FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29922

FusionGeneSummary for RAB1A_SPRED2

check button Fusion gene summary
Fusion gene informationFusion gene name: RAB1A_SPRED2
Fusion gene ID: 29922
HgeneTgene
Gene symbol

RAB1A

SPRED2

Gene ID

5861

200734

Gene nameRAB1A, member RAS oncogene familysprouty related EVH1 domain containing 2
SynonymsRAB1|YPT1Spred-2
Cytomap

2p14

2p14

Type of geneprotein-codingprotein-coding
Descriptionras-related protein Rab-1AGTP binding protein Rab1aRAB1, member RAS oncogene familyRab GTPase YPT1 homologYPT1-related proteinsprouty-related, EVH1 domain-containing protein 2sprouty protein with EVH-1 domain 2, related sequence
Modification date2018052320180519
UniProtAcc

P62820

Q7Z698

Ensembl transtripts involved in fusion geneENST00000494188, ENST00000409892, 
ENST00000409784, ENST00000398529, 
ENST00000409751, ENST00000260638, 
ENST00000356214, 
ENST00000356388, 
ENST00000443619, ENST00000474228, 
Fusion gene scores* DoF score7 X 6 X 3=1263 X 3 X 2=18
# samples 83
** MAII scorelog2(8/126*10)=-0.655351828612554
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RAB1A [Title/Abstract] AND SPRED2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A8-A07O-01ARAB1Achr2

65357027

-SPRED2chr2

65544017

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5UTR-3CDSENST00000494188ENST00000356388RAB1Achr2

65357027

-SPRED2chr2

65544017

-
5UTR-3CDSENST00000494188ENST00000443619RAB1Achr2

65357027

-SPRED2chr2

65544017

-
5UTR-5UTRENST00000494188ENST00000474228RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000409892ENST00000356388RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000409892ENST00000443619RAB1Achr2

65357027

-SPRED2chr2

65544017

-
5CDS-5UTRENST00000409892ENST00000474228RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000409784ENST00000356388RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000409784ENST00000443619RAB1Achr2

65357027

-SPRED2chr2

65544017

-
5CDS-5UTRENST00000409784ENST00000474228RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000398529ENST00000356388RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000398529ENST00000443619RAB1Achr2

65357027

-SPRED2chr2

65544017

-
5CDS-5UTRENST00000398529ENST00000474228RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000409751ENST00000356388RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000409751ENST00000443619RAB1Achr2

65357027

-SPRED2chr2

65544017

-
5CDS-5UTRENST00000409751ENST00000474228RAB1Achr2

65357027

-SPRED2chr2

65544017

-
intron-3CDSENST00000260638ENST00000356388RAB1Achr2

65357027

-SPRED2chr2

65544017

-
intron-3CDSENST00000260638ENST00000443619RAB1Achr2

65357027

-SPRED2chr2

65544017

-
intron-5UTRENST00000260638ENST00000474228RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000356214ENST00000356388RAB1Achr2

65357027

-SPRED2chr2

65544017

-
In-frameENST00000356214ENST00000443619RAB1Achr2

65357027

-SPRED2chr2

65544017

-
5CDS-5UTRENST00000356214ENST00000474228RAB1Achr2

65357027

-SPRED2chr2

65544017

-

Top

FusionProtFeatures for RAB1A_SPRED2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RAB1A

P62820

SPRED2

Q7Z698

The small GTPases Rab are key regulators ofintracellular membrane trafficking, from the formation oftransport vesicles to their fusion with membranes. Rabs cyclebetween an inactive GDP-bound form and an active GTP-bound formthat is able to recruit to membranes different sets of downstreameffectors directly responsible for vesicle formation, movement,tethering and fusion. RAB1A regulates vesicular protein transportfrom the endoplasmic reticulum (ER) to the Golgi compartment andon to the cell surface, and plays a role in IL-8 and growthhormone secretion. Regulates the level of CASR present at the cellmembrane. Plays a role in cell adhesion and cell migration, viaits role in protein trafficking. Plays a role in autophagosomeassembly and cellular defense reactions against pathogenicbacteria. Plays a role in microtubule-dependent protein transportby early endosomes and in anterograde melanosome transport.{ECO:0000269|PubMed:20639577, ECO:0000269|PubMed:20861236,ECO:0000269|PubMed:21303926, ECO:0000269|PubMed:22939626}. Negatively regulates Ras signaling pathways anddownstream activation of MAP kinases.{ECO:0000269|PubMed:15683364}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for RAB1A_SPRED2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RAB1A_ENST00000409892_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG

>In-frame_RAB1A_ENST00000409892_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG

>In-frame_RAB1A_ENST00000409784_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG

>In-frame_RAB1A_ENST00000409784_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG

>In-frame_RAB1A_ENST00000398529_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG

>In-frame_RAB1A_ENST00000398529_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG

>In-frame_RAB1A_ENST00000409751_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG

>In-frame_RAB1A_ENST00000409751_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG

>In-frame_RAB1A_ENST00000356214_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG

>In-frame_RAB1A_ENST00000356214_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_280aa
MSSMNPE_QLQTVLLIPLRRESNLLGQSPLPHPVSTGGFIPWATSTTHTPQTTITSISRCQGPTAR_ASRTTTRRSCASTPGRRSG_RGT
RITGTHPSGASTRTPRRTRTPPTCASPRARSPSMTTTTPTWTPQTLA_ARTPKAAGAA_SRRSPPGASRGGGRRTESARGACTAGTCSTT
RRTAGATARTRPTP_ELASAG_AACGARTACSITVCRTPRETIQTLARAILATRSFASGGWLLLPCLSWPPVCAVTCPFGPATTAE_CAG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RAB1A_ENST00000409892_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT

>In-frame_RAB1A_ENST00000409892_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT

>In-frame_RAB1A_ENST00000409784_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT

>In-frame_RAB1A_ENST00000409784_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT

>In-frame_RAB1A_ENST00000398529_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT

>In-frame_RAB1A_ENST00000398529_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT

>In-frame_RAB1A_ENST00000409751_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT

>In-frame_RAB1A_ENST00000409751_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT

>In-frame_RAB1A_ENST00000356214_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT

>In-frame_RAB1A_ENST00000356214_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_842nt
ATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCTCCTCTC
CCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGCCGATGC
CAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGGGGTACG
AGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGGGCGAGG
TCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCGTGATCA
AGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCAACCACG
AGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGGACAGCA
TGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCCGGTGGA
TGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGTGCAGGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RAB1A_ENST00000409892_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_3682nt
TTTTGGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACAG
CCTATCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCAG
CTGCAGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACA
ATCTCCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGAT
CAGCCGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATG
ACGGGGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCC
AAGGGCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGC
AGCGTGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATG
TTCAACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGC
GCGGACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGC
CTCCGGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTG
ATGTGCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTCG
TCTCTTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGAG
GCACCATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTCG
CACAGTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGATT
TCCTGTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTCC
AAGAGCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATGA
AACCCGACAGAAGTATCTCAGCCTGCAGTCAGTTATTATGTATAGGAGGTGAGCTAGTTAACAAACTTGTACCACAAAACAATATCGCTT
TAACTTTTCTAAAGCCAAATTTCCCATGTAAGCTGCAGTTTCTATCTTTAGCCCATCATCATTTTCTGCCCCCCCAAAATCTGTTGAAAT
GATTCACTGATGCAAAACATTCACCCGTAATAGACTGAGAATTGAGCCTTAACTTCAGATTAACTTGTGAGAATCAGGAAAATTCCTTCA
ACTGCATTGCATCCTCTTGGACCAGGGCTAGAATGGGGATTTCAGGTTTCTATGAGCCTCCCCATTACCCCTAAAGTAGAACATTTTTTA
AATTGTGTTGCCACCACTTCTAAAAATTTAGCAATATTAGAATAGGATACTAGTGAAGTAAGAAATTTTGCTTGTTGTTTTGCAAACCAA
ATAGTTTCCTCAAACACAAATCAGTGTTCCCACGAACAAGTTCCAGTTGAGAAACACTAAGGTTATGGTGAATAAAACCATAGGGAGCTT
CTTCCCCCCAACCCCTGGCTATTTTATATTAATGGGGAGAGGGGATTTTTAAATGTCATAAATTTGAAGAGTGGTGGGTTGCATTTTCTT
CATGGGTTTATGTTTTCGTTTCATTTTGGACTCAATTTCACATCACCAAATTCCTCATTTATACTTGGGGAAAAAACAAGGCCATATGTA
AAAACCCTTCCAATGCCTAAGTGTCTTTCTCCTGCAACTCCAAACCCAGACTCGCCACTTTGGGTGCACAGGTGGTTAGGTCAGCCAACT
GGTTCTGCCTGTCGCCTTGCCACGGAGGAGGCTTCTAATTAGCTGGAAAAGAGTATTTTTCTAATACGTTGCAAGGATTAGCCAAATCTT
CTTATTGAAGAAAGAAGAAAAGTGAAGAGTGGTTACCTATACCTAGCATAGTACAATCAGAACCTCGTGGAGACCACCGGGGACAGGCTT
GCGGACGCCGGCTGTTCTTCCCGCCACGATCTTTCTGTGGTAGCGGCCAGCAGAAGACATGGCCTGCTCCCCACTCCCTTTCCCCACTCC
TTCTTTATTGCACACAGGACACCAGTCTTCAAGGAAAGGGACTTTTTTCCAGTCTGCCAATCATATTGGGAAAGTGCTAGCTGTGCTCAC
CTTCATGGGGCTGTTTCCAGCTCGTCCACAAGCTCATCGATTTTCTTTAGTAGATTACCGGTGTAAATACCCAGTGTGCTTATGAGTCAG
TTAGTAGACGTCTTCATTCATTGGAGTAACTGGTTTAGGCTTTCCAGTTTGGAAAAGGAGCAGAGAGCTGTCCATCTGGATTGATGGAAG
AAAAGAGAACCTCATCCATGCCTGGAGAACATCTAGAAAACCTTCAGCCAGCCTCCAGTGCTGTCGAGAGACCACCTTCCCCCGACCCGG
AGGCACTTCCTTGGGGTCTTTCTCTAGGGTCTCTTCTCTACAAAGCACAACACTAATGTTCGTTTCCTTAGACCTCAGTTCAAGTGCCCC
TATTTATTTCAATAAGAACGCACATATCCCAGCTGTTTTTTGTTTGTCACCTCTATTTAGTTGTTACCTGTTTCTCTCTTCTTTCACCCC
TTGTCCTTTTCCACCCTTTTAAGAGTTACGCTAGCAGATCTTACTCCACGTATACTTTTTGGTTTGTGAAGGCATCGGTTAAGGGCACAA
AGACAGCCATGGGGACATTTATGTAAATACGTCTCTAATTGCCACACTGCAGCTGAACAGTGTGTAGTATTTTCCCAGTCAGCTTTGCCA
TACTGACGTCAATCATTTGAGAGAAATTATTCAGATTTTATTTTTGTATCTGTGGTAACAAAACATTAACCAAAAGATTTTCTGTCCAGA
AGCCTCCCCGACCCCCCAAGCTATTTGCTCACATTAACAAATTAAAGTGCCTGAAGCATAATTCATTCTTTACCTGTATACTAAAAACCC
TGTTGTATTGATTTTTTTATAATAAGCCTTTTTACCTCTGTGTAAAAAATATATATACAAGTGTATGATGTACATTTTAGTTCTTAACTT

