FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29586

FusionGeneSummary for PTPRR_SNRPF

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPRR_SNRPF
Fusion gene ID: 29586
HgeneTgene
Gene symbol

PTPRR

SNRPF

Gene ID

5801

6636

Gene nameprotein tyrosine phosphatase, receptor type Rsmall nuclear ribonucleoprotein polypeptide F
SynonymsEC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQSMF|Sm-F|snRNP-F
Cytomap

12q15

12q23.1

Type of geneprotein-codingprotein-coding
Descriptionreceptor-type tyrosine-protein phosphatase RCh-1 PTPaseNC-PTPCOM1R-PTP-Rch-1PTPaseprotein tyrosine phosphatase Cr1PTPaseprotein-tyrosine phosphatase NC-PTPCOM1protein-tyrosine phosphatase PCPTP1small nuclear ribonucleoprotein Fsm protein F
Modification date2018051920180523
UniProtAcc

Q15256

P62306

Ensembl transtripts involved in fusion geneENST00000283228, ENST00000440835, 
ENST00000537619, ENST00000378778, 
ENST00000342084, ENST00000549308, 
ENST00000266735, ENST00000553192, 
ENST00000552085, 
Fusion gene scores* DoF score12 X 9 X 4=4323 X 2 X 2=12
# samples 122
** MAII scorelog2(12/432*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/12*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PTPRR [Title/Abstract] AND SNRPF [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSNRPF

GO:0000387

spliceosomal snRNP assembly

18984161


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A3U5-01APTPRRchr12

71314113

-SNRPFchr12

96254946

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000283228ENST00000266735PTPRRchr12

71314113

-SNRPFchr12

96254946

+
In-frameENST00000283228ENST00000553192PTPRRchr12

71314113

-SNRPFchr12

96254946

+
In-frameENST00000283228ENST00000552085PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000440835ENST00000266735PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000440835ENST00000553192PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000440835ENST00000552085PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000537619ENST00000266735PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000537619ENST00000553192PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000537619ENST00000552085PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000378778ENST00000266735PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000378778ENST00000553192PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000378778ENST00000552085PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000342084ENST00000266735PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000342084ENST00000553192PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000342084ENST00000552085PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000549308ENST00000266735PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000549308ENST00000553192PTPRRchr12

