FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29583

FusionGeneSummary for PTPRR_KCNC2

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPRR_KCNC2
Fusion gene ID: 29583
HgeneTgene
Gene symbol

PTPRR

KCNC2

Gene ID

5801

3747

Gene nameprotein tyrosine phosphatase, receptor type Rpotassium voltage-gated channel subfamily C member 2
SynonymsEC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQKV3.2
Cytomap

12q15

12q21.1

Type of geneprotein-codingprotein-coding
Descriptionreceptor-type tyrosine-protein phosphatase RCh-1 PTPaseNC-PTPCOM1R-PTP-Rch-1PTPaseprotein tyrosine phosphatase Cr1PTPaseprotein-tyrosine phosphatase NC-PTPCOM1protein-tyrosine phosphatase PCPTP1potassium voltage-gated channel subfamily C member 2potassium channel, voltage gated Shaw related subfamily C, member 2potassium voltage-gated channel, Shaw-related subfamily, member 2shaw-like potassium channelvoltage-gated potassium channel Kv3.2
Modification date2018051920180523
UniProtAcc

Q15256

Q96PR1

Ensembl transtripts involved in fusion geneENST00000283228, ENST00000440835, 
ENST00000537619, ENST00000378778, 
ENST00000342084, ENST00000549308, 
ENST00000550433, ENST00000548513, 
ENST00000549446, ENST00000298972, 
ENST00000341669, ENST00000350228, 
ENST00000540018, ENST00000393288, 
ENST00000548243, 
Fusion gene scores* DoF score12 X 9 X 4=43213 X 4 X 5=260
# samples 1212
** MAII scorelog2(12/432*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/260*10)=-1.11547721741994
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PTPRR [Title/Abstract] AND KCNC2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-AB35-01APTPRRchr12

71092045

-KCNC2chr12

75445097

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000283228ENST00000550433PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000283228ENST00000548513PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000283228ENST00000549446PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000283228ENST00000298972PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000283228ENST00000341669PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000283228ENST00000350228PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000283228ENST00000540018PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000283228ENST00000393288PTPRRchr12

71092045

-KCNC2chr12

75445097

-
5CDS-intronENST00000283228ENST00000548243PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000440835ENST00000550433PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000440835ENST00000548513PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000440835ENST00000549446PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000440835ENST00000298972PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000440835ENST00000341669PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000440835ENST00000350228PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000440835ENST00000540018PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000440835ENST00000393288PTPRRchr12

71092045

-KCNC2chr12

75445097

-
5CDS-intronENST00000440835ENST00000548243PTPRRchr12

71092045

-KCNC2chr12

75445097

-
intron-3CDSENST00000537619ENST00000550433PTPRRchr12

71092045

-KCNC2chr12

75445097

-
intron-3CDSENST00000537619ENST00000548513PTPRRchr12

71092045

-KCNC2chr12

75445097

-
intron-3CDSENST00000537619ENST00000549446PTPRRchr12

71092045

-KCNC2chr12

75445097

-
intron-3CDSENST00000537619ENST00000298972PTPRRchr12

71092045

-KCNC2chr12

75445097

-
intron-3CDSENST00000537619ENST00000341669PTPRRchr12

71092045

-KCNC2chr12

75445097

-
intron-3CDSENST00000537619ENST00000350228PTPRRchr12

71092045

-KCNC2chr12

75445097

-
intron-3CDSENST00000537619ENST00000540018PTPRRchr12

71092045

-KCNC2chr12

75445097

-
intron-3CDSENST00000537619ENST00000393288PTPRRchr12

71092045

-KCNC2chr12

75445097

-
intron-intronENST00000537619ENST00000548243PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000378778ENST00000550433PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000378778ENST00000548513PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000378778ENST00000549446PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000378778ENST00000298972PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000378778ENST00000341669PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000378778ENST00000350228PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000378778ENST00000540018PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000378778ENST00000393288PTPRRchr12

71092045

-KCNC2chr12

75445097

-
5CDS-intronENST00000378778ENST00000548243PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000342084ENST00000550433PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000342084ENST00000548513PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000342084ENST00000549446PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000342084ENST00000298972PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000342084ENST00000341669PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000342084ENST00000350228PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000342084ENST00000540018PTPRRchr12

71092045

-KCNC2chr12

75445097

-
Frame-shitENST00000342084ENST00000393288PTPRRchr12

71092045

-KCNC2chr12

75445097

-
5CDS-intronENST00000342084ENST00000548243PTPRRchr12

71092045

-KCNC2chr12

75445097

-
In-frameENST00000549308ENST00000550433PTPRRchr12

71092045

-KCNC2chr12

75445097

-
In-frameENST00000549308ENST00000548513PTPRRchr12

71092045

-KCNC2chr12

75445097

-
In-frameENST00000549308ENST00000549446PTPRRchr12

71092045

-KCNC2chr12

75445097

-
In-frameENST00000549308ENST00000298972PTPRRchr12

71092045

-KCNC2chr12

75445097

-
In-frameENST00000549308ENST00000341669PTPRRchr12

71092045

-KCNC2chr12

75445097

-
In-frameENST00000549308ENST00000350228PTPRRchr12

71092045

-KCNC2chr12

75445097

-
In-frameENST00000549308ENST00000540018PTPRRchr12

71092045

-KCNC2chr12

75445097

-
In-frameENST00000549308ENST00000393288PTPRRchr12

71092045

-KCNC2chr12

75445097

-
5CDS-intronENST00000549308ENST00000548243PTPRRchr12

71092045

-KCNC2chr12

75445097

-

Top

FusionProtFeatures for PTPRR_KCNC2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPRR

Q15256

KCNC2

Q96PR1

Sequesters mitogen-activated protein kinases (MAPKs)such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactiveform. The MAPKs bind to a dephosphorylated kinase interactingmotif, phosphorylation of which by the protein kinase A complexreleases the MAPKs for activation and translocation into thenucleus (By similarity). {ECO:0000250}. Voltage-gated potassium channel that mediatestransmembrane potassium transport in excitable membranes,primarily in the brain. Contributes to the regulation of the fastaction potential repolarization and in sustained high-frequencyfiring in neurons of the central nervous system. Homotetramerchannels mediate delayed-rectifier voltage-dependent potassiumcurrents that activate rapidly at high-threshold voltages andinactivate slowly. Forms tetrameric channels through whichpotassium ions pass in accordance with their electrochemicalgradient. The channel alternates between opened and closedconformations in response to the voltage difference across themembrane (PubMed:15709110). Can form functional homotetrameric andheterotetrameric channels that contain variable proportions ofKCNC1, and possibly other family members as well; channelproperties depend on the type of alpha subunits that are part ofthe channel. Channel properties may be modulated either by theassociation with ancillary subunits, such as KCNE1, KCNE2 or KCNE3or indirectly by nitric oxide (NO) through a cGMP- and PKG-mediated signaling cascade, slowing channel activation anddeactivation of delayed rectifier potassium channels (Bysimilarity). Contributes to fire sustained trains of very briefaction potentials at high frequency in retinal ganglion cells,thalamocortical and suprachiasmatic nucleus (SCN) neurons and inhippocampal and neocortical interneurons (PubMed:15709110).Sustained maximal action potential firing frequency in inhibitoryhippocampal interneurons is negatively modulated by histamine H2receptor activation in a cAMP- and protein kinase (PKA)phosphorylation-dependent manner. Plays a role in maintaining thefidelity of synaptic transmission in neocortical GABAergicinterneurons by generating action potential (AP) repolarization atnerve terminals, thus reducing spike-evoked calcium influx andGABA neurotransmitter release. Required for long-rangesynchronization of gamma oscillations over distance in theneocortex. Contributes to the modulation of the circadian rhythmof spontaneous action potential firing in suprachiasmatic nucleus(SCN) neurons in a light-dependent manner (By similarity).{ECO:0000250|UniProtKB:P22462, ECO:0000250|UniProtKB:Q14B80,ECO:0000269|PubMed:15709110, ECO:0000305|PubMed:10414303,ECO:0000305|PubMed:11506885}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PTPRR_KCNC2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000550433_chr12_75445097_-_582aa
MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQE
RRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTIL
PITCFCFFILHPGFNYNFLPGNT_SFQTC_KQDRTSHQWHKCCSTV_N_NGSCLDVCRRSVCGVVYF_IFSPTCFFTQ_T_IHQKSLETH
_LCGHPTFLLRGGTQWAVIQSC_RCAWLPQGGKVCEDPENFQAHPPFCRSEGAWTYSSS_Y__IFAADNFPGSRSFDICYHDLLCRESGS
ST_RPFS__AHTVQKHSHWVLVGCSDHDYPGLWGTVPPNMVRHAGGSPVCSGWSADNSHASACHCQ_FWNVLLLGNGKAETSKEKKEAHP
SCSSGKLTYFLQDRIKTGLQ_YTE_HMSGQRQSTSGT_QISVIR_RQYRK_AATITPRKAPHQTL_YQRQKQKRGNMFPTDDR_LHVCF_

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000548513_chr12_75445097_-_181aa
MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQE
RRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTIL

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000549446_chr12_75445097_-_591aa
MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQE
RRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTIL
PITCFCFFILHPGFNYNFLPGNT_SFQTC_KQDRTSHQWHKCCSTV_N_NGSCLDVCRRSVCGVVYF_IFSPTCFFTQ_T_IHQKSLETH
_LCGHPTFLLRGGTQWAVIQSC_RCAWLPQGGKVCEDPENFQAHPPFCRSEGAWTYSSS_Y__IFAADNFPGSRSFDICYHDLLCRESGS
ST_RPFS__AHTVQKHSHWVLVGCSDHDYPGLWGTVPPNMVRHAGGSPVCSGWSADNSHASACHCQ_FWNVLLLGNGKAETSKEKKEAHP
SCSSGKLTYFLQDRIKTGLQ_YTE_HMSGQRQSTSGT_QISVIR_RQYRK_AATITPRKAPHQTL_YQRQKQKRGNMFPTDDR_LHVCF_

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000298972_chr12_75445097_-_566aa
MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQE
RRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTIL
PITCFCFFILHPGFNYNFLPGNT_SFQTC_KQDRTSHQWHKCCSTV_N_NGSCLDVCRRSVCGVVYF_IFSPTCFFTQ_T_IHQKSLETH
_LCGHPTFLLRGGTQWAVIQSC_RCAWLPQGGKVCEDPENFQAHPPFCRSEGAWTYSSS_Y__IFAADNFPGSRSFDICYHDLLCRESGS
ST_RPFS__AHTVQKHSHWVLVGCSDHDYPGLWGTVPPNMVRHAGGSPVCSGWSADNSHASACHCQ_FWNVLLLGNGKAETSKEKKEAHP
SCSSGKLTYFLQDRIKTGLQ_YTE_HMSGQRQSTSGT_QISVIR_RQYRK_AATITPRKAPHQTL_YQRQKQKRGNMFPTDDR_LHVCF_

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000341669_chr12_75445097_-_582aa
MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQE
RRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTIL
PITCFCFFILHPGFNYNFLPGNT_SFQTC_KQDRTSHQWHKCCSTV_N_NGSCLDVCRRSVCGVVYF_IFSPTCFFTQ_T_IHQKSLETH
_LCGHPTFLLRGGTQWAVIQSC_RCAWLPQGGKVCEDPENFQAHPPFCRSEGAWTYSSS_Y__IFAADNFPGSRSFDICYHDLLCRESGS
ST_RPFS__AHTVQKHSHWVLVGCSDHDYPGLWGTVPPNMVRHAGGSPVCSGWSADNSHASACHCQ_FWNVLLLGNGKAETSKEKKEAHP
SCSSGKLTYFLQDRIKTGLQ_YTE_HMSGQRQSTSGT_QISVIR_RQYRK_AATITPRKAPHQTL_YQRQKQKRGNMFPTDDR_LHVCF_

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000350228_chr12_75445097_-_511aa
MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQE
RRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTIL
PITCFCFFILHPGFNYNFLPGNT_SFQTC_KQDRTSHQWHKCCSTV_N_NGSCLDVCRRSVCGVVYF_IFSPTCFFTQ_T_IHQKSLETH
_LCGHPTFLLRGGTQWAVIQSC_RCAWLPQGGKVCEDPENFQAHPPFCRSEGAWTYSSS_Y__IFAADNFPGSRSFDICYHDLLCRESGS
ST_RPFS__AHTVQKHSHWVLVGCSDHDYPGLWGTVPPNMVRHAGGSPVCSGWSADNSHASACHCQ_FWNVLLLGNGKAETSKEKKEAHP

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000540018_chr12_75445097_-_536aa
MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQE
RRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTIL
PITCFCFFILHPGFNYNFLPGNT_SFQTC_KQDRTSHQWHKCCSTV_N_NGSCLDVCRRSVCGVVYF_IFSPTCFFTQ_T_IHQKSLETH
_LCGHPTFLLRGGTQWAVIQSC_RCAWLPQGGKVCEDPENFQAHPPFCRSEGAWTYSSS_Y__IFAADNFPGSRSFDICYHDLLCRESGS
ST_RPFS__AHTVQKHSHWVLVGCSDHDYPGLWGTVPPNMVRHAGGSPVCSGWSADNSHASACHCQ_FWNVLLLGNGKAETSKEKKEAHP

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000393288_chr12_75445097_-_571aa
MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQE
RRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTIL
PITCFCFFILHPGFNYNFLPGNT_SFQTC_KQDRTSHQWHKCCSTV_N_NGSCLDVCRRSVCGVVYF_IFSPTCFFTQ_T_IHQKSLETH
_LCGHPTFLLRGGTQWAVIQSC_RCAWLPQGGKVCEDPENFQAHPPFCRSEGAWTYSSS_Y__IFAADNFPGSRSFDICYHDLLCRESGS
ST_RPFS__AHTVQKHSHWVLVGCSDHDYPGLWGTVPPNMVRHAGGSPVCSGWSADNSHASACHCQ_FWNVLLLGNGKAETSKEKKEAHP
SCSSGKLTYFLQDRIKTGLQ_YTE_HMSGQRQSTSGT_QISVIR_RQYRK_AATITPRKAPHQTL_YQRQKQKRGNMFPTDDR_LHVCF_


