FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29578

FusionGeneSummary for PTPRR_C12orf54

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPRR_C12orf54
Fusion gene ID: 29578
HgeneTgene
Gene symbol

PTPRR

C12orf54

Gene ID

5801

121273

Gene nameprotein tyrosine phosphatase, receptor type Rchromosome 12 open reading frame 54
SynonymsEC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQHSD-29|HSD-30
Cytomap

12q15

12q13.11

Type of geneprotein-codingprotein-coding
Descriptionreceptor-type tyrosine-protein phosphatase RCh-1 PTPaseNC-PTPCOM1R-PTP-Rch-1PTPaseprotein tyrosine phosphatase Cr1PTPaseprotein-tyrosine phosphatase NC-PTPCOM1protein-tyrosine phosphatase PCPTP1uncharacterized protein C12orf54
Modification date2018051920180329
UniProtAcc

Q15256

Q6X4T0

Ensembl transtripts involved in fusion geneENST00000283228, ENST00000440835, 
ENST00000537619, ENST00000378778, 
ENST00000342084, ENST00000549308, 
ENST00000314014, ENST00000548364, 
ENST00000548913, 
Fusion gene scores* DoF score12 X 9 X 4=4321 X 1 X 1=1
# samples 121
** MAII scorelog2(12/432*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: PTPRR [Title/Abstract] AND C12orf54 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EE-A2MS-06APTPRRchr12

71158445

-C12orf54chr12

48880471

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000283228ENST00000314014PTPRRchr12

71158445

-C12orf54chr12

48880471

+
In-frameENST00000283228ENST00000548364PTPRRchr12

71158445

-C12orf54chr12

48880471

+
5CDS-intronENST00000283228ENST00000548913PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-3CDSENST00000440835ENST00000314014PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-3CDSENST00000440835ENST00000548364PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-intronENST00000440835ENST00000548913PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-3CDSENST00000537619ENST00000314014PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-3CDSENST00000537619ENST00000548364PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-intronENST00000537619ENST00000548913PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-3CDSENST00000378778ENST00000314014PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-3CDSENST00000378778ENST00000548364PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-intronENST00000378778ENST00000548913PTPRRchr12

71158445

-C12orf54chr12

48880471

+
In-frameENST00000342084ENST00000314014PTPRRchr12

71158445

-C12orf54chr12

48880471

+
In-frameENST00000342084ENST00000548364PTPRRchr12

71158445

-C12orf54chr12

48880471

+
5CDS-intronENST00000342084ENST00000548913PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-3CDSENST00000549308ENST00000314014PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-3CDSENST00000549308ENST00000548364PTPRRchr12