71314113

-SNRPFchr12

96254946

+
intron-3CDSENST00000549308ENST00000552085PTPRRchr12

71314113

-SNRPFchr12

96254946

+

Top

FusionProtFeatures for PTPRR_SNRPF


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPRR

Q15256

SNRPF

P62306

Sequesters mitogen-activated protein kinases (MAPKs)such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactiveform. The MAPKs bind to a dephosphorylated kinase interactingmotif, phosphorylation of which by the protein kinase A complexreleases the MAPKs for activation and translocation into thenucleus (By similarity). {ECO:0000250}. Core component of the spliceosomal U1, U2, U4 and U5small nuclear ribonucleoproteins (snRNPs), the building blocks ofthe spliceosome. Thereby, plays an important role in the splicingof cellular pre-mRNAs. Most spliceosomal snRNPs contain a commonset of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF andSNRPG that assemble in a heptameric protein ring on the Sm site ofthe small nuclear RNA to form the core snRNP. As part of the U7snRNP it is involved in histone 3'-end processing.{ECO:0000269|PubMed:18984161, ECO:0000269|PubMed:23333303}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPRRchr12:71314113chr12:96254946ENST00000283228-114393_64719658DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71314113chr12:96254946ENST00000342084-113393_647-49546DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71314113chr12:96254946ENST00000378778-111393_6470452DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71314113chr12:96254946ENST00000440835-110393_647-156413DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71314113chr12:96254946ENST00000549308-111393_647-80413DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71314113chr12:96254946ENST00000283228-114588_59419658RegionSubstrate binding
HgenePTPRRchr12:71314113chr12:96254946ENST00000342084-113588_594-49546RegionSubstrate binding
HgenePTPRRchr12:71314113chr12:96254946ENST00000378778-111588_5940452RegionSubstrate binding
HgenePTPRRchr12:71314113chr12:96254946ENST00000440835-110588_594-156413RegionSubstrate binding
HgenePTPRRchr12:71314113chr12:96254946ENST00000549308-111588_594-80413RegionSubstrate binding
HgenePTPRRchr12:71314113chr12:96254946ENST00000283228-11422_22719658Topological domainExtracellular
HgenePTPRRchr12:71314113chr12:96254946ENST00000283228-114249_65719658Topological domainCytoplasmic
HgenePTPRRchr12:71314113chr12:96254946ENST00000342084-11322_227-49546Topological domainExtracellular
HgenePTPRRchr12:71314113chr12:96254946ENST00000342084-113249_657-49546Topological domainCytoplasmic
HgenePTPRRchr12:71314113chr12:96254946ENST00000378778-11122_2270452Topological domainExtracellular
HgenePTPRRchr12:71314113chr12:96254946ENST00000378778-111249_6570452Topological domainCytoplasmic
HgenePTPRRchr12:71314113chr12:96254946ENST00000440835-11022_227-156413Topological domainExtracellular
HgenePTPRRchr12:71314113chr12:96254946ENST00000440835-110249_657-156413Topological domainCytoplasmic
HgenePTPRRchr12:71314113chr12:96254946ENST00000549308-11122_227-80413Topological domainExtracellular
HgenePTPRRchr12:71314113chr12:96254946ENST00000549308-111249_657-80413Topological domainCytoplasmic
HgenePTPRRchr12:71314113chr12:96254946ENST00000283228-114228_24819658TransmembraneHelical
HgenePTPRRchr12:71314113chr12:96254946ENST00000342084-113228_248-49546TransmembraneHelical
HgenePTPRRchr12:71314113chr12:96254946ENST00000378778-111228_2480452TransmembraneHelical
HgenePTPRRchr12:71314113chr12:96254946ENST00000440835-110228_248-156413TransmembraneHelical
HgenePTPRRchr12:71314113chr12:96254946ENST00000549308-111228_248-80413TransmembraneHelical


Top

FusionGeneSequence for PTPRR_SNRPF


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPRR_ENST00000283228_chr12_71314113_-_SNRPF_ENST00000266735_chr12_96254946_+_105aa
MRRAVCFPALCLLLNLHAAEFTPQSQTFPQWTNRKASDGET_VGNGVQGLSGICRWLHEHAACKYRRIHRWSFVWTSG_SFNKV__CPLT

>In-frame_PTPRR_ENST00000283228_chr12_71314113_-_SNRPF_ENST00000553192_chr12_96254946_+_86aa

>In-frame_PTPRR_ENST00000283228_chr12_71314113_-_SNRPF_ENST00000552085_chr12_96254946_+_146aa
MRRAVCFPALCLLLNLHAAEFTPQSQTFPQWTNRKASDGET_VGNGVQGLSGICRWLHEHADFHLHLGNIETKWSFTLVAQAGVQWHDLG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPRR_ENST00000283228_chr12_71314113_-_SNRPF_ENST00000266735_chr12_96254946_+_316nt
ATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGAGTTTACCCCTCAATCCCAAACCTTTCCTCAA
TGGACTAACAGGAAAGCCAGTGATGGTGAAACTTAAGTGGGGAATGGAGTACAAGGGCTATCTGGTATCTGTAGATGGCTACATGAACAT
GCAGCTTGCAAATACAGAAGAATACATAGATGGAGCTTTGTCTGGACATCTGGGTGAAGTTTTAATAAGGTGTAATAATGTCCTTTATAT

>In-frame_PTPRR_ENST00000283228_chr12_71314113_-_SNRPF_ENST00000553192_chr12_96254946_+_259nt
ATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGAGTTTACCCCTCAATCCCAAACCTTTCCTCAA
TGGACTAACAGGAAAGCCAGTGATGGTGAAACTTAAGTGGGGAATGGAGTACAAGGGCTATCTGGTATCTGTAGATGGCTACATGAACAT