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000550433_chr12_75445097_-_1747nt
ATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACA
TTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCT
CAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAG
AGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAG
GTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGT
GAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTA
CCAATTTATTGCTTTTGCTTCTTTATTCTTCATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAA
AAACAAGACAGAACCAGTCATCAATGGCACAAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGT
GTGTGTGGTGTGGTTTACTTTTGAATTTTTAGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCAT
TGACTTTGTGGCCATCCTACCTTTCTACTTAGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAG
GGTGGTAAGGTTTGTGAGGATCCTGAGAATTTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAG
TACTAATGAATTTTTGCTGCTGATAATTTTCCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGC
TCAACCTAACGACCCTTCAGCTAGTGAGCACACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCT
GGGTTATGGGGATATGTACCCCCAAACATGGTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCC
AGTGCCTGTCATTGTCAATAATTTTGGAATGTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCC
TCCTGCTCCTCAGGCAAGCTCACCTACTTTTTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAA
AGACAATCGACTTCTGGAACATAACAGATCAGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCT
CCCCATCAGACGCTCTAGTACCAGAGACAAAAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGA
TGGAGGGATCAGGAAAGTGTTGTACAGAATTTATCATGGATTATTGACTGCTGAGAAAGGGACAGTGGAATTTAGCCATACCAAGGACTA

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000548513_chr12_75445097_-_544nt
ATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACA
TTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCT
CAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAG
AGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAG
GTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGT
GAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTA

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000549446_chr12_75445097_-_1774nt
ATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACA
TTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCT
CAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAG
AGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAG
GTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGT
GAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTA
CCAATTTATTGCTTTTGCTTCTTTATTCTTCATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAA
AAACAAGACAGAACCAGTCATCAATGGCACAAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGT
GTGTGTGGTGTGGTTTACTTTTGAATTTTTAGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCAT
TGACTTTGTGGCCATCCTACCTTTCTACTTAGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAG
GGTGGTAAGGTTTGTGAGGATCCTGAGAATTTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAG
TACTAATGAATTTTTGCTGCTGATAATTTTCCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGC
TCAACCTAACGACCCTTCAGCTAGTGAGCACACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCT
GGGTTATGGGGATATGTACCCCCAAACATGGTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCC
AGTGCCTGTCATTGTCAATAATTTTGGAATGTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCC
TCCTGCTCCTCAGGCAAGCTCACCTACTTTTTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAA
AGACAATCGACTTCTGGAACATAACAGATCAGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCT
CCCCATCAGACGCTCTAGTACCAGAGACAAAAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGA
TGGAGGGATCAGGAAAGGATATGAAAAATCCCGAAGCTTAAACAACATAGCGGGCTTGGCAGGCAATGCTCTGAGGCTCTCTCCAGTAAC

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000298972_chr12_75445097_-_1699nt
ATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACA
TTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCT
CAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAG
AGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAG
GTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGT
GAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTA
CCAATTTATTGCTTTTGCTTCTTTATTCTTCATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAA
AAACAAGACAGAACCAGTCATCAATGGCACAAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGT
GTGTGTGGTGTGGTTTACTTTTGAATTTTTAGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCAT
TGACTTTGTGGCCATCCTACCTTTCTACTTAGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAG
GGTGGTAAGGTTTGTGAGGATCCTGAGAATTTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAG
TACTAATGAATTTTTGCTGCTGATAATTTTCCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGC
TCAACCTAACGACCCTTCAGCTAGTGAGCACACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCT
GGGTTATGGGGATATGTACCCCCAAACATGGTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCC
AGTGCCTGTCATTGTCAATAATTTTGGAATGTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCC
TCCTGCTCCTCAGGCAAGCTCACCTACTTTTTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAA
AGACAATCGACTTCTGGAACATAACAGATCAGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCT
CCCCATCAGACGCTCTAGTACCAGAGACAAAAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGA

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000341669_chr12_75445097_-_1747nt
ATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACA
TTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCT
CAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAG
AGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAG
GTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGT
GAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTA
CCAATTTATTGCTTTTGCTTCTTTATTCTTCATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAA
AAACAAGACAGAACCAGTCATCAATGGCACAAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGT
GTGTGTGGTGTGGTTTACTTTTGAATTTTTAGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCAT
TGACTTTGTGGCCATCCTACCTTTCTACTTAGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAG
GGTGGTAAGGTTTGTGAGGATCCTGAGAATTTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAG
TACTAATGAATTTTTGCTGCTGATAATTTTCCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGC
TCAACCTAACGACCCTTCAGCTAGTGAGCACACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCT
GGGTTATGGGGATATGTACCCCCAAACATGGTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCC
AGTGCCTGTCATTGTCAATAATTTTGGAATGTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCC
TCCTGCTCCTCAGGCAAGCTCACCTACTTTTTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAA
AGACAATCGACTTCTGGAACATAACAGATCAGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCT
CCCCATCAGACGCTCTAGTACCAGAGACAAAAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGA
TGGAGGGATCAGGAAAGTGTTGTACAGAATTTATCATGGATTATTGACTGCTGAGAAAGGGACAGTGGAATTTAGCCATACCAAGGACTA

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000350228_chr12_75445097_-_1534nt
ATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACA
TTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCT
CAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAG
AGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAG
GTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGT
GAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTA
CCAATTTATTGCTTTTGCTTCTTTATTCTTCATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAA
AAACAAGACAGAACCAGTCATCAATGGCACAAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGT
GTGTGTGGTGTGGTTTACTTTTGAATTTTTAGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCAT
TGACTTTGTGGCCATCCTACCTTTCTACTTAGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAG
GGTGGTAAGGTTTGTGAGGATCCTGAGAATTTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAG
TACTAATGAATTTTTGCTGCTGATAATTTTCCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGC
TCAACCTAACGACCCTTCAGCTAGTGAGCACACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCT
GGGTTATGGGGATATGTACCCCCAAACATGGTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCC
AGTGCCTGTCATTGTCAATAATTTTGGAATGTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCC
TCCTGCTCCTCAGGCAAGCTCACCTACTTTTTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAA
AGACAATCGACTTCTGGAACATAACAGATCAGATAACTGCAAAGAGGTTGTCATTACTGGTTACACGCAAGCCGAGGCCAGATCTCTTAC

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000540018_chr12_75445097_-_1609nt
ATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACA
TTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCT
CAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAG
AGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAG
GTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGT
GAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTA
CCAATTTATTGCTTTTGCTTCTTTATTCTTCATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAA
AAACAAGACAGAACCAGTCATCAATGGCACAAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGT
GTGTGTGGTGTGGTTTACTTTTGAATTTTTAGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCAT
TGACTTTGTGGCCATCCTACCTTTCTACTTAGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAG
GGTGGTAAGGTTTGTGAGGATCCTGAGAATTTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAG
TACTAATGAATTTTTGCTGCTGATAATTTTCCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGC
TCAACCTAACGACCCTTCAGCTAGTGAGCACACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCT
GGGTTATGGGGATATGTACCCCCAAACATGGTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCC
AGTGCCTGTCATTGTCAATAATTTTGGAATGTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCC
TCCTGCTCCTCAGGCAAGCTCACCTACTTTTTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAA
AGACAATCGACTTCTGGAACATAACAGATCAGGATATGAAAAATCCCGAAGCTTAAACAACATAGCGGGCTTGGCAGGCAATGCTCTGAG

