FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30028

FusionGeneSummary for RAB40B_TAF15

check button Fusion gene summary
Fusion gene informationFusion gene name: RAB40B_TAF15
Fusion gene ID: 30028
HgeneTgene
Gene symbol

RAB40B

TAF15

Gene ID

10966

8148

Gene nameRAB40B, member RAS oncogene familyTATA-box binding protein associated factor 15
SynonymsRAR|SEC4LNpl3|RBP56|TAF2N|TAFII68
Cytomap

17q25.3

17q12

Type of geneprotein-codingprotein-coding
Descriptionras-related protein Rab-40BGTP-binding protein homologous to Saccharomyces cerevisiae SEC4SOCS box-containing protein RARprotein RarTATA-binding protein-associated factor 2NRBP56/CSMF fusionTAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDaTATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD (RNA-binding protein 56)TATA box-bin
Modification date2018052320180523
UniProtAcc

Q12829

Q92804

Ensembl transtripts involved in fusion geneENST00000571995, ENST00000571880, 
ENST00000269347, ENST00000538809, 
ENST00000588240, ENST00000592237, 
ENST00000311979, 
Fusion gene scores* DoF score3 X 2 X 3=187 X 5 X 6=210
# samples 37
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RAB40B [Title/Abstract] AND TAF15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCOADTCGA-D5-6929-01ARAB40Bchr17

80656331

-TAF15chr17

34165428

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000571995ENST00000588240RAB40Bchr17

80656331

-TAF15chr17

34165428

+
In-frameENST00000571995ENST00000592237RAB40Bchr17

80656331

-TAF15chr17

34165428

+
In-frameENST00000571995ENST00000311979RAB40Bchr17

80656331

-TAF15chr17

34165428

+
intron-3CDSENST00000571880ENST00000588240RAB40Bchr17

80656331

-TAF15chr17

34165428

+
intron-3CDSENST00000571880ENST00000592237RAB40Bchr17

80656331

-TAF15chr17

34165428

+
intron-3CDSENST00000571880ENST00000311979RAB40Bchr17

80656331

-TAF15chr17

34165428

+
5UTR-3CDSENST00000269347ENST00000588240RAB40Bchr17

80656331

-TAF15chr17

34165428

+
5UTR-3CDSENST00000269347ENST00000592237RAB40Bchr17

80656331

-TAF15chr17

34165428

+
5UTR-3CDSENST00000269347ENST00000311979RAB40Bchr17

80656331

-TAF15chr17

34165428

+
In-frameENST00000538809ENST00000588240RAB40Bchr17

80656331

-TAF15chr17

34165428

+
In-frameENST00000538809ENST00000592237RAB40Bchr17

80656331

-TAF15chr17

34165428

+
In-frameENST00000538809ENST00000311979RAB40Bchr17

80656331

-TAF15chr17

34165428

+

Top

FusionProtFeatures for RAB40B_TAF15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RAB40B