>In-frame_PTPRR_ENST00000283228_chr12_71314113_-_SNRPF_ENST00000552085_chr12_96254946_+_439nt
ATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGAGTTTACCCCTCAATCCCAAACCTTTCCTCAA
TGGACTAACAGGAAAGCCAGTGATGGTGAAACTTAAGTGGGGAATGGAGTACAAGGGCTATCTGGTATCTGTAGATGGCTACATGAACAT
GCAGATTTTCATCTACATCTTGGGAATATTGAAACAAAATGGAGTTTCACTCTCGTCGCCCAGGCTGGAGTGCAATGGCATGATCTCGGC
TCATTGCAACCTCTGTCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGGATTACAGCTAGGACCTCCAGAACACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPRR_ENST00000283228_chr12_71314113_-_SNRPF_ENST00000266735_chr12_96254946_+_1751nt
ACCACCCCAGCGATGGAGCCTACTCTGCTCCAAGCCGCCGCTAAGACCCGGAGAAGCGGAATTTCACTTTGAAATTCCCTTGCCTCGTGA
GGGCCGGCGCTGGGCATGCTCAGTAGCCGCGGCGCTGCTGCTGGGCTGCTGGGCTGGCGCGGAGTCCACCCTGCCGTCTCCGCCTTGGCT
TCTGGGCGTCCAGAAGGCCAGGCATTTGCCGCCTCTGAGCGCTTCTGTTCCCCTTACCCGCAACCTCCTACTGCTCTTCCTCTCTCCCTC
TCTTAGGGAGGTTGAAGCTGGTGCTGGTTTCTGTCGGCGCCACAGACTGACTGCTCTGCAAACCCCAGCCGAGGACCTGAATCCCGGAGA
CTAGAAGACCCTTGGCGGTGGCTCTTTCTAATAGCACTTTACCTGAAGTGGGGTCGTGGTGGAGTTTCTCCTCCACCTCTCAATGCAAAC
ACTATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGAGTTTACCCCTCAATCCCAAACCTTTCCT
CAATGGACTAACAGGAAAGCCAGTGATGGTGAAACTTAAGTGGGGAATGGAGTACAAGGGCTATCTGGTATCTGTAGATGGCTACATGAA
CATGCAGCTTGCAAATACAGAAGAATACATAGATGGAGCTTTGTCTGGACATCTGGGTGAAGTTTTAATAAGGTGTAATAATGTCCTTTA
TATCAGAGGTGTGGAAGAAGAGGAAGAAGATGGGGAAATGAGAGAATAGCATCTTTTGTGGGGGATTTTTTTTATATATATTTCTAGACA
ATAAAGATTTGTTTGTTTTTCAACTTGACTTGTGAACTATTTGTATTCAGATATTTACAAGCAAAGCTGAAATGATGAACCAATTGGGAA
AGATTACTCACTGAACTAATGCTTTAAAAGCCACTGAATTTCATTTAAGTTGCTTTTCTTTTGTAAGCCCAATATTCTTTTTTTTCCCAT
AAAGGATAATTATTTATATGCTTTAGATATTTTTATGAAGGTGAATTTCAGACCTTTTCTTGTAAAATTATCTATTAGCTGAGACCTTTT
AAATGCAACTTTTTCTTTTAAAGTTATTTTTGAGCTACTTTTAACGTATAAAATTAAACATTTTCTTGGTATTAATAATATACTGTCTTA
TTTTACTTAGTAGTCAATAAATTACATGTTAATTCTGTGTCAATATAAGCTAAATGCACATATTGCAGCTAAAATTGAAGCATCTTCTAA
AAATTAAAATGATTGTACAGACAGGGCACAACAGAAATTGGGAACTGACATTCAGGCTGAAGGCATACGGTTTGTTCACTGAAGAGAAAA
AAGTTCTCTGAACAAAATGTAATGTCAAATAAAAACCAGTCTCCCCATTATGTTCTGAGACATAACCTCGAGGTTGAGTTTTAAGCCCCT
CAAAACCCTTCAGGTATTTTAGGGTTGTACATTGTTAAAATGTATAGTCCATAGTAATAACAGTATGCTATGAACTTCCCTACAGATGGG
TTGAGAAAATACATCATTTACATTCTCATGTTGTAAGAGAATGGCCATTATTACACTTCAGTGTTCATTTACCATAGTTTTATCAGTAAA
CTATCTTTGTGTATCCCCAAGTGGGACAACTCAAAGTATAGAAGAAAGTGTTTAGCTATATGGAATAATACTTATGATATGAATACTTAA