>In-frame_RAB1A_ENST00000409892_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_1540nt
TTTTGGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACAG
CCTATCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCAG
CTGCAGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACA
ATCTCCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGAT
CAGCCGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATG
ACGGGGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCC
AAGGGCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGC
AGCGTGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATG
TTCAACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGC
GCGGACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGC
CTCCGGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTG
ATGTGCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTCG
TCTCTTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGAG
GCACCATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTCG
CACAGTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGATT
TCCTGTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTCC
AAGAGCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATGA

>In-frame_RAB1A_ENST00000409784_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_3683nt
ATTTTGGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACA
GCCTATCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCA
GCTGCAGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGAC
AATCTCCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGA
TCAGCCGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGAT
GACGGGGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGC
CAAGGGCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGG
CAGCGTGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACAT
GTTCAACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTG
CGCGGACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTG
CCTCCGGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGT
GATGTGCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTC
GTCTCTTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGA
GGCACCATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTC
GCACAGTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGAT
TTCCTGTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTC
CAAGAGCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATG
AAACCCGACAGAAGTATCTCAGCCTGCAGTCAGTTATTATGTATAGGAGGTGAGCTAGTTAACAAACTTGTACCACAAAACAATATCGCT
TTAACTTTTCTAAAGCCAAATTTCCCATGTAAGCTGCAGTTTCTATCTTTAGCCCATCATCATTTTCTGCCCCCCCAAAATCTGTTGAAA
TGATTCACTGATGCAAAACATTCACCCGTAATAGACTGAGAATTGAGCCTTAACTTCAGATTAACTTGTGAGAATCAGGAAAATTCCTTC
AACTGCATTGCATCCTCTTGGACCAGGGCTAGAATGGGGATTTCAGGTTTCTATGAGCCTCCCCATTACCCCTAAAGTAGAACATTTTTT
AAATTGTGTTGCCACCACTTCTAAAAATTTAGCAATATTAGAATAGGATACTAGTGAAGTAAGAAATTTTGCTTGTTGTTTTGCAAACCA
AATAGTTTCCTCAAACACAAATCAGTGTTCCCACGAACAAGTTCCAGTTGAGAAACACTAAGGTTATGGTGAATAAAACCATAGGGAGCT
TCTTCCCCCCAACCCCTGGCTATTTTATATTAATGGGGAGAGGGGATTTTTAAATGTCATAAATTTGAAGAGTGGTGGGTTGCATTTTCT
TCATGGGTTTATGTTTTCGTTTCATTTTGGACTCAATTTCACATCACCAAATTCCTCATTTATACTTGGGGAAAAAACAAGGCCATATGT
AAAAACCCTTCCAATGCCTAAGTGTCTTTCTCCTGCAACTCCAAACCCAGACTCGCCACTTTGGGTGCACAGGTGGTTAGGTCAGCCAAC
TGGTTCTGCCTGTCGCCTTGCCACGGAGGAGGCTTCTAATTAGCTGGAAAAGAGTATTTTTCTAATACGTTGCAAGGATTAGCCAAATCT
TCTTATTGAAGAAAGAAGAAAAGTGAAGAGTGGTTACCTATACCTAGCATAGTACAATCAGAACCTCGTGGAGACCACCGGGGACAGGCT
TGCGGACGCCGGCTGTTCTTCCCGCCACGATCTTTCTGTGGTAGCGGCCAGCAGAAGACATGGCCTGCTCCCCACTCCCTTTCCCCACTC
CTTCTTTATTGCACACAGGACACCAGTCTTCAAGGAAAGGGACTTTTTTCCAGTCTGCCAATCATATTGGGAAAGTGCTAGCTGTGCTCA
CCTTCATGGGGCTGTTTCCAGCTCGTCCACAAGCTCATCGATTTTCTTTAGTAGATTACCGGTGTAAATACCCAGTGTGCTTATGAGTCA
GTTAGTAGACGTCTTCATTCATTGGAGTAACTGGTTTAGGCTTTCCAGTTTGGAAAAGGAGCAGAGAGCTGTCCATCTGGATTGATGGAA
GAAAAGAGAACCTCATCCATGCCTGGAGAACATCTAGAAAACCTTCAGCCAGCCTCCAGTGCTGTCGAGAGACCACCTTCCCCCGACCCG
GAGGCACTTCCTTGGGGTCTTTCTCTAGGGTCTCTTCTCTACAAAGCACAACACTAATGTTCGTTTCCTTAGACCTCAGTTCAAGTGCCC
CTATTTATTTCAATAAGAACGCACATATCCCAGCTGTTTTTTGTTTGTCACCTCTATTTAGTTGTTACCTGTTTCTCTCTTCTTTCACCC
CTTGTCCTTTTCCACCCTTTTAAGAGTTACGCTAGCAGATCTTACTCCACGTATACTTTTTGGTTTGTGAAGGCATCGGTTAAGGGCACA
AAGACAGCCATGGGGACATTTATGTAAATACGTCTCTAATTGCCACACTGCAGCTGAACAGTGTGTAGTATTTTCCCAGTCAGCTTTGCC
ATACTGACGTCAATCATTTGAGAGAAATTATTCAGATTTTATTTTTGTATCTGTGGTAACAAAACATTAACCAAAAGATTTTCTGTCCAG
AAGCCTCCCCGACCCCCCAAGCTATTTGCTCACATTAACAAATTAAAGTGCCTGAAGCATAATTCATTCTTTACCTGTATACTAAAAACC
CTGTTGTATTGATTTTTTTATAATAAGCCTTTTTACCTCTGTGTAAAAAATATATATACAAGTGTATGATGTACATTTTAGTTCTTAACT