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000393288_chr12_75445097_-_1714nt
ATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACA
TTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCT
CAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAG
AGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAG
GTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGT
GAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTA
CCAATTTATTGCTTTTGCTTCTTTATTCTTCATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAA
AAACAAGACAGAACCAGTCATCAATGGCACAAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGT
GTGTGTGGTGTGGTTTACTTTTGAATTTTTAGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCAT
TGACTTTGTGGCCATCCTACCTTTCTACTTAGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAG
GGTGGTAAGGTTTGTGAGGATCCTGAGAATTTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAG
TACTAATGAATTTTTGCTGCTGATAATTTTCCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGC
TCAACCTAACGACCCTTCAGCTAGTGAGCACACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCT
GGGTTATGGGGATATGTACCCCCAAACATGGTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCC
AGTGCCTGTCATTGTCAATAATTTTGGAATGTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCC
TCCTGCTCCTCAGGCAAGCTCACCTACTTTTTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAA
AGACAATCGACTTCTGGAACATAACAGATCAGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCT
CCCCATCAGACGCTCTAGTACCAGAGACAAAAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGA
TGGAGGGATCAGGAAAGGAATTAGAAATGGGCATTCCATCCTACATCACCTGGATAATGGCACCAAATGCCATTATTTAAGAATCATCTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000550433_chr12_75445097_-_3007nt
AAAAGTAAAGAGGTAGTACAGCACGTAATCCAGGGTGCTGATGTTGTGGGAGGGGACTTAAAACAGAGTAAGGAAATCAGAAACAATTTC
CTCCACACAGAAAAGAACAGAACTCTCTTACCTATGAACCAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAA
GAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTT
CAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACA
GTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCT
ACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAATTTATTGCTTTTGCTTCTTTATTCTT
CATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAAAAACAAGACAGAACCAGTCATCAATGGCAC
AAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGTGTGTGTGGTGTGGTTTACTTTTGAATTTTT
AGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCATTGACTTTGTGGCCATCCTACCTTTCTACTT
AGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAGGGTGGTAAGGTTTGTGAGGATCCTGAGAAT
TTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAGTACTAATGAATTTTTGCTGCTGATAATTTT
CCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGCTCAACCTAACGACCCTTCAGCTAGTGAGCA
CACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCTGGGTTATGGGGATATGTACCCCCAAACATG
GTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCCAGTGCCTGTCATTGTCAATAATTTTGGAAT
GTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCCTCCTGCTCCTCAGGCAAGCTCACCTACTTT
TTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAAAGACAATCGACTTCTGGAACATAACAGATC
AGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCTCCCCATCAGACGCTCTAGTACCAGAGACAA
AAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGATGGAGGGATCAGGAAAGTGTTGTACAGAAT
TTATCATGGATTATTGACTGCTGAGAAAGGGACAGTGGAATTTAGCCATACCAAGGACTATACTGGAAACAGACTTCTGCTGCTGAATGT
GCCCTGATGTGACCAGGTTGCACTTGGAAGAGATCCTCGCGTCTTCATGAGGCACTTAAAGCTTATAAAAGAACTGCGGCTGGAACTCAT
CTGGTGCTCCCCATGAGAGTGCTCTGCTTGTAGACTGGCCAGTGTCCATGAAACAACTGTAAATACCAACATGTGTGCATGGGTCAACAG
TCTTGGCCATTTCTCATCAAAAGAAGCCAAATTCATGATCAACATCTCTGAAGTTTCAAGTAAGGCCCACACTTCTTTGAATTACTCTTC
ATGGGCCCACATTAGGTTGTGCTGTGAATTACTTAAGGCAGTGATACTGATGTAGTATAGTTTTGTCTTAATTTCCCTTATTTCTACTTC
TTTGGTTGAATCTATGAACTTGATTGTATAATTTTCTTATAAATTACTGATGTAATCAGCTTGTCAATTATGTTGTGAAATTGTTAGTAT
TCATTTATCAAAAATGACCTATGTTTAGTCACATATTTGTTTAGTTCTGGGAAATTGTTATAGCTTAAATGGAACTCACCAACATTATTC
ATAGTTTAAGTCTTTTATCATTATTACCTCAATTATAAATATTACAAAAACATAATTCTGGCAATGAGAGTATTTTTTTATTCAATGATC
AAGGAGCAATGTCAGTATATAGTAGAATATCAATTAAATTATATCCTAAAATGTATATTTTGCATAAAAGAGATATTCTTTAATCAATTA
CTTTTTTGTGAGTTTTGTGGCAAATGAAGCTTGTACGTGTCTTTAAAACTGTTGTAGATGAAACTGTATAAGATTTTTACATCTTGCTTA
ATCAATATTTTCAGAGTCTATTAGTTCCCCTGGGATTCTGAATATAACATATAGCCTATTATAAATCCCTGTATCGTGGACCTTTTGTGA
ACATTTCAAGGCGCATGCACAACCTTGATGATAACCAGTGGAAATGTAACTAACTGAAATGAAGAATAAAAGGCAAATGAGCTGGGGATA