>In-frame_PTPRR_ENST00000283228_chr12_71314113_-_SNRPF_ENST00000553192_chr12_96254946_+_951nt
ACCACCCCAGCGATGGAGCCTACTCTGCTCCAAGCCGCCGCTAAGACCCGGAGAAGCGGAATTTCACTTTGAAATTCCCTTGCCTCGTGA
GGGCCGGCGCTGGGCATGCTCAGTAGCCGCGGCGCTGCTGCTGGGCTGCTGGGCTGGCGCGGAGTCCACCCTGCCGTCTCCGCCTTGGCT
TCTGGGCGTCCAGAAGGCCAGGCATTTGCCGCCTCTGAGCGCTTCTGTTCCCCTTACCCGCAACCTCCTACTGCTCTTCCTCTCTCCCTC
TCTTAGGGAGGTTGAAGCTGGTGCTGGTTTCTGTCGGCGCCACAGACTGACTGCTCTGCAAACCCCAGCCGAGGACCTGAATCCCGGAGA
CTAGAAGACCCTTGGCGGTGGCTCTTTCTAATAGCACTTTACCTGAAGTGGGGTCGTGGTGGAGTTTCTCCTCCACCTCTCAATGCAAAC
ACTATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGAGTTTACCCCTCAATCCCAAACCTTTCCT
CAATGGACTAACAGGAAAGCCAGTGATGGTGAAACTTAAGTGGGGAATGGAGTACAAGGGCTATCTGGTATCTGTAGATGGCTACATGAA
CATGCAGATTTTCATCTACATCTTGGGAATATTGAAACAAAGTAAGATTCTGCTCTTCCAGCTCTCTGAGGACTTGAAGTAACTCCTCTG
GTTCCTTGAAATAAAGTGCTGGCTCCTAATTAATCAATAATGAAGAATATAATTTACTTAAAAATATGCTACCTATGCACATGTGACTTA
TCTAGAAAATACAGTGGGGTAAAGGAAGACAGTTCTAAGGATGAGGGAGACACAGGTAGGAACTTGTATGGGAAACTCGCCTATTTCCAA

>In-frame_PTPRR_ENST00000283228_chr12_71314113_-_SNRPF_ENST00000552085_chr12_96254946_+_1218nt
ACCACCCCAGCGATGGAGCCTACTCTGCTCCAAGCCGCCGCTAAGACCCGGAGAAGCGGAATTTCACTTTGAAATTCCCTTGCCTCGTGA
GGGCCGGCGCTGGGCATGCTCAGTAGCCGCGGCGCTGCTGCTGGGCTGCTGGGCTGGCGCGGAGTCCACCCTGCCGTCTCCGCCTTGGCT
TCTGGGCGTCCAGAAGGCCAGGCATTTGCCGCCTCTGAGCGCTTCTGTTCCCCTTACCCGCAACCTCCTACTGCTCTTCCTCTCTCCCTC
TCTTAGGGAGGTTGAAGCTGGTGCTGGTTTCTGTCGGCGCCACAGACTGACTGCTCTGCAAACCCCAGCCGAGGACCTGAATCCCGGAGA
CTAGAAGACCCTTGGCGGTGGCTCTTTCTAATAGCACTTTACCTGAAGTGGGGTCGTGGTGGAGTTTCTCCTCCACCTCTCAATGCAAAC
ACTATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGAGTTTACCCCTCAATCCCAAACCTTTCCT
CAATGGACTAACAGGAAAGCCAGTGATGGTGAAACTTAAGTGGGGAATGGAGTACAAGGGCTATCTGGTATCTGTAGATGGCTACATGAA
CATGCAGATTTTCATCTACATCTTGGGAATATTGAAACAAAATGGAGTTTCACTCTCGTCGCCCAGGCTGGAGTGCAATGGCATGATCTC
GGCTCATTGCAACCTCTGTCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGGATTACAGCTAGGACCTCCAGAAC
ACTGACAAAAAGAAGTGGTGCAGTGGAAATCCTTGCCTTGTTCCTAATCTTAGGGGGAAAGCATTCAGTCTTTTACCATTAGATATGTAA
TGTTAGTGATAAGTTTCTAGTAGATGTCCTTTTATAAAGTTGAGGAACTTCTCTTCTGTTCCTACTTTGCTGAGAGTCTCCATCAAGAAT
GAATTTTGGATATTGTTGAGTGGTTTTTCTGCATCAATTGGGATAATCATATGGGTTTTCATTTTTAATTTGTTAATGTGTATTACATTG
ATTTATTTTTAAATGTTAAATTACTTTTGTATTCTTAGATTAAACCCTAATTTGTCATAATGTATTATCTTTTTAGTATTATTGGATTTG