>In-frame_RAB1A_ENST00000409784_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_1541nt
ATTTTGGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACA
GCCTATCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCA
GCTGCAGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGAC
AATCTCCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGA
TCAGCCGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGAT
GACGGGGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGC
CAAGGGCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGG
CAGCGTGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACAT
GTTCAACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTG
CGCGGACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTG
CCTCCGGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGT
GATGTGCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTC
GTCTCTTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGA
GGCACCATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTC
GCACAGTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGAT
TTCCTGTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTC
CAAGAGCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATG

>In-frame_RAB1A_ENST00000398529_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_3678nt
GGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACAGCCTA
TCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCAGCTGC
AGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCT
CCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGC
CGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGG
GGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGG
GCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCG
TGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCA
ACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGG
ACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCC
GGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGT
GCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTCGTCTC
TTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGAGGCAC
CATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTCGCACA
GTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGATTTCCT
GTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTCCAAGA
GCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATGAAACC
CGACAGAAGTATCTCAGCCTGCAGTCAGTTATTATGTATAGGAGGTGAGCTAGTTAACAAACTTGTACCACAAAACAATATCGCTTTAAC
TTTTCTAAAGCCAAATTTCCCATGTAAGCTGCAGTTTCTATCTTTAGCCCATCATCATTTTCTGCCCCCCCAAAATCTGTTGAAATGATT
CACTGATGCAAAACATTCACCCGTAATAGACTGAGAATTGAGCCTTAACTTCAGATTAACTTGTGAGAATCAGGAAAATTCCTTCAACTG
CATTGCATCCTCTTGGACCAGGGCTAGAATGGGGATTTCAGGTTTCTATGAGCCTCCCCATTACCCCTAAAGTAGAACATTTTTTAAATT
GTGTTGCCACCACTTCTAAAAATTTAGCAATATTAGAATAGGATACTAGTGAAGTAAGAAATTTTGCTTGTTGTTTTGCAAACCAAATAG
TTTCCTCAAACACAAATCAGTGTTCCCACGAACAAGTTCCAGTTGAGAAACACTAAGGTTATGGTGAATAAAACCATAGGGAGCTTCTTC
CCCCCAACCCCTGGCTATTTTATATTAATGGGGAGAGGGGATTTTTAAATGTCATAAATTTGAAGAGTGGTGGGTTGCATTTTCTTCATG
GGTTTATGTTTTCGTTTCATTTTGGACTCAATTTCACATCACCAAATTCCTCATTTATACTTGGGGAAAAAACAAGGCCATATGTAAAAA
CCCTTCCAATGCCTAAGTGTCTTTCTCCTGCAACTCCAAACCCAGACTCGCCACTTTGGGTGCACAGGTGGTTAGGTCAGCCAACTGGTT
CTGCCTGTCGCCTTGCCACGGAGGAGGCTTCTAATTAGCTGGAAAAGAGTATTTTTCTAATACGTTGCAAGGATTAGCCAAATCTTCTTA
TTGAAGAAAGAAGAAAAGTGAAGAGTGGTTACCTATACCTAGCATAGTACAATCAGAACCTCGTGGAGACCACCGGGGACAGGCTTGCGG
ACGCCGGCTGTTCTTCCCGCCACGATCTTTCTGTGGTAGCGGCCAGCAGAAGACATGGCCTGCTCCCCACTCCCTTTCCCCACTCCTTCT
TTATTGCACACAGGACACCAGTCTTCAAGGAAAGGGACTTTTTTCCAGTCTGCCAATCATATTGGGAAAGTGCTAGCTGTGCTCACCTTC
ATGGGGCTGTTTCCAGCTCGTCCACAAGCTCATCGATTTTCTTTAGTAGATTACCGGTGTAAATACCCAGTGTGCTTATGAGTCAGTTAG
TAGACGTCTTCATTCATTGGAGTAACTGGTTTAGGCTTTCCAGTTTGGAAAAGGAGCAGAGAGCTGTCCATCTGGATTGATGGAAGAAAA
GAGAACCTCATCCATGCCTGGAGAACATCTAGAAAACCTTCAGCCAGCCTCCAGTGCTGTCGAGAGACCACCTTCCCCCGACCCGGAGGC
ACTTCCTTGGGGTCTTTCTCTAGGGTCTCTTCTCTACAAAGCACAACACTAATGTTCGTTTCCTTAGACCTCAGTTCAAGTGCCCCTATT
TATTTCAATAAGAACGCACATATCCCAGCTGTTTTTTGTTTGTCACCTCTATTTAGTTGTTACCTGTTTCTCTCTTCTTTCACCCCTTGT
CCTTTTCCACCCTTTTAAGAGTTACGCTAGCAGATCTTACTCCACGTATACTTTTTGGTTTGTGAAGGCATCGGTTAAGGGCACAAAGAC
AGCCATGGGGACATTTATGTAAATACGTCTCTAATTGCCACACTGCAGCTGAACAGTGTGTAGTATTTTCCCAGTCAGCTTTGCCATACT
GACGTCAATCATTTGAGAGAAATTATTCAGATTTTATTTTTGTATCTGTGGTAACAAAACATTAACCAAAAGATTTTCTGTCCAGAAGCC
TCCCCGACCCCCCAAGCTATTTGCTCACATTAACAAATTAAAGTGCCTGAAGCATAATTCATTCTTTACCTGTATACTAAAAACCCTGTT
GTATTGATTTTTTTATAATAAGCCTTTTTACCTCTGTGTAAAAAATATATATACAAGTGTATGATGTACATTTTAGTTCTTAACTTTTTT

>In-frame_RAB1A_ENST00000398529_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_1536nt
GGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACAGCCTA
TCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCAGCTGC
AGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAATCT
CCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATCAGC
CGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGACGG
GGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCAAGG
GCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCAGCG
TGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGTTCA
ACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCGCGG
ACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCCTCC
GGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGATGT
GCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTCGTCTC
TTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGAGGCAC
CATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTCGCACA
GTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGATTTCCT
GTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTCCAAGA
GCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATGAAACC

>In-frame_RAB1A_ENST00000409751_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_3681nt
TTTGGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACAGC
CTATCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCAGC
TGCAGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAA
TCTCCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATC
AGCCGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGA
CGGGGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCA
AGGGCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCA
GCGTGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGT
TCAACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCG
CGGACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCC
TCCGGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGA
TGTGCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTCGT
CTCTTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGAGG
CACCATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTCGC
ACAGTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGATTT
CCTGTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTCCA
AGAGCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATGAA
ACCCGACAGAAGTATCTCAGCCTGCAGTCAGTTATTATGTATAGGAGGTGAGCTAGTTAACAAACTTGTACCACAAAACAATATCGCTTT
AACTTTTCTAAAGCCAAATTTCCCATGTAAGCTGCAGTTTCTATCTTTAGCCCATCATCATTTTCTGCCCCCCCAAAATCTGTTGAAATG
ATTCACTGATGCAAAACATTCACCCGTAATAGACTGAGAATTGAGCCTTAACTTCAGATTAACTTGTGAGAATCAGGAAAATTCCTTCAA
CTGCATTGCATCCTCTTGGACCAGGGCTAGAATGGGGATTTCAGGTTTCTATGAGCCTCCCCATTACCCCTAAAGTAGAACATTTTTTAA
ATTGTGTTGCCACCACTTCTAAAAATTTAGCAATATTAGAATAGGATACTAGTGAAGTAAGAAATTTTGCTTGTTGTTTTGCAAACCAAA
TAGTTTCCTCAAACACAAATCAGTGTTCCCACGAACAAGTTCCAGTTGAGAAACACTAAGGTTATGGTGAATAAAACCATAGGGAGCTTC
TTCCCCCCAACCCCTGGCTATTTTATATTAATGGGGAGAGGGGATTTTTAAATGTCATAAATTTGAAGAGTGGTGGGTTGCATTTTCTTC
ATGGGTTTATGTTTTCGTTTCATTTTGGACTCAATTTCACATCACCAAATTCCTCATTTATACTTGGGGAAAAAACAAGGCCATATGTAA
AAACCCTTCCAATGCCTAAGTGTCTTTCTCCTGCAACTCCAAACCCAGACTCGCCACTTTGGGTGCACAGGTGGTTAGGTCAGCCAACTG
GTTCTGCCTGTCGCCTTGCCACGGAGGAGGCTTCTAATTAGCTGGAAAAGAGTATTTTTCTAATACGTTGCAAGGATTAGCCAAATCTTC
TTATTGAAGAAAGAAGAAAAGTGAAGAGTGGTTACCTATACCTAGCATAGTACAATCAGAACCTCGTGGAGACCACCGGGGACAGGCTTG
CGGACGCCGGCTGTTCTTCCCGCCACGATCTTTCTGTGGTAGCGGCCAGCAGAAGACATGGCCTGCTCCCCACTCCCTTTCCCCACTCCT
TCTTTATTGCACACAGGACACCAGTCTTCAAGGAAAGGGACTTTTTTCCAGTCTGCCAATCATATTGGGAAAGTGCTAGCTGTGCTCACC
TTCATGGGGCTGTTTCCAGCTCGTCCACAAGCTCATCGATTTTCTTTAGTAGATTACCGGTGTAAATACCCAGTGTGCTTATGAGTCAGT
TAGTAGACGTCTTCATTCATTGGAGTAACTGGTTTAGGCTTTCCAGTTTGGAAAAGGAGCAGAGAGCTGTCCATCTGGATTGATGGAAGA
AAAGAGAACCTCATCCATGCCTGGAGAACATCTAGAAAACCTTCAGCCAGCCTCCAGTGCTGTCGAGAGACCACCTTCCCCCGACCCGGA
GGCACTTCCTTGGGGTCTTTCTCTAGGGTCTCTTCTCTACAAAGCACAACACTAATGTTCGTTTCCTTAGACCTCAGTTCAAGTGCCCCT
ATTTATTTCAATAAGAACGCACATATCCCAGCTGTTTTTTGTTTGTCACCTCTATTTAGTTGTTACCTGTTTCTCTCTTCTTTCACCCCT
TGTCCTTTTCCACCCTTTTAAGAGTTACGCTAGCAGATCTTACTCCACGTATACTTTTTGGTTTGTGAAGGCATCGGTTAAGGGCACAAA
GACAGCCATGGGGACATTTATGTAAATACGTCTCTAATTGCCACACTGCAGCTGAACAGTGTGTAGTATTTTCCCAGTCAGCTTTGCCAT
ACTGACGTCAATCATTTGAGAGAAATTATTCAGATTTTATTTTTGTATCTGTGGTAACAAAACATTAACCAAAAGATTTTCTGTCCAGAA
GCCTCCCCGACCCCCCAAGCTATTTGCTCACATTAACAAATTAAAGTGCCTGAAGCATAATTCATTCTTTACCTGTATACTAAAAACCCT
GTTGTATTGATTTTTTTATAATAAGCCTTTTTACCTCTGTGTAAAAAATATATATACAAGTGTATGATGTACATTTTAGTTCTTAACTTT

>In-frame_RAB1A_ENST00000409751_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_1539nt
TTTGGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACAGC
CTATCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCAGC
TGCAGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAA
TCTCCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATC
AGCCGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGA
CGGGGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCA
AGGGCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCA
GCGTGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGT
TCAACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCG
CGGACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCC
TCCGGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGA
TGTGCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTCGT
CTCTTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGAGG
CACCATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTCGC
ACAGTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGATTT
CCTGTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTCCA
AGAGCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATGAA

>In-frame_RAB1A_ENST00000356214_chr2_65357027_-_SPRED2_ENST00000356388_chr2_65544017_-_3681nt
TTTGGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACAGC
CTATCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCAGC
TGCAGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAA
TCTCCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATC
AGCCGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGA
CGGGGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCA
AGGGCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCA
GCGTGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGT
TCAACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCG
CGGACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCC
TCCGGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGA
TGTGCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTCGT
CTCTTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGAGG
CACCATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTCGC
ACAGTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGATTT
CCTGTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTCCA
AGAGCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATGAA
ACCCGACAGAAGTATCTCAGCCTGCAGTCAGTTATTATGTATAGGAGGTGAGCTAGTTAACAAACTTGTACCACAAAACAATATCGCTTT
AACTTTTCTAAAGCCAAATTTCCCATGTAAGCTGCAGTTTCTATCTTTAGCCCATCATCATTTTCTGCCCCCCCAAAATCTGTTGAAATG
ATTCACTGATGCAAAACATTCACCCGTAATAGACTGAGAATTGAGCCTTAACTTCAGATTAACTTGTGAGAATCAGGAAAATTCCTTCAA
CTGCATTGCATCCTCTTGGACCAGGGCTAGAATGGGGATTTCAGGTTTCTATGAGCCTCCCCATTACCCCTAAAGTAGAACATTTTTTAA
ATTGTGTTGCCACCACTTCTAAAAATTTAGCAATATTAGAATAGGATACTAGTGAAGTAAGAAATTTTGCTTGTTGTTTTGCAAACCAAA
TAGTTTCCTCAAACACAAATCAGTGTTCCCACGAACAAGTTCCAGTTGAGAAACACTAAGGTTATGGTGAATAAAACCATAGGGAGCTTC
TTCCCCCCAACCCCTGGCTATTTTATATTAATGGGGAGAGGGGATTTTTAAATGTCATAAATTTGAAGAGTGGTGGGTTGCATTTTCTTC
ATGGGTTTATGTTTTCGTTTCATTTTGGACTCAATTTCACATCACCAAATTCCTCATTTATACTTGGGGAAAAAACAAGGCCATATGTAA
AAACCCTTCCAATGCCTAAGTGTCTTTCTCCTGCAACTCCAAACCCAGACTCGCCACTTTGGGTGCACAGGTGGTTAGGTCAGCCAACTG
GTTCTGCCTGTCGCCTTGCCACGGAGGAGGCTTCTAATTAGCTGGAAAAGAGTATTTTTCTAATACGTTGCAAGGATTAGCCAAATCTTC
TTATTGAAGAAAGAAGAAAAGTGAAGAGTGGTTACCTATACCTAGCATAGTACAATCAGAACCTCGTGGAGACCACCGGGGACAGGCTTG
CGGACGCCGGCTGTTCTTCCCGCCACGATCTTTCTGTGGTAGCGGCCAGCAGAAGACATGGCCTGCTCCCCACTCCCTTTCCCCACTCCT
TCTTTATTGCACACAGGACACCAGTCTTCAAGGAAAGGGACTTTTTTCCAGTCTGCCAATCATATTGGGAAAGTGCTAGCTGTGCTCACC
TTCATGGGGCTGTTTCCAGCTCGTCCACAAGCTCATCGATTTTCTTTAGTAGATTACCGGTGTAAATACCCAGTGTGCTTATGAGTCAGT
TAGTAGACGTCTTCATTCATTGGAGTAACTGGTTTAGGCTTTCCAGTTTGGAAAAGGAGCAGAGAGCTGTCCATCTGGATTGATGGAAGA
AAAGAGAACCTCATCCATGCCTGGAGAACATCTAGAAAACCTTCAGCCAGCCTCCAGTGCTGTCGAGAGACCACCTTCCCCCGACCCGGA
GGCACTTCCTTGGGGTCTTTCTCTAGGGTCTCTTCTCTACAAAGCACAACACTAATGTTCGTTTCCTTAGACCTCAGTTCAAGTGCCCCT
ATTTATTTCAATAAGAACGCACATATCCCAGCTGTTTTTTGTTTGTCACCTCTATTTAGTTGTTACCTGTTTCTCTCTTCTTTCACCCCT
TGTCCTTTTCCACCCTTTTAAGAGTTACGCTAGCAGATCTTACTCCACGTATACTTTTTGGTTTGTGAAGGCATCGGTTAAGGGCACAAA
GACAGCCATGGGGACATTTATGTAAATACGTCTCTAATTGCCACACTGCAGCTGAACAGTGTGTAGTATTTTCCCAGTCAGCTTTGCCAT
ACTGACGTCAATCATTTGAGAGAAATTATTCAGATTTTATTTTTGTATCTGTGGTAACAAAACATTAACCAAAAGATTTTCTGTCCAGAA
GCCTCCCCGACCCCCCAAGCTATTTGCTCACATTAACAAATTAAAGTGCCTGAAGCATAATTCATTCTTTACCTGTATACTAAAAACCCT
GTTGTATTGATTTTTTTATAATAAGCCTTTTTACCTCTGTGTAAAAAATATATATACAAGTGTATGATGTACATTTTAGTTCTTAACTTT