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000548513_chr12_75445097_-_3102nt
AAAAGTAAAGAGGTAGTACAGCACGTAATCCAGGGTGCTGATGTTGTGGGAGGGGACTTAAAACAGAGTAAGGAAATCAGAAACAATTTC
CTCCACACAGAAAAGAACAGAACTCTCTTACCTATGAACCAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAA
GAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTT
CAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACA
GTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCT
ACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAATTTATTGCTTTTGCTTCTTTATTCTT
CATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAAAAACAAGACAGAACCAGTCATCAATGGCAC
AAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGTGTGTGTGGTGTGGTTTACTTTTGAATTTTT
AGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCATTGACTTTGTGGCCATCCTACCTTTCTACTT
AGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAGGGTGGTAAGGTTTGTGAGGATCCTGAGAAT
TTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAGTACTAATGAATTTTTGCTGCTGATAATTTT
CCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGCTCAACCTAACGACCCTTCAGCTAGTGAGCA
CACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCTGGGTTATGGGGATATGTACCCCCAAACATG
GTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCCAGTGCCTGTCATTGTCAATAATTTTGGAAT
GTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCCTCCTGCTCCTCAGGCAAGCTCACCTACTTT
TTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAAAGACAATCGACTTCTGGAACATAACAGATC
AGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCTCCCCATCAGACGCTCTAGTACCAGAGACAA
AAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGATGGAGGGATCAGGAAAGATAACTGCAAAGA
GGTTGTCATTACTGGTTACACGCAAGCCGAGGCCAGATCTCTTACTTAATGACTTGGGGAAGGCACAAAACATGAGAGAAAGTGTTGTAC
AGAATTTATCATGGATTATTGACTGCTGAGAAAGGGACAGTGGAATTTAGCCATACCAAGGACTATACTGGAAACAGACTTCTGCTGCTG
AATGTGCCCTGATGTGACCAGGTTGCACTTGGAAGAGATCCTCGCGTCTTCATGAGGCACTTAAAGCTTATAAAAGAACTGCGGCTGGAA
CTCATCTGGTGCTCCCCATGAGAGTGCTCTGCTTGTAGACTGGCCAGTGTCCATGAAACAACTGTAAATACCAACATGTGTGCATGGGTC
AACAGTCTTGGCCATTTCTCATCAAAAGAAGCCAAATTCATGATCAACATCTCTGAAGTTTCAAGTAAGGCCCACACTTCTTTGAATTAC
TCTTCATGGGCCCACATTAGGTTGTGCTGTGAATTACTTAAGGCAGTGATACTGATGTAGTATAGTTTTGTCTTAATTTCCCTTATTTCT
ACTTCTTTGGTTGAATCTATGAACTTGATTGTATAATTTTCTTATAAATTACTGATGTAATCAGCTTGTCAATTATGTTGTGAAATTGTT
AGTATTCATTTATCAAAAATGACCTATGTTTAGTCACATATTTGTTTAGTTCTGGGAAATTGTTATAGCTTAAATGGAACTCACCAACAT
TATTCATAGTTTAAGTCTTTTATCATTATTACCTCAATTATAAATATTACAAAAACATAATTCTGGCAATGAGAGTATTTTTTTATTCAA
TGATCAAGGAGCAATGTCAGTATATAGTAGAATATCAATTAAATTATATCCTAAAATGTATATTTTGCATAAAAGAGATATTCTTTAATC
AATTACTTTTTTGTGAGTTTTGTGGCAAATGAAGCTTGTACGTGTCTTTAAAACTGTTGTAGATGAAACTGTATAAGATTTTTACATCTT
GCTTAATCAATATTTTCAGAGTCTATTAGTTCCCCTGGGATTCTGAATATAACATATAGCCTATTATAAATCCCTGTATCGTGGACCTTT
TGTGAACATTTCAAGGCGCATGCACAACCTTGATGATAACCAGTGGAAATGTAACTAACTGAAATGAAGAATAAAAGGCAAATGAGCTGG

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000549446_chr12_75445097_-_5041nt
AAAAGTAAAGAGGTAGTACAGCACGTAATCCAGGGTGCTGATGTTGTGGGAGGGGACTTAAAACAGAGTAAGGAAATCAGAAACAATTTC
CTCCACACAGAAAAGAACAGAACTCTCTTACCTATGAACCAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAA
GAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTT
CAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACA
GTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCT
ACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAATTTATTGCTTTTGCTTCTTTATTCTT
CATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAAAAACAAGACAGAACCAGTCATCAATGGCAC
AAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGTGTGTGTGGTGTGGTTTACTTTTGAATTTTT
AGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCATTGACTTTGTGGCCATCCTACCTTTCTACTT
AGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAGGGTGGTAAGGTTTGTGAGGATCCTGAGAAT
TTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAGTACTAATGAATTTTTGCTGCTGATAATTTT
CCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGCTCAACCTAACGACCCTTCAGCTAGTGAGCA
CACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCTGGGTTATGGGGATATGTACCCCCAAACATG
GTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCCAGTGCCTGTCATTGTCAATAATTTTGGAAT
GTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCCTCCTGCTCCTCAGGCAAGCTCACCTACTTT
TTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAAAGACAATCGACTTCTGGAACATAACAGATC
AGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCTCCCCATCAGACGCTCTAGTACCAGAGACAA
AAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGATGGAGGGATCAGGAAAGGATATGAAAAATC
CCGAAGCTTAAACAACATAGCGGGCTTGGCAGGCAATGCTCTGAGGCTCTCTCCAGTAACATCACCCTACAACTCTCCTTGTCCTCTGAG
GCGCTCTCGATCTCCCATCCCATCTATCTTGTAAACCAAACAACCAAACTGCATCAGTCGGCTAAATTGTATTAATTCAAGTGCTGTTTA
CCCCATAATGGAAATAATTAAATGTAGAGTTACTCCAGGCTCCATTAATACAGTATAAATCTTGCATGATACTACAATTTGAAGTCAGAA
ATGCCACTTGGGTAGCTAATGAATCTTACCCAGGCTTTAAAGATTGTCTAAAGTAGTGCTAAGATCCCTCCTATTAATTGCCCTGATATC
CTTTTGCAATAAAATGACAGATAGTGTCAGATATTGACCAGTGCACTAATATATAAACATACCTTCAGGGAGATATATTTAAAACAGTGT
GCTTCCAAATGCCAACCACTTCATTGGAACTTTATTTCTTGTGACTGTAAACCATTCTGAAGATGTCTGGGATCCTATCTTGATTGCACA
CGACATGACTTGTGTCAGCTCATTTGCATGGACCATCTTGTCTCTATCACCTGAAAGCAATGTTGCAGAGTTCGGGGACTGTGGATAGCT
CAGGATATGTGTACTTGCATCGAACCATCCTGCTGATATGAAAGCATTGGTCGACTGTTCTGCATGTTGAATTGTGGGGCAGGGAGGGCA
CTTTTCTCCTTGACATTTTTTTCTTATTATTTGAAAGAAATATATGTTTTAAATAGTTTAATTTCTTGATTGATTTACTTTTCTTCAAAA
ATGCTGTATTGGAGTTCTGAATGTCTCTGGTTGTTTGCACACAGATAACTGCAAAGAGGTTGTCATTACTGGTTACACGCAAGCCGAGGC
CAGATCTCTTACTTAATGACTTGGGGAAGGCACAAAACATGAGAGAAAGGTAACTGCCAGCCAGGCTTGCATTGTTTAGCCAGAAATTGC
TGCTTGGTTCTAGACTCTTTAAAAAAAAAAAATACCCAGGGTTTGTCATCATTTTCAGAGGCAGAGTGCCAAATATCACCCAAAGCTCTT
GTGTCTTTTTTTTACCCCCTTATTTTATTTTTATTTATTAATTTTTTGTGCAAACATCAAATGTCACTGGTGTTCACAGAAGGCTTTTTT
GACTAGCCTTAAATTCCTGAGTCAAAAGATTAATCAGATTTTCAGGCAGTGTTTAATCAGGTGCTTTGTCCTGTATGTTGTTCTTGTCTG
TCTTAGCTCCCTGTCTTTCCTGTATATGCCATCTGTCTCCATGAAGCACAGAAATGCCTCTGTAAGATGTTTATGATTTTAATATTTACT
CCCTCCAAACCCGACTCCATACCATTTTTTGCTATTTGGAGCAGCCTCTCTGCTTTGTGTATAAATTAATGATGCTCTGTAGACTACCTA
AGTTAATCGGCACTGTGAATCTTTTTGATAAGCAGGGTTTAAGCAGCAATTTCACCATTGCACTTGGTTGCCTGCTGCAGTGTCAGTTTC
TACTACCTAGCAACCAGCATTCATTACTACACTCCAACAAAATCCTTAGGGAGTCATATTCAGTCTGAGTGGAAGAAAGTCTATTTATGC
ATTCCTATGAATTCAACAGCAATAGCGTGTCTCATGTATTGAGCATGTGAGGGAAGAAAAAGACCGTAATATAAATAGAGGGATAAATAA
TATCACTAAGGCATTTGGGAGCCTTGAGACTGCTGATTAATTCCTATTTCTCATGTTTATTTTTTGTTAGGAAGACAATTGTCACTTTTA
TTATTGGCCACGAAACATGTATTACTCTATATCCCCAAGTCCTAGAGCATGACCTGCATGTTGGAGATGTTGTACAGCAATGTATTTATC
CAGACATACATATATGATATTTAGAGACACAGTGATTCTTTTGATAACACCACACATAGAACATTATAATTACACACAAATTTATGGTAA
AAGAATTAATATGCTGTCTGGTGCTGCTGTTATTGACTACAGTGTTGTACAGAATTTATCATGGATTATTGACTGCTGAGAAAGGGACAG
TGGAATTTAGCCATACCAAGGACTATACTGGAAACAGACTTCTGCTGCTGAATGTGCCCTGATGTGACCAGGTTGCACTTGGAAGAGATC
CTCGCGTCTTCATGAGGCACTTAAAGCTTATAAAAGAACTGCGGCTGGAACTCATCTGGTGCTCCCCATGAGAGTGCTCTGCTTGTAGAC
TGGCCAGTGTCCATGAAACAACTGTAAATACCAACATGTGTGCATGGGTCAACAGTCTTGGCCATTTCTCATCAAAAGAAGCCAAATTCA
TGATCAACATCTCTGAAGTTTCAAGTAAGGCCCACACTTCTTTGAATTACTCTTCATGGGCCCACATTAGGTTGTGCTGTGAATTACTTA
AGGCAGTGATACTGATGTAGTATAGTTTTGTCTTAATTTCCCTTATTTCTACTTCTTTGGTTGAATCTATGAACTTGATTGTATAATTTT
CTTATAAATTACTGATGTAATCAGCTTGTCAATTATGTTGTGAAATTGTTAGTATTCATTTATCAAAAATGACCTATGTTTAGTCACATA
TTTGTTTAGTTCTGGGAAATTGTTATAGCTTAAATGGAACTCACCAACATTATTCATAGTTTAAGTCTTTTATCATTATTACCTCAATTA
TAAATATTACAAAAACATAATTCTGGCAATGAGAGTATTTTTTTATTCAATGATCAAGGAGCAATGTCAGTATATAGTAGAATATCAATT
AAATTATATCCTAAAATGTATATTTTGCATAAAAGAGATATTCTTTAATCAATTACTTTTTTGTGAGTTTTGTGGCAAATGAAGCTTGTA
CGTGTCTTTAAAACTGTTGTAGATGAAACTGTATAAGATTTTTACATCTTGCTTAATCAATATTTTCAGAGTCTATTAGTTCCCCTGGGA
TTCTGAATATAACATATAGCCTATTATAAATCCCTGTATCGTGGACCTTTTGTGAACATTTCAAGGCGCATGCACAACCTTGATGATAAC
CAGTGGAAATGTAACTAACTGAAATGAAGAATAAAAGGCAAATGAGCTGGGGATAAACTTGAATGTTATCTGATTAAATTACTCAAATTA

