACCAAGAAGTTGAAGCAGTGCCCCAATGCTGTGGTGCTCTTT
GATGAAGTAGACAAGGCCCATCCAGATGTGCTCACCATCATGCTGCAGCTGTTTGATGAGGGCCGGCTGACAGATGGAAAAGGGAAGACC
ATTGATTGCAAGGACGCCATCTTCATCATGACCTCCAATGTGGCCAGCGACGAGATCGCACAGCACGCGCTGCAGCTGAGGCAGGAAGCT
TTGGAGATGAGCCGTAACCGTATTGCCGAAAACCTGGGGGATGTCCAGATAAGTGACAAGATCACCATCTCAAAGAACTTCAAGGAGAAT
GTGATTCGCCCTATCCTGAAAGCTCACTTCCGGAGGGATGAGTTTCTGGGACGGATCAATGAGATCGTCTACTTCCTCCCCTTCTGCCAC
TCGGAGCTCATCCAACTCGTCAACAAGGAACTAAACTTCTGGGCCAAGAGAGCCAAGCAAAGGCACAACATCACGCTGCTCTGGGACCGC
GAGGTGGCAGATGTGCTGGTCGACGGCTACAATGTGCACTATGGCGCCCGCTCCATCAAACATGAGGTAGAACGCCGTGTGGTGAACCAG
CTGGCAGCAGCCTATGAGCAGGACCTGCTGCCAGGGGGCTGTACTTTGCGCATCACGGTGGAGGACTCAGACAAGCAGCTACTCAAAAGC
CCAGAACTGCCCTCACCCCAGGCTGAGAAGCGCCTCCCCAAGCTGCGTCTGGAGATCATCGACAAGGACAGCAAGACTCGCAGACTGGAC

>In-frame_RAD9A_ENST00000307980_chr11_67159549_+_CLPB_ENST00000340729_chr11_72141407_-_1578nt
ATGAAGTGCCTGGTCACGGGCGGCAACGTGAAGGATGCAGCCCTGTTGGAAGCTGCCCGTGCCAACAATATGCAAGAAGTCAGCAGTGTG
GTACAGGTCCTGCTTGCTGCTGGGGCTGATCCAAACCTTGGAGATGATTTCAGCAGTGTTTACAAGACTGCCAAGGAACAGGGAATCCAT
TCTTTGGAAGTCCTGATCACCCGAGAGGATGACTTCAACAACAGGCTGAACAACCGCGCCAGTTTCAAGGGCTGCACGGCCTTGCACTAT
GCTGTTCTTGCTGATGACTACCGCACTGTCAAGGAGCTGCTTGATGGAGGAGCCAACCCCCTGCAGAGGAATGAAATGGGACACACACCC
TTGGATTATGCCCGAGAAGGGGAAGTGATGAAGCTTCTGAGGACTTCTGAAGCCAAGTACCAAGAGAAGCAGCGGAAGCGTGAGGCTGAG
GAGCGGCGCCGCTTCCCCCTGGAGCAGCGACTAAAGGAGCACATCATTGGCCAGGAGAGCGCCATCGCCACAGTGGGTGCTGCGATCCGG
AGGAAGGAGAATGGCTGGTACGATGAAGAACACCCTCTGGTCTTCCTCTTCTTGGGATCATCTGGAATAGGAAAAACAGAGCTGGCCAAG
CAGACAGCCAAATATATGCACAAAGATGCTAAAAAGGGCTTCATCAGGCTGGACATGTCCGAGTTCCAGGAGCGACACGAGGTGGCCAAG
TTTATTGGGTCTCCACCAGGCTACGTTGGCCATGAGGAGGGTGGCCAGCTGACCAAGAAGTTGAAGCAGTGCCCCAATGCTGTGGTGCTC
TTTGATGAAGTAGACAAGGCCCATCCAGATGTGCTCACCATCATGCTGCAGCTGTTTGATGAGGGCCGGCTGACAGATGGAAAAGGGAAG
ACCATTGATTGCAAGGACGCCATCTTCATCATGACCTCCAATGTGGCCAGCGACGAGATCGCACAGCACGCGCTGCAGCTGAGGCAGGAA