Q12829

TAF15

Q92804

May be a substrate-recognition component of a SCF-likeECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complexwhich mediates the ubiquitination and subsequent proteasomaldegradation of target proteins. {ECO:0000250}. RNA and ssDNA-binding protein that may play specificroles during transcription initiation at distinct promoters. Canenter the preinitiation complex together with the RNA polymeraseII (Pol II). {ECO:0000269|PubMed:19124016}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRAB40Bchr17:80656331chr17:34165428ENST00000571995-1621_2847279Nucleotide bindingGTP
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916320_590258590Compositional biasNote=Arg/Gly-rich
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916320_590261593Compositional biasNote=Arg/Gly-rich
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916407_575258590RegionNote=21 X approximate tandem repeats of D-R-[S%2CG](0%2C3)-G-G-Y-G-G
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916407_575261593RegionNote=21 X approximate tandem repeats of D-R-[S%2CG](0%2C3)-G-G-Y-G-G
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916407_413258590RepeatNote=1
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916414_420258590RepeatNote=2
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916421_429258590RepeatNote=3
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916430_439258590RepeatNote=4
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916440_448258590RepeatNote=5
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916449_457258590RepeatNote=6
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916458_465258590RepeatNote=7
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916466_473258590RepeatNote=8
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916474_481258590RepeatNote=9
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916482_488258590RepeatNote=10
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916489_496258590RepeatNote=11
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916497_503258590RepeatNote=12
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916504_510258590RepeatNote=13
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916511_517258590RepeatNote=14
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916518_524258590RepeatNote=15
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916525_533258590RepeatNote=16
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916534_543258590RepeatNote=17
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916544_551258590RepeatNote=18
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916552_560258590RepeatNote=19
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916561_568258590RepeatNote=20
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916569_575258590RepeatNote=21
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916407_413261593RepeatNote=1
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916414_420261593RepeatNote=2
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916421_429261593RepeatNote=3
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916430_439261593RepeatNote=4
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916440_448261593RepeatNote=5
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916449_457261593RepeatNote=6
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916458_465261593RepeatNote=7
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916466_473261593RepeatNote=8
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916474_481261593RepeatNote=9
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916482_488261593RepeatNote=10
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916489_496261593RepeatNote=11
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916497_503261593RepeatNote=12
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916504_510261593RepeatNote=13
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916511_517261593RepeatNote=14
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916518_524261593RepeatNote=15
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916525_533261593RepeatNote=16
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916534_543261593RepeatNote=17
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916544_551261593RepeatNote=18
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916552_560261593RepeatNote=19
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916561_568261593RepeatNote=20
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916569_575261593RepeatNote=21
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916354_385258590Zinc fingerRanBP2-type
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916354_385261593Zinc fingerRanBP2-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRAB40Bchr17:80656331chr17:34165428ENST00000571995-16175_22847279DomainSOCS box
HgeneRAB40Bchr17:80656331chr17:34165428ENST00000571995-16126_12947279Nucleotide bindingGTP
HgeneRAB40Bchr17:80656331chr17:34165428ENST00000571995-1669_7347279Nucleotide bindingGTP
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+9161_208258590Compositional biasNote=Gln/Gly/Ser/Tyr-rich
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+9161_208261593Compositional biasNote=Gln/Gly/Ser/Tyr-rich
TgeneTAF15chr17:80656331chr17:34165428ENST00000311979+916234_320258590DomainRRM
TgeneTAF15chr17:80656331chr17:34165428ENST00000588240+916234_320261593DomainRRM


Top

FusionGeneSequence for RAB40B_TAF15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RAB40B_ENST00000571995_chr17_80656331_-_TAF15_ENST00000588240_chr17_34165428_+_379aa
MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPADK_EDRKTNDKSLYRQGHRKAKGGGNSVI__PSFS_GSH_LV_
WKRIPWQHH_SVLCH_KT_IHERRWKWRWAARPWRI_RSWRLSRERWRPQKWGLGLP_SVMRKTELCSKEFLQSVQ_A_TRGLSSLRRRF
PGERLRWREGLQRSWGQRWRPRRLWWRQKWGWLWWRQKQRWWLQRR_KWGRLWWRQKWGWLWWGQRRRLWWGQRRRLWRRPRRWLWRRSR
WLWRRPRWRLWWRPRRLWRRSRRLRRRSRRLWRRSRRLWRRQKPGGLWRRPWWWQWLRWRPKWRLWRRQEWWRLWRRPRWGLRRRPRWLW

>In-frame_RAB40B_ENST00000571995_chr17_80656331_-_TAF15_ENST00000592237_chr17_34165428_+_327aa
MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPADK_EDRKTNDKSLYRQGHRKAKGGGNSVI__PSFS_GSH_LV_
WKRIPWQHH_SVLCH_KT_IHERRWKWRWAARPWRI_RSWRLSRERWRPQKWGLGLP_SVMRKTELCSKEFLQSVQ_A_TRGLSSLRRRF
PGERLRWREGLQRSWGQRWRPRRLWWRQNRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGTGGDRGGGYGGDRGGTGGKMGGRNDYRNDQR