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000298972_chr12_75445097_-_3063nt
AAAAGTAAAGAGGTAGTACAGCACGTAATCCAGGGTGCTGATGTTGTGGGAGGGGACTTAAAACAGAGTAAGGAAATCAGAAACAATTTC
CTCCACACAGAAAAGAACAGAACTCTCTTACCTATGAACCAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAA
GAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTT
CAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACA
GTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCT
ACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAATTTATTGCTTTTGCTTCTTTATTCTT
CATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAAAAACAAGACAGAACCAGTCATCAATGGCAC
AAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGTGTGTGTGGTGTGGTTTACTTTTGAATTTTT
AGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCATTGACTTTGTGGCCATCCTACCTTTCTACTT
AGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAGGGTGGTAAGGTTTGTGAGGATCCTGAGAAT
TTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAGTACTAATGAATTTTTGCTGCTGATAATTTT
CCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGCTCAACCTAACGACCCTTCAGCTAGTGAGCA
CACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCTGGGTTATGGGGATATGTACCCCCAAACATG
GTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCCAGTGCCTGTCATTGTCAATAATTTTGGAAT
GTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCCTCCTGCTCCTCAGGCAAGCTCACCTACTTT
TTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAAAGACAATCGACTTCTGGAACATAACAGATC
AGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCTCCCCATCAGACGCTCTAGTACCAGAGACAA
AAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGATGGAGGGATCAGGAAAGATAACTGCAAAGA
GGTTGTCATTACTGGTTACACGCAAGCCGAGGCCAGATCTCTTACTTAATGACTTGGGGAAGGCACAAAACATGAGAGAAAGTGTTGTAC
AGAATTTATCATGGATTATTGACTGCTGAGAAAGGGACAGTGGAATTTAGCCATACCAAGGACTATACTGGAAACAGACTTCTGCTGCTG
AATGTGCCCTGATGTGACCAGGTTGCACTTGGAAGAGATCCTCGCGTCTTCATGAGGCACTTAAAGCTTATAAAAGAACTGCGGCTGGAA
CTCATCTGGTGCTCCCCATGAGAGTGCTCTGCTTGTAGACTGGCCAGTGTCCATGAAACAACTGTAAATACCAACATGTGTGCATGGGTC
AACAGTCTTGGCCATTTCTCATCAAAAGAAGCCAAATTCATGATCAACATCTCTGAAGTTTCAAGTAAGGCCCACACTTCTTTGAATTAC
TCTTCATGGGCCCACATTAGGTTGTGCTGTGAATTACTTAAGGCAGTGATACTGATGTAGTATAGTTTTGTCTTAATTTCCCTTATTTCT
ACTTCTTTGGTTGAATCTATGAACTTGATTGTATAATTTTCTTATAAATTACTGATGTAATCAGCTTGTCAATTATGTTGTGAAATTGTT
AGTATTCATTTATCAAAAATGACCTATGTTTAGTCACATATTTGTTTAGTTCTGGGAAATTGTTATAGCTTAAATGGAACTCACCAACAT
TATTCATAGTTTAAGTCTTTTATCATTATTACCTCAATTATAAATATTACAAAAACATAATTCTGGCAATGAGAGTATTTTTTTATTCAA
TGATCAAGGAGCAATGTCAGTATATAGTAGAATATCAATTAAATTATATCCTAAAATGTATATTTTGCATAAAAGAGATATTCTTTAATC
AATTACTTTTTTGTGAGTTTTGTGGCAAATGAAGCTTGTACGTGTCTTTAAAACTGTTGTAGATGAAACTGTATAAGATTTTTACATCTT
GCTTAATCAATATTTTCAGAGTCTATTAGTTCCCCTGGGATTCTGAATATAACATATAGCCTATTATAAATCCCTGTATCGTGGACCTTT
TGTGAACATTTCAAGGCGCATGCACAACCTTGATGATAACCAGTGGAAATGTAACTAACTGAAATGAAGAATAAAAGGCAAATGAGCTGG