GCTTTGGAGATGAGCCGTAACCGTATTGCCGAAAACCTGGGGGATGTCCAGATAAGTGACAAGATCACCATCTCAAAGAACTTCAAGGAG
AATGTGATTCGCCCTATCCTGAAAGCTCACTTCCGGAGGGATGAGTTTCTGGGACGGATCAATGAGATCGTCTACTTCCTCCCCTTCTGC
CACTCGGAGCTCATCCAACTCGTCAACAAGGAACTAAACTTCTGGGCCAAGAGAGCCAAGCAAAGGCACAACATCACGCTGCTCTGGGAC
CGCGAGGTGGCAGATGTGCTGGTCGACGGCTACAATGTGCACTATGGCGCCCGCTCCATCAAACATGAGGTAGAACGCCGTGTGGTGAAC
CAGCTGGCAGCAGCCTATGAGCAGGACCTGCTGCCAGGGGGCTGTACTTTGCGCATCACGGTGGAGGACTCAGACAAGCAGCTACTCAAA
AGCCCAGAACTGCCCTCACCCCAGGCTGAGAAGCGCCTCCCCAAGCTGCGTCTGGAGATCATCGACAAGGACAGCAAGACTCGCAGACTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RAD9A_ENST00000307980_chr11_67159549_+_CLPB_ENST00000294053_chr11_72141407_-_2790nt
GGGCCGGCAGGGGCGGTGCGCGGGAAGGGACCCCGGACCCGGAGGTCGCGGAGAGCTGGGCAGTGTTGGCCGCTGGCGGAGCGCTGGGGC
AGCATGAAGTGCCTGGTCACGGGCGGCAACGTGAAGGATGCAGCCCTGTTGGAAGCTGCCCGTGCCAACAATATGCAAGAAGTCAGCAGG
CTGTTGTCAGAAGGTGCAGATGTCAATGCAAAGCACAGACTTGGCTGGACAGCACTCATGGTGGCAGCCATCAACCGAAACAACAGTGTG
GTACAGGTCCTGCTTGCTGCTGGGGCTGATCCAAACCTTGGAGATGATTTCAGCAGTGTTTACAAGACTGCCAAGGAACAGGGAATCCAT
TCTTTGGAAGATGGGGGACAGGACGGTGCAAGCCGGCACATCACAAACCAGTGGACAAGTGCCCTGGAGTTCAGGAGATGGCTAGGACTC
CCCGCTGGCGTCCTGATCACCCGAGAGGATGACTTCAACAACAGGCTGAACAACCGCGCCAGTTTCAAGGGCTGCACGGCCTTGCACTAT
GCTGTTCTTGCTGATGACTACCGCACTGTCAAGGAGCTGCTTGATGGAGGAGCCAACCCCCTGCAGAGGAATGAAATGGGACACACACCC
TTGGATTATGCCCGAGAAGGGGAAGTGATGAAGCTTCTGAGGACTTCTGAAGCCAAGTACCAAGAGAAGCAGCGGAAGCGTGAGGCTGAG
GAGCGGCGCCGCTTCCCCCTGGAGCAGCGACTAAAGGAGCACATCATTGGCCAGGAGAGCGCCATCGCCACAGTGGGTGCTGCGATCCGG
AGGAAGGAGAATGGCTGGTACGATGAAGAACACCCTCTGGTCTTCCTCTTCTTGGGATCATCTGGAATAGGAAAAACAGAGCTGGCCAAG
CAGACAGCCAAATATATGCACAAAGATGCTAAAAAGGGCTTCATCAGGCTGGACATGTCCGAGTTCCAGGAGCGACACGAGGTGGCCAAG
TTTATTGGGTCTCCACCAGGCTACGTTGGCCATGAGGAGGGTGGCCAGCTGACCAAGAAGTTGAAGCAGTGCCCCAATGCTGTGGTGCTC