71158445

-C12orf54chr12

48880471

+
intron-intronENST00000549308ENST00000548913PTPRRchr12

71158445

-C12orf54chr12

48880471

+

Top

FusionProtFeatures for PTPRR_C12orf54


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPRR

Q15256

C12orf54

Q6X4T0

Sequesters mitogen-activated protein kinases (MAPKs)such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactiveform. The MAPKs bind to a dephosphorylated kinase interactingmotif, phosphorylation of which by the protein kinase A complexreleases the MAPKs for activation and translocation into thenucleus (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPRRchr12:71158445chr12:48880471ENST00000283228-314393_647157658DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71158445chr12:48880471ENST00000342084-213393_64745546DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71158445chr12:48880471ENST00000378778-111393_6470452DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71158445chr12:48880471ENST00000440835-110393_647-156413DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71158445chr12:48880471ENST00000549308-111393_647-80413DomainTyrosine-protein phosphatase
HgenePTPRRchr12:71158445chr12:48880471ENST00000283228-314588_594157658RegionSubstrate binding
HgenePTPRRchr12:71158445chr12:48880471ENST00000342084-213588_59445546RegionSubstrate binding
HgenePTPRRchr12:71158445chr12:48880471ENST00000378778-111588_5940452RegionSubstrate binding
HgenePTPRRchr12:71158445chr12:48880471ENST00000440835-110588_594-156413RegionSubstrate binding
HgenePTPRRchr12:71158445chr12:48880471ENST00000549308-111588_594-80413RegionSubstrate binding
HgenePTPRRchr12:71158445chr12:48880471ENST00000283228-31422_227157658Topological domainExtracellular
HgenePTPRRchr12:71158445chr12:48880471ENST00000283228-314249_657157658Topological domainCytoplasmic
HgenePTPRRchr12:71158445chr12:48880471ENST00000342084-21322_22745546Topological domainExtracellular
HgenePTPRRchr12:71158445chr12:48880471ENST00000342084-213249_65745546Topological domainCytoplasmic
HgenePTPRRchr12:71158445chr12:48880471ENST00000378778-11122_2270452Topological domainExtracellular
HgenePTPRRchr12:71158445chr12:48880471ENST00000378778-111249_6570452Topological domainCytoplasmic
HgenePTPRRchr12:71158445chr12:48880471ENST00000440835-11022_227-156413Topological domainExtracellular
HgenePTPRRchr12:71158445chr12:48880471ENST00000440835-110249_657-156413Topological domainCytoplasmic
HgenePTPRRchr12:71158445chr12:48880471ENST00000549308-11122_227-80413Topological domainExtracellular
HgenePTPRRchr12:71158445chr12:48880471ENST00000549308-111249_657-80413Topological domainCytoplasmic
HgenePTPRRchr12:71158445chr12:48880471ENST00000283228-314228_248157658TransmembraneHelical
HgenePTPRRchr12:71158445chr12:48880471ENST00000342084-213228_24845546TransmembraneHelical
HgenePTPRRchr12:71158445chr12:48880471ENST00000378778-111228_2480452TransmembraneHelical
HgenePTPRRchr12:71158445chr12:48880471ENST00000440835-110228_248-156413TransmembraneHelical
HgenePTPRRchr12:71158445chr12:48880471ENST00000549308-111228_248-80413TransmembraneHelical


Top

FusionGeneSequence for PTPRR_C12orf54


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPRR_ENST00000283228_chr12_71158445_-_C12orf54_ENST00000314014_chr12_48880471_+_253aa
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFITKHSQDIEKSLDIAPQKIYRHSYHSSSEAQVSKRHQIVNSAFPRPAT
DPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKQVTITETLWDQVLTVFKDIQK

>In-frame_PTPRR_ENST00000283228_chr12_71158445_-_C12orf54_ENST00000548364_chr12_48880471_+_253aa
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFITKHSQDIEKSLDIAPQKIYRHSYHSSSEAQVSKRHQIVNSAFPRPAT
DPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKQVTITETLWDQVLTVFKDIQK

>In-frame_PTPRR_ENST00000342084_chr12_71158445_-_C12orf54_ENST00000314014_chr12_48880471_+_141aa
MQSISKQTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKQVTITETLWDQVLTVFKDIQKELQEDARIRGMSNCSMTPMTSA

>In-frame_PTPRR_ENST00000342084_chr12_71158445_-_C12orf54_ENST00000548364_chr12_48880471_+_141aa
MQSISKQTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKQVTITETLWDQVLTVFKDIQKELQEDARIRGMSNCSMTPMTSA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPRR_ENST00000283228_chr12_71158445_-_C12orf54_ENST00000314014_chr12_48880471_+_759nt
ATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGGGTGCTTTTCAGGAAACAATGATCATTTTTTG
GCAATTAATCAGAAGAAGAGTGGGAAGCCGGTATTCATTTATAAGCATTCACAAGACATTGAGAAGAGCCTGGATATAGCCCCACAAAAA
ATCTACAGACATAGCTACCATTCCTCTTCCGAAGCTCAAGTAAGCAAACGCCACCAGATTGTCAATTCAGCATTTCCTAGACCCGCATAT
GACCCGTCTCTCAATCTGCTGGCCATGGATGGTCAAGATCTTGAAGTGGAAAATCTCCCAATCCCAGCAGCAAATGTAATTGTGGTGACA
CTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAGCAA
GTGCACATCAATCGCCTCATTGAAAAACAGGTAACCATCACTGAAACCCTGTGGGACCAGGTGCTGACAGTTTTTAAGGATATACAAAAG
GAGCTGCAGGAAGATGCTCGGATTCGAGGGATGAGCAACTGCTCCATGACACCCATGACATCAGCACCCAGGACTGGAAGCATAAGGCCT
CCAGATTCCTTGATGACCCCAAAGTTGAGAAGATTGCAGTTCAGCTCTGGAGAGCAGCCATCAGGAGGCCGTATCCACAACCTGAAGACA