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000341669_chr12_75445097_-_2968nt
AAAAGTAAAGAGGTAGTACAGCACGTAATCCAGGGTGCTGATGTTGTGGGAGGGGACTTAAAACAGAGTAAGGAAATCAGAAACAATTTC
CTCCACACAGAAAAGAACAGAACTCTCTTACCTATGAACCAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAA
GAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTT
CAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACA
GTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCT
ACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAATTTATTGCTTTTGCTTCTTTATTCTT
CATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAAAAACAAGACAGAACCAGTCATCAATGGCAC
AAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGTGTGTGTGGTGTGGTTTACTTTTGAATTTTT
AGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCATTGACTTTGTGGCCATCCTACCTTTCTACTT
AGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAGGGTGGTAAGGTTTGTGAGGATCCTGAGAAT
TTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAGTACTAATGAATTTTTGCTGCTGATAATTTT
CCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGCTCAACCTAACGACCCTTCAGCTAGTGAGCA
CACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCTGGGTTATGGGGATATGTACCCCCAAACATG
GTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCCAGTGCCTGTCATTGTCAATAATTTTGGAAT
GTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCCTCCTGCTCCTCAGGCAAGCTCACCTACTTT
TTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAAAGACAATCGACTTCTGGAACATAACAGATC
AGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCTCCCCATCAGACGCTCTAGTACCAGAGACAA
AAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGATGGAGGGATCAGGAAAGTGTTGTACAGAAT
TTATCATGGATTATTGACTGCTGAGAAAGGGACAGTGGAATTTAGCCATACCAAGGACTATACTGGAAACAGACTTCTGCTGCTGAATGT
GCCCTGATGTGACCAGGTTGCACTTGGAAGAGATCCTCGCGTCTTCATGAGGCACTTAAAGCTTATAAAAGAACTGCGGCTGGAACTCAT
CTGGTGCTCCCCATGAGAGTGCTCTGCTTGTAGACTGGCCAGTGTCCATGAAACAACTGTAAATACCAACATGTGTGCATGGGTCAACAG
TCTTGGCCATTTCTCATCAAAAGAAGCCAAATTCATGATCAACATCTCTGAAGTTTCAAGTAAGGCCCACACTTCTTTGAATTACTCTTC
ATGGGCCCACATTAGGTTGTGCTGTGAATTACTTAAGGCAGTGATACTGATGTAGTATAGTTTTGTCTTAATTTCCCTTATTTCTACTTC
TTTGGTTGAATCTATGAACTTGATTGTATAATTTTCTTATAAATTACTGATGTAATCAGCTTGTCAATTATGTTGTGAAATTGTTAGTAT
TCATTTATCAAAAATGACCTATGTTTAGTCACATATTTGTTTAGTTCTGGGAAATTGTTATAGCTTAAATGGAACTCACCAACATTATTC
ATAGTTTAAGTCTTTTATCATTATTACCTCAATTATAAATATTACAAAAACATAATTCTGGCAATGAGAGTATTTTTTTATTCAATGATC
AAGGAGCAATGTCAGTATATAGTAGAATATCAATTAAATTATATCCTAAAATGTATATTTTGCATAAAAGAGATATTCTTTAATCAATTA
CTTTTTTGTGAGTTTTGTGGCAAATGAAGCTTGTACGTGTCTTTAAAACTGTTGTAGATGAAACTGTATAAGATTTTTACATCTTGCTTA
ATCAATATTTTCAGAGTCTATTAGTTCCCCTGGGATTCTGAATATAACATATAGCCTATTATAAATCCCTGTATCGTGGACCTTTTGTGA

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000350228_chr12_75445097_-_2897nt
AAAAGTAAAGAGGTAGTACAGCACGTAATCCAGGGTGCTGATGTTGTGGGAGGGGACTTAAAACAGAGTAAGGAAATCAGAAACAATTTC
CTCCACACAGAAAAGAACAGAACTCTCTTACCTATGAACCAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAA
GAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTT
CAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACA
GTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCT
ACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAATTTATTGCTTTTGCTTCTTTATTCTT
CATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAAAAACAAGACAGAACCAGTCATCAATGGCAC
AAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGTGTGTGTGGTGTGGTTTACTTTTGAATTTTT
AGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCATTGACTTTGTGGCCATCCTACCTTTCTACTT
AGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAGGGTGGTAAGGTTTGTGAGGATCCTGAGAAT
TTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAGTACTAATGAATTTTTGCTGCTGATAATTTT
CCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGCTCAACCTAACGACCCTTCAGCTAGTGAGCA
CACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCTGGGTTATGGGGATATGTACCCCCAAACATG
GTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCCAGTGCCTGTCATTGTCAATAATTTTGGAAT
GTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCCTCCTGCTCCTCAGGCAAGCTCACCTACTTT
TTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAAAGACAATCGACTTCTGGAACATAACAGATC
AGATAACTGCAAAGAGGTTGTCATTACTGGTTACACGCAAGCCGAGGCCAGATCTCTTACTTAATGACTTGGGGAAGGCACAAAACATGA
GAGAAAGTGTTGTACAGAATTTATCATGGATTATTGACTGCTGAGAAAGGGACAGTGGAATTTAGCCATACCAAGGACTATACTGGAAAC
AGACTTCTGCTGCTGAATGTGCCCTGATGTGACCAGGTTGCACTTGGAAGAGATCCTCGCGTCTTCATGAGGCACTTAAAGCTTATAAAA
GAACTGCGGCTGGAACTCATCTGGTGCTCCCCATGAGAGTGCTCTGCTTGTAGACTGGCCAGTGTCCATGAAACAACTGTAAATACCAAC
ATGTGTGCATGGGTCAACAGTCTTGGCCATTTCTCATCAAAAGAAGCCAAATTCATGATCAACATCTCTGAAGTTTCAAGTAAGGCCCAC
ACTTCTTTGAATTACTCTTCATGGGCCCACATTAGGTTGTGCTGTGAATTACTTAAGGCAGTGATACTGATGTAGTATAGTTTTGTCTTA
ATTTCCCTTATTTCTACTTCTTTGGTTGAATCTATGAACTTGATTGTATAATTTTCTTATAAATTACTGATGTAATCAGCTTGTCAATTA
TGTTGTGAAATTGTTAGTATTCATTTATCAAAAATGACCTATGTTTAGTCACATATTTGTTTAGTTCTGGGAAATTGTTATAGCTTAAAT
GGAACTCACCAACATTATTCATAGTTTAAGTCTTTTATCATTATTACCTCAATTATAAATATTACAAAAACATAATTCTGGCAATGAGAG
TATTTTTTTATTCAATGATCAAGGAGCAATGTCAGTATATAGTAGAATATCAATTAAATTATATCCTAAAATGTATATTTTGCATAAAAG
AGATATTCTTTAATCAATTACTTTTTTGTGAGTTTTGTGGCAAATGAAGCTTGTACGTGTCTTTAAAACTGTTGTAGATGAAACTGTATA
AGATTTTTACATCTTGCTTAATCAATATTTTCAGAGTCTATTAGTTCCCCTGGGATTCTGAATATAACATATAGCCTATTATAAATCCCT
GTATCGTGGACCTTTTGTGAACATTTCAAGGCGCATGCACAACCTTGATGATAACCAGTGGAAATGTAACTAACTGAAATGAAGAATAAA