TTTGATGAAGTAGACAAGGCCCATCCAGATGTGCTCACCATCATGCTGCAGCTGTTTGATGAGGGCCGGCTGACAGATGGAAAAGGGAAG
ACCATTGATTGCAAGGACGCCATCTTCATCATGACCTCCAATGTGGCCAGCGACGAGATCGCACAGCACGCGCTGCAGCTGAGGCAGGAA
GCTTTGGAGATGAGCCGTAACCGTATTGCCGAAAACCTGGGGGATGTCCAGATAAGTGACAAGATCACCATCTCAAAGAACTTCAAGGAG
AATGTGATTCGCCCTATCCTGAAAGCTCACTTCCGGAGGGATGAGTTTCTGGGACGGATCAATGAGATCGTCTACTTCCTCCCCTTCTGC
CACTCGGAGCTCATCCAACTCGTCAACAAGGAACTAAACTTCTGGGCCAAGAGAGCCAAGCAAAGGCACAACATCACGCTGCTCTGGGAC
CGCGAGGTGGCAGATGTGCTGGTCGACGGCTACAATGTGCACTATGGCGCCCGCTCCATCAAACATGAGGTAGAACGCCGTGTGGTGAAC
CAGCTGGCAGCAGCCTATGAGCAGGACCTGCTGCCAGGGGGCTGTACTTTGCGCATCACGGTGGAGGACTCAGACAAGCAGCTACTCAAA
AGCCCAGAACTGCCCTCACCCCAGGCTGAGAAGCGCCTCCCCAAGCTGCGTCTGGAGATCATCGACAAGGACAGCAAGACTCGCAGACTG
GACATCCGGGCACCACTGCACCCTGAGAAGGTGTGCAACACCATCTAGCAGCCACCTGCCTGCTCCTATGTGCCCTCACCATCCAATAAA
GGCCCCTTGGCTGTGGCATGGCAACTGACTTACCTTCCCCTCATGCCGCTCCCATCTCTACCCAGTCTCAGGCCTGCTTACCTCCTCACA
GCCCATGAAGACCCCTTCTCAGCCCCAAAACCTGAAGGAGGAATTTCGCCCTACTCTGGCCCCTTTGTTGTGGGCCCATAACCTGCTAAC
AAGCCTTCAGGAGAGGAGCTGCCTTTCCACCCCCTTCAAGGCAAGGAGGGATGGAGGTCCCTTATTTCCTTCAGAATGATCCCCATCCCC
CATAGTCGCCAGACTTTCTCATGTTCCCAGGAAGCTCAGAAGTATGGCAGCTAAGAACACAGCTGGCTGGAAGAAGACAGGGACCAGACT
GAACTGCCACCCTCTGCTAGTCCTCATGCAACTCAGTCCCCAGAATGGCTCCACTGGGAGTGGAGGAAGAGCTCAGAGGCCCAGGTGCAG
ATAGTTCTGCAATTTAGTCTGTAGCCTCCTCGTTCCCTACCCTAAAATTCTAAGGGGAAGGGACCCATAGAGGCTTGCCTGTTTCCGCTA
CTATATTATGCCCAGTGTTCCTCCTCACCCCACGTCCTGGGGTCAGGCCAGACCATGTTTCGTCAGCCTTGGGGACTAGGCCAGTGTTGG
GCACCTCCAGGAGGAGGCCTGACTGGTTCATTACCCTCCCCTACTCAGACTGAGCAGCAGTCCCAGATAACCAAGCAAGCTCAGCTCTGT
GGGGGCCTCCTTCAAAAGACCAACATCGCAGACATTAGGAAGCTGTAGGAAGAGAGATCATGGGTTTGACCTCTGCCCACATGGCCATGG
AGTCAGCCTCAGCCCTGTCTGTACTGCTCGTCCAGCTAAACGAGCCTGGAATAAACATGCAGTTTATTCAGTCTGCATGTTAGTCACAAA

>In-frame_RAD9A_ENST00000307980_chr11_67159549_+_CLPB_ENST00000538039_chr11_72141407_-_2679nt