>In-frame_PTPRR_ENST00000283228_chr12_71158445_-_C12orf54_ENST00000548364_chr12_48880471_+_759nt
ATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGGGTGCTTTTCAGGAAACAATGATCATTTTTTG
GCAATTAATCAGAAGAAGAGTGGGAAGCCGGTATTCATTTATAAGCATTCACAAGACATTGAGAAGAGCCTGGATATAGCCCCACAAAAA
ATCTACAGACATAGCTACCATTCCTCTTCCGAAGCTCAAGTAAGCAAACGCCACCAGATTGTCAATTCAGCATTTCCTAGACCCGCATAT
GACCCGTCTCTCAATCTGCTGGCCATGGATGGTCAAGATCTTGAAGTGGAAAATCTCCCAATCCCAGCAGCAAATGTAATTGTGGTGACA
CTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAGCAA
GTGCACATCAATCGCCTCATTGAAAAACAGGTAACCATCACTGAAACCCTGTGGGACCAGGTGCTGACAGTTTTTAAGGATATACAAAAG
GAGCTGCAGGAAGATGCTCGGATTCGAGGGATGAGCAACTGCTCCATGACACCCATGACATCAGCACCCAGGACTGGAAGCATAAGGCCT
CCAGATTCCTTGATGACCCCAAAGTTGAGAAGATTGCAGTTCAGCTCTGGAGAGCAGCCATCAGGAGGCCGTATCCACAACCTGAAGACA

>In-frame_PTPRR_ENST00000342084_chr12_71158445_-_C12orf54_ENST00000314014_chr12_48880471_+_423nt
ATGCAGTCAATTTCCAAACAGACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCA
GCTTTAGGACTCTTACCCCAGCAAGTGCACATCAATCGCCTCATTGAAAAACAGGTAACCATCACTGAAACCCTGTGGGACCAGGTGCTG
ACAGTTTTTAAGGATATACAAAAGGAGCTGCAGGAAGATGCTCGGATTCGAGGGATGAGCAACTGCTCCATGACACCCATGACATCAGCA
CCCAGGACTGGAAGCATAAGGCCTCCAGATTCCTTGATGACCCCAAAGTTGAGAAGATTGCAGTTCAGCTCTGGAGAGCAGCCATCAGGA