Top

FusionGenePPI for PTPRR_SNRPF


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPRRMAPK1, MAPK3, MAPK7, MAPK14, NTRK1, CEP290, EGFR, ERBB2, IGF1R, RET, MST1R, ERBB4, FGFR2, FGFR4, KDR, TEK, INSR, ALDH18A1, DHPS, PNMA2, TRIM11, KIAA0196, TBC1D5, DNAJC13, SNX6, PTPRR, MAPK1IP1L, MAPKAPK3, MAD2L1BP, CBS, MAPK11, CCT8L1P, HSPA4L, LMTK2, AATK, ERBB3, RYK, ROR1, ROR2, PTK7, EPHA2SNRPFUQCRC1, OGG1, CD2BP2, PSMA3, GEMIN5, SNRPD2, SNRPE, SF3A2, DDX20, SMN2, MEPCE, SRRM1, SRRM2, SMN1, CLNS1A, ELAVL1, CUL3, CUL2, CDK2, COPS5, CAND1, RNU4ATAC, RNU6ATAC, RBM8A, RAD23B, SEC24C, LAGE3, TBCA, S100P, IGBP1, TAGLN2, SH3BGRL, S100A4, FN1, SNRPG, SNRPA1, PUF60, SRRT, SRSF5, LSM5, LSM6, LSM7, IFIT1, IFIT2, IFIT3, IL7R, METTL18, ITGA4, NPM1, MAPRE1, SFN, FERMT2, OLA1, HDGF, MYO1E, PAFAH1B1, TBCB, UBFD1, VCL, YWHAZ, LIN28A, LIN28B, COIL, HOMER3, IKZF1, LNX1, EZH2, EED, EGFR, ABCE1, HSPB1, SNRPD1, SNRPD3, KRAS, FBXW7, CRBN, SNRPN, BPIFA2, LSM10, SNRPGP15, CMTR2, PDCD7, SNRNP48, ZMAT5, SNRNP35, GPBP1L1, ZRSR2, WBP4, RNPC3, PRPF3, SNRNP70, TGS1, LSM11, TUT1, SNRPA, GPATCH1, CST1, SNRPB2, GEMIN8, DHX35, CDC40, TOE1, PAXBP1, SNRPB, SART3, WDR83, TFIP11, DDX23, XAB2, GEMIN6, AQR, TSSC4, LSM8, GEMIN2, AKAP7, CWF19L2, SNRNP200, CST5, SNRPC, PRPF8, PIGR, PRPF6, PRPF4, GEMIN4, KLHL8, GPATCH11, HTATSF1, RBM22, TXNL4A, RSRC1, CRNKL1, PRPF31, CST4, SLC4A1AP, LSM2, SF3A3, ZG16B, LSM1, EFTUD2, SF3B1, PPIE, SNRNP40, SF3A1, ISY1, ZCRB1, SF3B4, SMR3B, SNW1, IGHA1, CYLD, G3BP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPRR_SNRPF


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTPRR_SNRPF


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTPRRC0041696Unipolar Depression1PSYGENET
HgenePTPRRC1269683Major Depressive Disorder1PSYGENET