GGGCCGGCAGGGGCGGTGCGCGGGAAGGGACCCCGGACCCGGAGGTCGCGGAGAGCTGGGCAGTGTTGGCCGCTGGCGGAGCGCTGGGGC
AGCATGAAGTGCCTGGTCACGGGCGGCAACGTGAAGGATGCAGCCCTGTTGGAAGCTGCCCGTGCCAACAATATGCAAGAAGTCAGCAGG
CTGTTGTCAGAAGGTGCAGATGTCAATGCAAAGCACAGACTTGGCTGGACAGCACTCATGGTGGCAGCCATCAACCGAAACAACAGTGTG
GTACAGGTCCTGCTTGCTGCTGGGGCTGATCCAAACCTTGGAGATGATTTCAGCAGTGTTTACAAGACTGCCAAGGAACAGGGAATCCAT
TCTTTGGAAGTCCTGATCACCCGAGAGGATGACTTCAACAACAGGCTGAACAACCGCGCCAGTTTCAAGGGCTGCACGGCCTTGCACTAT
GCTGTTCTTGCTGATGACTACCGCACTGTCAAGGAGCTGCTTGATGGAGGAGCCAACCCCCTGCAGAGGAATGAAATGGGACACACACCC
TTGGATTATGCCCGAGAAGGGGAAGTGATGAAGCTTCTGAGGACTTCTGAAGCCAAGTACCAAGAGAAGCAGCGGAAGCGTGAGGCTGAG
GAGCGGCGCCGCTTCCCCCTGGAGCAGCGACTAAAGGAGCACATCATTGGCCAGGAGAGCGCCATCGCCACAGTGGGTGCTGCGATCCGG
AGGAAGGAGAATGGCTGGTACGATGAAGAACACCCTCTGGTCTTCCTCTTCTTGGGATCATCTGGAATAGGAAAAACAGAGCTGGCCAAG
CAGACAGCCAAATATATGCACAAAGATGCTAAAAAGGGCTTCATCAGGCTGGACATGTCCGAGTTCCAGGAGCGACACGAGGTGGCCAAG
TTTATTGGGTCTCCACCAGGCTACGTTGGCCATGAGGAGGGTGGCCAGCTGACCAAGAAGTTGAAGCAGTGCCCCAATGCTGTGGTGCTC
TTTGATGAAGTAGACAAGGCCCATCCAGATGTGCTCACCATCATGCTGCAGCTGTTTGATGAGGGCCGGCTGACAGATGGAAAAGGGAAG
ACCATTGATTGCAAGGACGCCATCTTCATCATGACCTCCAATGTGGCCAGCGACGAGATCGCACAGCACGCGCTGCAGCTGAGGCAGGAA
GCTTTGGAGATGAGCCGTAACCGTATTGCCGAAAACCTGGGGGATGTCCAGATAAGTGACAAGATCACCATCTCAAAGAACTTCAAGGAG
AATGTGATTCGCCCTATCCTGAAAGCTCACTTCCGGAGGGATGAGTTTCTGGGACGGATCAATGAGATCGTCTACTTCCTCCCCTTCTGC
CACTCGGAGCTCATCCAACTCGTCAACAAGGAACTAAACTTCTGGGCCAAGAGAGCCAAGCAAAGGCACAACATCACGCTGCTCTGGGAC
CGCGAGGTGGCAGATGTGCTGGTCGACGGCTACAATGTGCACTATGGCGCCCGCTCCATCAAACATGAGGTAGAACGCCGTGTGGTGAAC
CAGCTGGCAGCAGCCTATGAGCAGGACCTGCTGCCAGGGGGCTGTACTTTGCGCATCACGGTGGAGGACTCAGACAAGCAGCTACTCAAA
AGCCCAGAACTGCCCTCACCCCAGGCTGAGAAGCGCCTCCCCAAGCTGCGTCTGGAGATCATCGACAAGGACAGCAAGACTCGCAGACTG
GACATCCGGGCACCACTGCACCCTGAGAAGGTGTGCAACACCATCTAGCAGCCACCTGCCTGCTCCTATGTGCCCTCACCATCCAATAAA