>In-frame_RAB40B_ENST00000571995_chr17_80656331_-_TAF15_ENST00000311979_chr17_34165428_+_379aa
MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPADK_EDRKTNDKSLYRQGHRKAKGGGNSVI__PSFS_GSH_LV_
WKRIPWQHH_SVLCH_KT_IHERRWKWRWAARPWRI_RSWRLSRERWRPQKWGLGLP_SVMRKTELCSKEFLQSVQ_A_TRGLSSLRRRF
PGERLRWREGLQRSWGQRWRPRRLWWRQKWGWLWWRQKQRWWLQRR_KWGRLWWRQKWGWLWWGQRRRLWWGQRRRLWRRPRRWLWRRSR
WLWRRPRWRLWWRPRRLWRRSRRLRRRSRRLWRRSRRLWRRQKPGGLWRRPWWWQWLRWRPKWRLWRRQEWWRLWRRPRWGLRRRPRWLW

>In-frame_RAB40B_ENST00000538809_chr17_80656331_-_TAF15_ENST00000588240_chr17_34165428_+_379aa
MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPADK_EDRKTNDKSLYRQGHRKAKGGGNSVI__PSFS_GSH_LV_
WKRIPWQHH_SVLCH_KT_IHERRWKWRWAARPWRI_RSWRLSRERWRPQKWGLGLP_SVMRKTELCSKEFLQSVQ_A_TRGLSSLRRRF
PGERLRWREGLQRSWGQRWRPRRLWWRQKWGWLWWRQKQRWWLQRR_KWGRLWWRQKWGWLWWGQRRRLWWGQRRRLWRRPRRWLWRRSR
WLWRRPRWRLWWRPRRLWRRSRRLRRRSRRLWRRSRRLWRRQKPGGLWRRPWWWQWLRWRPKWRLWRRQEWWRLWRRPRWGLRRRPRWLW

>In-frame_RAB40B_ENST00000538809_chr17_80656331_-_TAF15_ENST00000592237_chr17_34165428_+_327aa
MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPADK_EDRKTNDKSLYRQGHRKAKGGGNSVI__PSFS_GSH_LV_
WKRIPWQHH_SVLCH_KT_IHERRWKWRWAARPWRI_RSWRLSRERWRPQKWGLGLP_SVMRKTELCSKEFLQSVQ_A_TRGLSSLRRRF
PGERLRWREGLQRSWGQRWRPRRLWWRQNRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGTGGDRGGGYGGDRGGTGGKMGGRNDYRNDQR

>In-frame_RAB40B_ENST00000538809_chr17_80656331_-_TAF15_ENST00000311979_chr17_34165428_+_379aa
MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPADK_EDRKTNDKSLYRQGHRKAKGGGNSVI__PSFS_GSH_LV_
WKRIPWQHH_SVLCH_KT_IHERRWKWRWAARPWRI_RSWRLSRERWRPQKWGLGLP_SVMRKTELCSKEFLQSVQ_A_TRGLSSLRRRF
PGERLRWREGLQRSWGQRWRPRRLWWRQKWGWLWWRQKQRWWLQRR_KWGRLWWRQKWGWLWWGQRRRLWWGQRRRLWRRPRRWLWRRSR
WLWRRPRWRLWWRPRRLWRRSRRLRRRSRRLWRRSRRLWRRQKPGGLWRRPWWWQWLRWRPKWRLWRRQEWWRLWRRPRWGLRRRPRWLW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RAB40B_ENST00000571995_chr17_80656331_-_TAF15_ENST00000588240_chr17_34165428_+_1138nt
ATGAGCGCCCTGGGCAGCCCGGTCCGGGCCTACGACTTTCTGCTCAAGTTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATC
CTGGCGAGCCTGCAGGATGGCGCGGCCGAGTCCCCGTACGGCCACCCGGCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTA
TACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGA
TGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCG
GCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTC
ATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTT
CCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGG
GGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGG
CTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGG
TGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGG
TTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGA
CCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGG

>In-frame_RAB40B_ENST00000571995_chr17_80656331_-_TAF15_ENST00000592237_chr17_34165428_+_982nt
ATGAGCGCCCTGGGCAGCCCGGTCCGGGCCTACGACTTTCTGCTCAAGTTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATC
CTGGCGAGCCTGCAGGATGGCGCGGCCGAGTCCCCGTACGGCCACCCGGCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTA
TACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGA
TGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCG
GCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTC
ATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTT
CCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGG
GGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTAT
GGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGC
AACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCT

>In-frame_RAB40B_ENST00000571995_chr17_80656331_-_TAF15_ENST00000311979_chr17_34165428_+_1138nt
ATGAGCGCCCTGGGCAGCCCGGTCCGGGCCTACGACTTTCTGCTCAAGTTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATC
CTGGCGAGCCTGCAGGATGGCGCGGCCGAGTCCCCGTACGGCCACCCGGCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTA
TACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGA
TGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCG
GCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTC
ATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTT
CCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGG
GGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGG
CTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGG
TGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGG
TTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGA
CCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGG

>In-frame_RAB40B_ENST00000538809_chr17_80656331_-_TAF15_ENST00000588240_chr17_34165428_+_1138nt
ATGAGCGCCCTGGGCAGCCCGGTCCGGGCCTACGACTTTCTGCTCAAGTTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATC
CTGGCGAGCCTGCAGGATGGCGCGGCCGAGTCCCCGTACGGCCACCCGGCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTA
TACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGA
TGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCG
GCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTC
ATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTT
CCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGG
GGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGG
CTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGG
TGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGG
TTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGA
CCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGG

>In-frame_RAB40B_ENST00000538809_chr17_80656331_-_TAF15_ENST00000592237_chr17_34165428_+_982nt
ATGAGCGCCCTGGGCAGCCCGGTCCGGGCCTACGACTTTCTGCTCAAGTTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATC
CTGGCGAGCCTGCAGGATGGCGCGGCCGAGTCCCCGTACGGCCACCCGGCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTA
TACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGA
TGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCG
GCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTC
ATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTT
CCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGG
GGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTAT
GGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGC
AACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCT

>In-frame_RAB40B_ENST00000538809_chr17_80656331_-_TAF15_ENST00000311979_chr17_34165428_+_1138nt
ATGAGCGCCCTGGGCAGCCCGGTCCGGGCCTACGACTTTCTGCTCAAGTTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATC
CTGGCGAGCCTGCAGGATGGCGCGGCCGAGTCCCCGTACGGCCACCCGGCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTA
TACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGA
TGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCG
GCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTC
ATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTT
CCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGG
GGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGG
CTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGG
TGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGG
TTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGA
CCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RAB40B_ENST00000571995_chr17_80656331_-_TAF15_ENST00000588240_chr17_34165428_+_1567nt
AGCGCTGGGCGGCGGGGCGGGGCCGGAGGCGAGCAAGGACTCGGGGCCCGCGCGGCGCCTCTCGGGGCCGGGCCGCCGCCTCTGCGCTCA
GCCCCGCAGGCCGGGCATGGGTGGGGGCGCCGGGCCGTCACGATGAGCGCCCTGGGCAGCCCGGTCCGGGCCTACGACTTTCTGCTCAAG
TTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATCCTGGCGAGCCTGCAGGATGGCGCGGCCGAGTCCCCGTACGGCCACCCG
GCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATT
TGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAG
AAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGG
TGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAA
TGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGG
CAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGA
TAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGG
CTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGG
CTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGG
CTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGG
AGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCG
ACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGG
CCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGA
GATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATA

>In-frame_RAB40B_ENST00000571995_chr17_80656331_-_TAF15_ENST00000592237_chr17_34165428_+_1246nt
AGCGCTGGGCGGCGGGGCGGGGCCGGAGGCGAGCAAGGACTCGGGGCCCGCGCGGCGCCTCTCGGGGCCGGGCCGCCGCCTCTGCGCTCA
GCCCCGCAGGCCGGGCATGGGTGGGGGCGCCGGGCCGTCACGATGAGCGCCCTGGGCAGCCCGGTCCGGGCCTACGACTTTCTGCTCAAG
TTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATCCTGGCGAGCCTGCAGGATGGCGCGGCCGAGTCCCCGTACGGCCACCCG
GCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATT
TGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAG
AAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGG
TGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAA
TGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGG
CAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGAC
CGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGA
GGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACAT
GATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTAT
TTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAG

>In-frame_RAB40B_ENST00000571995_chr17_80656331_-_TAF15_ENST00000311979_chr17_34165428_+_1559nt
AGCGCTGGGCGGCGGGGCGGGGCCGGAGGCGAGCAAGGACTCGGGGCCCGCGCGGCGCCTCTCGGGGCCGGGCCGCCGCCTCTGCGCTCA
GCCCCGCAGGCCGGGCATGGGTGGGGGCGCCGGGCCGTCACGATGAGCGCCCTGGGCAGCCCGGTCCGGGCCTACGACTTTCTGCTCAAG
TTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATCCTGGCGAGCCTGCAGGATGGCGCGGCCGAGTCCCCGTACGGCCACCCG
GCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATT
TGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAG
AAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGG
TGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAA
TGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGG
CAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGA
TAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGG
CTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGG
CTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGG
CTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGG
AGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCG
ACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGG
CCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGA
GATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATA

>In-frame_RAB40B_ENST00000538809_chr17_80656331_-_TAF15_ENST00000588240_chr17_34165428_+_1501nt
GCCGGGCCGCCGCCTCTGCGCTCAGCCCCGCAGGCCGGGCATGGGTGGGGGCGCCGGGCCGTCACGATGAGCGCCCTGGGCAGCCCGGTC
CGGGCCTACGACTTTCTGCTCAAGTTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATCCTGGCGAGCCTGCAGGATGGCGCG
GCCGAGTCCCCGTACGGCCACCCGGCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCC
AAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACAT
CATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGG
TCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCG
AAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGA
GAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAG
CAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGG
CTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGG
AGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTA
TGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGA
CAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGA
CTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAG
TTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGT
TTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGC

>In-frame_RAB40B_ENST00000538809_chr17_80656331_-_TAF15_ENST00000592237_chr17_34165428_+_1180nt
GCCGGGCCGCCGCCTCTGCGCTCAGCCCCGCAGGCCGGGCATGGGTGGGGGCGCCGGGCCGTCACGATGAGCGCCCTGGGCAGCCCGGTC
CGGGCCTACGACTTTCTGCTCAAGTTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATCCTGGCGAGCCTGCAGGATGGCGCG
GCCGAGTCCCCGTACGGCCACCCGGCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCC
AAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACAT
CATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGG
TCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCG
AAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGA
GAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAGACCGTGGT
GGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTAC
GGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTT
TGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAA
ATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTC
CAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATACTGCAATAAAGGCTGCTTG

>In-frame_RAB40B_ENST00000538809_chr17_80656331_-_TAF15_ENST00000311979_chr17_34165428_+_1493nt
GCCGGGCCGCCGCCTCTGCGCTCAGCCCCGCAGGCCGGGCATGGGTGGGGGCGCCGGGCCGTCACGATGAGCGCCCTGGGCAGCCCGGTC
CGGGCCTACGACTTTCTGCTCAAGTTCCTGCTGGTGGGCGACAGCGACGTGGGCAAGGGCGAGATCCTGGCGAGCCTGCAGGATGGCGCG
GCCGAGTCCCCGTACGGCCACCCGGCGGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCC
AAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACAT
CATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGG
TCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCG
AAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGA
GAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAG
CAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGG
CTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGG
AGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTA
TGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGA
CAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGA
CTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAG
TTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGT
TTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGC


Top

FusionGenePPI for RAB40B_TAF15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RAB40BTCEB1, CUL5, TCEB2, APP, FHIT, WFDC1, RABGGTB, RAB40AL, RAB40C, ISCA1, DCAF17, ANKRD27, FHL3TAF15SAFB, PRMT1, TAF7, TAF5, TAF13, TAF11, POLR2C, POLR2G, POLR2E, SF1, KAT2B, POLR2A, HIST2H2AC, HIST1H3A, HIST2H4A, CACNA1A, SIRT7, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, DDB1, TPR, SAP30BP, RNF168, SCARB2, TPM2, TMED9, MED26, PRMT8, FUS, RPA3, RPA2, RPA1, HIST3H3, CUL7, OBSL1, EZH2, SUZ12, EED, RNF2, BMI1, RPS6KB2, ACAA2, SFN, HNRNPA1, PPP1CB, MATR3, MED12, MCM2, NF2, DNPEP, KLHL8, TRIM25, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RAB40B_TAF15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RAB40B_TAF15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRAB40BC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneTAF15C0029463Osteosarcoma1CTD_human
TgeneTAF15C0038356Stomach Neoplasms1CTD_human