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000540018_chr12_75445097_-_1993nt
AAAAGTAAAGAGGTAGTACAGCACGTAATCCAGGGTGCTGATGTTGTGGGAGGGGACTTAAAACAGAGTAAGGAAATCAGAAACAATTTC
CTCCACACAGAAAAGAACAGAACTCTCTTACCTATGAACCAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAA
GAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTT
CAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACA
GTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCT
ACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAATTTATTGCTTTTGCTTCTTTATTCTT
CATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAAAAACAAGACAGAACCAGTCATCAATGGCAC
AAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGTGTGTGTGGTGTGGTTTACTTTTGAATTTTT
AGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCATTGACTTTGTGGCCATCCTACCTTTCTACTT
AGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAGGGTGGTAAGGTTTGTGAGGATCCTGAGAAT
TTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAGTACTAATGAATTTTTGCTGCTGATAATTTT
CCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGCTCAACCTAACGACCCTTCAGCTAGTGAGCA
CACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCTGGGTTATGGGGATATGTACCCCCAAACATG
GTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCCAGTGCCTGTCATTGTCAATAATTTTGGAAT
GTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCCTCCTGCTCCTCAGGCAAGCTCACCTACTTT
TTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAAAGACAATCGACTTCTGGAACATAACAGATC
AGGATATGAAAAATCCCGAAGCTTAAACAACATAGCGGGCTTGGCAGGCAATGCTCTGAGGCTCTCTCCAGTAACATCACCCTACAACTC
TCCTTGTCCTCTGAGGCGCTCTCGATCTCCCATCCCATCTATCTTGTAAACCAAACAACCAAACTGCATCAGTCGGCTAAATTGTATTAA
TTCAAGTGCTGTTTACCCCATAATGGAAATAATTAAATGTAGAGTTACTCCAGGCTCCATTAATACAGTATAAATCTTGCATGATACTAC

>In-frame_PTPRR_ENST00000549308_chr12_71092045_-_KCNC2_ENST00000393288_chr12_75445097_-_2334nt
AAAAGTAAAGAGGTAGTACAGCACGTAATCCAGGGTGCTGATGTTGTGGGAGGGGACTTAAAACAGAGTAAGGAAATCAGAAACAATTTC
CTCCACACAGAAAAGAACAGAACTCTCTTACCTATGAACCAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAA
GAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTT
CAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACA
GTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCT
ACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAATTTATTGCTTTTGCTTCTTTATTCTT
CATCCTGGTTTCAATTACAACTTTTTGCCTGGAAACACATGAAGCTTTCAATATTGTTAAAAACAAGACAGAACCAGTCATCAATGGCAC
AAGTGTTGTTCTACAGTATGAAATTGAAACGGATCCTGCCTTGACGTATGTAGAAGGAGTGTGTGTGGTGTGGTTTACTTTTGAATTTTT
AGTCCGTATTGTTTTTTCACCCAATAAACTTGAATTCATCAAAAATCTCTTGAATATCATTGACTTTGTGGCCATCCTACCTTTCTACTT
AGAGGTGGGACTCAGTGGGCTGTCATCCAAAGCTGCTAAAGATGTGCTTGGCTTCCTCAGGGTGGTAAGGTTTGTGAGGATCCTGAGAAT
TTTCAAGCTCACCCGCCATTTTGTAGGTCTGAGGGTGCTTGGACATACTCTTCGAGCTAGTACTAATGAATTTTTGCTGCTGATAATTTT
CCTGGCTCTAGGAGTTTTGATATTTGCTACCATGATCTACTATGCCGAGAGAGTGGGAGCTCAACCTAACGACCCTTCAGCTAGTGAGCA
CACACAGTTCAAAAACATTCCCATTGGGTTCTGGTGGGCTGTAGTGACCATGACTACCCTGGGTTATGGGGATATGTACCCCCAAACATG
GTCAGGCATGCTGGTGGGAGCCCTGTGTGCTCTGGCTGGAGTGCTGACAATAGCCATGCCAGTGCCTGTCATTGTCAATAATTTTGGAAT
GTACTACTCCTTGGCAATGGCAAAGCAGAAACTTCCAAGGAAAAGAAAGAAGCACATCCCTCCTGCTCCTCAGGCAAGCTCACCTACTTT
TTGCAAGACAGAATTAAATATGGCCTGCAATAGTACACAGAGTGACACATGTCTGGGCAAAGACAATCGACTTCTGGAACATAACAGATC
AGTGTTATCAGGTGACGACAGTACAGGAAGTGAGCCGCCACTATCACCCCCAGAAAGGCTCCCCATCAGACGCTCTAGTACCAGAGACAA
AAACAGAAGAGGGGAAACATGTTTCCTACTGACGACAGGTGATTACACGTGTGCTTCTGATGGAGGGATCAGGAAAGGAATTAGAAATGG
GCATTCCATCCTACATCACCTGGATAATGGCACCAAATGCCATTATTTAAGAATCATCTTTTAACCCTATAAAGCTGGAAGATTAAATAT
GCTGGAAAAAGAGTTGTCCATTTAAACTTAAGTATGCTTTATTGGCTTAGGAAATAAAAAATGAAAAGAGAAAAAGTAGCCTACTTATTT
CTCTTTTTTTCAAGAATACATTCTGAAATTTAAAAATATTAGTCAAGCTTATATCTTACTTAAGTTGCTTTGCCTAATTTTTAAATGAGT
TCTAGTATTCTATATGCCAAAATTATATTAATGCTAACTATAATCTGGGAAAAAATATATTTTGAAGTATTGTAACAATAATTTGTGATG


Top

FusionGenePPI for PTPRR_KCNC2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPRRMAPK1, MAPK3, MAPK7, MAPK14, NTRK1, CEP290, EGFR, ERBB2, IGF1R, RET, MST1R, ERBB4, FGFR2, FGFR4, KDR, TEK, INSR, ALDH18A1, DHPS, PNMA2, TRIM11, KIAA0196, TBC1D5, DNAJC13, SNX6, PTPRR, MAPK1IP1L, MAPKAPK3, MAD2L1BP, CBS, MAPK11, CCT8L1P, HSPA4L, LMTK2, AATK, ERBB3, RYK, ROR1, ROR2, PTK7, EPHA2KCNC2KCNC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPRR_KCNC2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneKCNC2Q96PR1DB06637DalfampridinePotassium voltage-gated channel subfamily C member 2 {ECO:0000312|HGNC:HGNC:6234}small moleculeapproved

Top

RelatedDiseases for PTPRR_KCNC2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTPRRC0041696Unipolar Depression1PSYGENET
HgenePTPRRC1269683Major Depressive Disorder1PSYGENET