GGCCCCTTGGCTGTGGCATGGCAACTGACTTACCTTCCCCTCATGCCGCTCCCATCTCTACCCAGTCTCAGGCCTGCTTACCTCCTCACA
GCCCATGAAGACCCCTTCTCAGCCCCAAAACCTGAAGGAGGAATTTCGCCCTACTCTGGCCCCTTTGTTGTGGGCCCATAACCTGCTAAC
AAGCCTTCAGGAGAGGAGCTGCCTTTCCACCCCCTTCAAGGCAAGGAGGGATGGAGGTCCCTTATTTCCTTCAGAATGATCCCCATCCCC
CATAGTCGCCAGACTTTCTCATGTTCCCAGGAAGCTCAGAAGTATGGCAGCTAAGAACACAGCTGGCTGGAAGAAGACAGGGACCAGACT
GAACTGCCACCCTCTGCTAGTCCTCATGCAACTCAGTCCCCAGAATGGCTCCACTGGGAGTGGAGGAAGAGCTCAGAGGCCCAGGTGCAG
ATAGTTCTGCAATTTAGTCTGTAGCCTCCTCGTTCCCTACCCTAAAATTCTAAGGGGAAGGGACCCATAGAGGCTTGCCTGTTTCCGCTA
CTATATTATGCCCAGTGTTCCTCCTCACCCCACGTCCTGGGGTCAGGCCAGACCATGTTTCGTCAGCCTTGGGGACTAGGCCAGTGTTGG
GCACCTCCAGGAGGAGGCCTGACTGGTTCATTACCCTCCCCTACTCAGACTGAGCAGCAGTCCCAGATAACCAAGCAAGCTCAGCTCTGT
GGGGGCCTCCTTCAAAAGACCAACATCGCAGACATTAGGAAGCTGTAGGAAGAGAGATCATGGGTTTGACCTCTGCCCACATGGCCATGG

>In-frame_RAD9A_ENST00000307980_chr11_67159549_+_CLPB_ENST00000340729_chr11_72141407_-_1735nt
GGGCCGGCAGGGGCGGTGCGCGGGAAGGGACCCCGGACCCGGAGGTCGCGGAGAGCTGGGCAGTGTTGGCCGCTGGCGGAGCGCTGGGGC
AGCATGAAGTGCCTGGTCACGGGCGGCAACGTGAAGGATGCAGCCCTGTTGGAAGCTGCCCGTGCCAACAATATGCAAGAAGTCAGCAGT
GTGGTACAGGTCCTGCTTGCTGCTGGGGCTGATCCAAACCTTGGAGATGATTTCAGCAGTGTTTACAAGACTGCCAAGGAACAGGGAATC
CATTCTTTGGAAGTCCTGATCACCCGAGAGGATGACTTCAACAACAGGCTGAACAACCGCGCCAGTTTCAAGGGCTGCACGGCCTTGCAC
TATGCTGTTCTTGCTGATGACTACCGCACTGTCAAGGAGCTGCTTGATGGAGGAGCCAACCCCCTGCAGAGGAATGAAATGGGACACACA
CCCTTGGATTATGCCCGAGAAGGGGAAGTGATGAAGCTTCTGAGGACTTCTGAAGCCAAGTACCAAGAGAAGCAGCGGAAGCGTGAGGCT
GAGGAGCGGCGCCGCTTCCCCCTGGAGCAGCGACTAAAGGAGCACATCATTGGCCAGGAGAGCGCCATCGCCACAGTGGGTGCTGCGATC
CGGAGGAAGGAGAATGGCTGGTACGATGAAGAACACCCTCTGGTCTTCCTCTTCTTGGGATCATCTGGAATAGGAAAAACAGAGCTGGCC
AAGCAGACAGCCAAATATATGCACAAAGATGCTAAAAAGGGCTTCATCAGGCTGGACATGTCCGAGTTCCAGGAGCGACACGAGGTGGCC
AAGTTTATTGGGTCTCCACCAGGCTACGTTGGCCATGAGGAGGGTGGCCAGCTGACCAAGAAGTTGAAGCAGTGCCCCAATGCTGTGGTG