>In-frame_RAB1A_ENST00000356214_chr2_65357027_-_SPRED2_ENST00000443619_chr2_65544017_-_1539nt
TTTGGGTGGAAGCGATAGCTGAGTGGCGGCGGCTGCTGATTGTGTTCTAGGGGACGGAGTAGGGGAAGACGTTTGCTCTCCCGGAACAGC
CTATCTCATTCCTTTCTTTCGATTACCCGTGGCGCGGAGAGTCAGGGCGGCGGCTGCGGCAGCAAGGGCGGCGGTGGCGGCGGCGGCAGC
TGCAGTGACATGTCCAGCATGAATCCCGAATAACAGCTACAGACAGTTCTTCTAATTCCTCTCAGAAGAGAGAGCAACCTACTCGGACAA
TCTCCTCTCCCACATCCTGTGAGCACCGGAGGATTTATACCCTGGGCCACCTCCACGACTCATACCCCACAGACCACTATCACCTCGATC
AGCCGATGCCAAGGCCCTACCGCCAGGTGAGCTTCCCGGACGACGACGAGGAGATCGTGCGCATCAACCCCCGGGAGAAGATCTGGATGA
CGGGGTACGAGGATTACCGGCACGCACCCGTCAGGGGCAAGTACCCGGACCCCTCGGAGGACGCGGACTCCTCCTACGTGCGCTTCGCCA
AGGGCGAGGTCCCCAAGCATGACTACAACTACCCCTACGTGGACTCCTCAGACTTTGGCCTAGGCGAGGACCCCAAAGGCCGCGGGGGCA
GCGTGATCAAGACGCAGCCCTCCCGGGGCAAGTCGCGGCGGCGGAAGGAGGACGGAGAGCGCTCGCGGTGCGTGTACTGCAGGGACATGT
TCAACCACGAGGAGAACCGCCGGGGCCACTGCCAGGACGCGCCCGACTCCGTGAGAACTTGCATCCGCCGGGTGAGCTGCATGTGGTGCG
CGGACAGCATGCTCTATCACTGTATGTCGGACCCCGAGGGAGACTATACAGACCCTTGCTCGTGCGATACTAGCGACGAGAAGTTTTGCC
TCCGGTGGATGGCTCTTATTGCCTTGTCTTTCCTGGCCCCCTGTATGTGCTGTTACCTGCCCCTTCGGGCCTGCTACCACTGCGGAGTGA
TGTGCAGGTGCTGTGGCGGGAAGCACAAAGCGGCCGCGTGACTCAGTTTCCCTCCCTTCTCCCTCCATCCGCAGCCACAGGGGAACTCGT
CTCTTACATACTCTCATCTTCTCCCCCGCTCCCTTCCACTCCAAGGAGCGAGGAGGGCAAGCGGCCTCCCAGCTCCCTGGTACCTCGAGG
CACCATTCCAGCCAGGGACGCTGCCGGGTAGACTCTCCACTCCCCCTGCCGCCCACACTGCAGCAGCCACATCCATACACACACGCTCGC
ACAGTGTTCTGAGGAAGGAACCTTCGCCACAGACTCCTGTACTATTAACAATCTGTAACCAAGCTAACTGTCTCATCCATGTGTTGATTT
CCTGTTTCCTCCTCCCCCGCCTCTTCCAGTTCAAAGGAGTCTGCAATTGGAACTGCTGATTTTCGGTGGGTTTTGTAGTTGATTTTTCCA
AGAGCGTCGAAGACTCTCTTTCTCTTGGTTCACCTTGCCTGTCGCTAGCAAGCATCTGGTTCAGCGGAAATGGGATGTGAGAATGATGAA


Top

FusionGenePPI for RAB1A_SPRED2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RAB1ARABAC1, GOLGA2, MICAL1, RABIF, GOLGA5, CAPNS1, CREB1, FSCN1, HIVEP1, SLC16A8, TBC1D17, CDKN1A, RFK, CHML, USO1, CHM, RABEP1, ELAVL1, ARRB1, RAB11B, RAB7A, GDI1, GDI2, RAB11A, RAB31, HNRNPA1L2, RAP1A, PTBP1, HNRNPA3, IQCB1, UBL4A, BAG3, ATP4A, ATP6V1A, MTPN, PCYT2, PDIA3, ENO2, GMPS, MTAP, PNP, TUBB4B, RPA1, RPA2, RPA3, ASB5, ASB9, SART3, RUSC2, CUL7, CCDC8, OCRL, ULK1, RAB1B, UNK, ATP1A1, ATP1A2, ATP1A3, ATP1B1, ATP5H, BCAP31, CCDC47, CYC1, DNAJA3, ETFA, HNRNPA1, HSD17B12, IPO9, KDSR, LDHA, LDHAL6B, LDHB, LDHC, LRPPRC, NDUFB8, NDUFB9, PHB, PHPT1, AHSA1, ARF1, ATP1B3, CANX, CDC42, CLGN, DUT, FUBP1, ILVBL, MTCH2, NDUFS8, PLIN3, PRRC1, RAB5A, RAB5B, RAB5C, RANBP1, RAP2C, SLC25A3, SSRP1, STMN1, TECR, TM9SF4, TOMM70A, TXN, RAB2A, RAB6A, RAB6B, RDH13, RER1, RPN1, RPN2, STOML2, STX12, STX7, TMCO1, TMED2, UBE2K, UQCRC2, UQCRQ, VAPA, VDAC2, TCTN2, TCTN3, CAPZA2, DBN1, ATL3, LIMA1, GTSE1, MTOR, RPTOR, CSNK1D, TRAPPC2L, VPS51, TMED10, TSSC1, PTAR1, SEC23IP, COG5, RAB18, VPS52, TRAPPC12, JTB, COG8, RIC1, COG3, COG7, VPS53, TRAPPC13, VPS54, CDC73, CDH1, EGFR, RAB8A, VPS13C, EEF1A2, RABGGTA, RAB2B, DLD, DLST, PARK7, PDHA1, G3BP1, HEY1SPRED2TESK1, ELAVL1, NBR1, SQSTM1, TOP3B, SPG21, ZDHHC17, PDP1, DPP9, PRTFDC1, RPS6KA3, GNG5, RPS6KA2, STOM, GNAQ


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RAB1A_SPRED2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RAB1A_SPRED2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSPRED2C0003873Rheumatoid Arthritis2CTD_human