CTCTTTGATGAAGTAGACAAGGCCCATCCAGATGTGCTCACCATCATGCTGCAGCTGTTTGATGAGGGCCGGCTGACAGATGGAAAAGGG
AAGACCATTGATTGCAAGGACGCCATCTTCATCATGACCTCCAATGTGGCCAGCGACGAGATCGCACAGCACGCGCTGCAGCTGAGGCAG
GAAGCTTTGGAGATGAGCCGTAACCGTATTGCCGAAAACCTGGGGGATGTCCAGATAAGTGACAAGATCACCATCTCAAAGAACTTCAAG
GAGAATGTGATTCGCCCTATCCTGAAAGCTCACTTCCGGAGGGATGAGTTTCTGGGACGGATCAATGAGATCGTCTACTTCCTCCCCTTC
TGCCACTCGGAGCTCATCCAACTCGTCAACAAGGAACTAAACTTCTGGGCCAAGAGAGCCAAGCAAAGGCACAACATCACGCTGCTCTGG
GACCGCGAGGTGGCAGATGTGCTGGTCGACGGCTACAATGTGCACTATGGCGCCCGCTCCATCAAACATGAGGTAGAACGCCGTGTGGTG
AACCAGCTGGCAGCAGCCTATGAGCAGGACCTGCTGCCAGGGGGCTGTACTTTGCGCATCACGGTGGAGGACTCAGACAAGCAGCTACTC
AAAAGCCCAGAACTGCCCTCACCCCAGGCTGAGAAGCGCCTCCCCAAGCTGCGTCTGGAGATCATCGACAAGGACAGCAAGACTCGCAGA
CTGGACATCCGGGCACCACTGCACCCTGAGAAGGTGTGCAACACCATCTAGCAGCCACCTGCCTGCTCCTATGTGCCCTCACCATCCAAT


Top

FusionGenePPI for RAD9A_CLPB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RAD9ABCL2L1, AR, NR3C1, RAD1, HUS1, RAD17, HUS1B, CLSPN, HDAC1, ABL1, DNAJC7, BCL2, TOPBP1, RPA1, RPA2, FEN1, ATR, SETMAR, DNMT1, SF3B3, PCNA, COPS5, FEM1B, MSH2, MSH6, MSH3, ATRX, RHNO1, C10orf2, TRIM25CLPBTTF2, COPS6, UCHL3, USP30, OSBPL10, TERF2, CUL3, SMAD9, MDFI, HDAC11, IRS4, CEP70, ERCC6L, TSEN2, MGEA5, NTRK1, XPO1, MCM2, NDUFA4, PTPMT1, DHRS4, COQ9, C15orf48, CISD3, C2orf47, FAM136A, OPA3, TRUB2, COQ10B, OCIAD1, ADCK3, WBSCR16, ADCK4, NDUFS3, PAK7, ADCK2, CHCHD10, C17orf89, CDKN3, CLUH, KIAA1191, PAG1, ARFIP1, SETDB1, TRIM11, MTIF2, MDM2, GTPBP10, EXOG, EIF5, NAP1L5, FBXL13


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RAD9A_CLPB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RAD9A_CLPB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRAD9AC0085183Neoplasms, Second Primary1CTD_human
TgeneCLPBC42253933-METHYLGLUTACONIC ACIDURIA WITH CATARACTS, NEUROLOGIC INVOLVEMENT, AND NEUTROPENIA2ORPHANET;UNIPROT