>In-frame_PTPRR_ENST00000342084_chr12_71158445_-_C12orf54_ENST00000548364_chr12_48880471_+_423nt
ATGCAGTCAATTTCCAAACAGACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCA
GCTTTAGGACTCTTACCCCAGCAAGTGCACATCAATCGCCTCATTGAAAAACAGGTAACCATCACTGAAACCCTGTGGGACCAGGTGCTG
ACAGTTTTTAAGGATATACAAAAGGAGCTGCAGGAAGATGCTCGGATTCGAGGGATGAGCAACTGCTCCATGACACCCATGACATCAGCA
CCCAGGACTGGAAGCATAAGGCCTCCAGATTCCTTGATGACCCCAAAGTTGAGAAGATTGCAGTTCAGCTCTGGAGAGCAGCCATCAGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPRR_ENST00000283228_chr12_71158445_-_C12orf54_ENST00000314014_chr12_48880471_+_1584nt
ACCACCCCAGCGATGGAGCCTACTCTGCTCCAAGCCGCCGCTAAGACCCGGAGAAGCGGAATTTCACTTTGAAATTCCCTTGCCTCGTGA
GGGCCGGCGCTGGGCATGCTCAGTAGCCGCGGCGCTGCTGCTGGGCTGCTGGGCTGGCGCGGAGTCCACCCTGCCGTCTCCGCCTTGGCT
TCTGGGCGTCCAGAAGGCCAGGCATTTGCCGCCTCTGAGCGCTTCTGTTCCCCTTACCCGCAACCTCCTACTGCTCTTCCTCTCTCCCTC
TCTTAGGGAGGTTGAAGCTGGTGCTGGTTTCTGTCGGCGCCACAGACTGACTGCTCTGCAAACCCCAGCCGAGGACCTGAATCCCGGAGA
CTAGAAGACCCTTGGCGGTGGCTCTTTCTAATAGCACTTTACCTGAAGTGGGGTCGTGGTGGAGTTTCTCCTCCACCTCTCAATGCAAAC
ACTATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGGGTGCTTTTCAGGAAACAATGATCATTTT
TTGGCAATTAATCAGAAGAAGAGTGGGAAGCCGGTATTCATTTATAAGCATTCACAAGACATTGAGAAGAGCCTGGATATAGCCCCACAA
AAAATCTACAGACATAGCTACCATTCCTCTTCCGAAGCTCAAGTAAGCAAACGCCACCAGATTGTCAATTCAGCATTTCCTAGACCCGCA
TATGACCCGTCTCTCAATCTGCTGGCCATGGATGGTCAAGATCTTGAAGTGGAAAATCTCCCAATCCCAGCAGCAAATGTAATTGTGGTG
ACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAG
CAAGTGCACATCAATCGCCTCATTGAAAAACAGGTAACCATCACTGAAACCCTGTGGGACCAGGTGCTGACAGTTTTTAAGGATATACAA
AAGGAGCTGCAGGAAGATGCTCGGATTCGAGGGATGAGCAACTGCTCCATGACACCCATGACATCAGCACCCAGGACTGGAAGCATAAGG
CCTCCAGATTCCTTGATGACCCCAAAGTTGAGAAGATTGCAGTTCAGCTCTGGAGAGCAGCCATCAGGAGGCCGTATCCACAACCTGAAG
ACACAGCTCTTCAGTCAATCAGCTTACTACCCTGGACCCTAACTCTACAATCAAGGAAGAAGGACATCTCTGCTTCCGCCAGCACAGCTT
CAGTTGGGGAAGATATTAGCAGACATCATCACTGAACCCAGAAGAGAGGGTGGTGCCCATGAGTGGAGATGCCAGGGTCTATGGCTGAAA
CTGGGAACTTGGAAATCAAGTGAGACCCAAGCAAGGAAACCAACTGCCAAAGCAAGGAAACCAGCTTGGTTTGGCAAACAGCTGATGAAA
TAAATGTGACGTAGAAGACTTGCCTTCCTGGTTCTTCCTGGGCTGTGGAATGGGTAGTGATAGAATTTCCAAGTATGATAGTGCATTTGG

>In-frame_PTPRR_ENST00000283228_chr12_71158445_-_C12orf54_ENST00000548364_chr12_48880471_+_1458nt
ACCACCCCAGCGATGGAGCCTACTCTGCTCCAAGCCGCCGCTAAGACCCGGAGAAGCGGAATTTCACTTTGAAATTCCCTTGCCTCGTGA
GGGCCGGCGCTGGGCATGCTCAGTAGCCGCGGCGCTGCTGCTGGGCTGCTGGGCTGGCGCGGAGTCCACCCTGCCGTCTCCGCCTTGGCT
TCTGGGCGTCCAGAAGGCCAGGCATTTGCCGCCTCTGAGCGCTTCTGTTCCCCTTACCCGCAACCTCCTACTGCTCTTCCTCTCTCCCTC
TCTTAGGGAGGTTGAAGCTGGTGCTGGTTTCTGTCGGCGCCACAGACTGACTGCTCTGCAAACCCCAGCCGAGGACCTGAATCCCGGAGA
CTAGAAGACCCTTGGCGGTGGCTCTTTCTAATAGCACTTTACCTGAAGTGGGGTCGTGGTGGAGTTTCTCCTCCACCTCTCAATGCAAAC
ACTATGCGGAGAGCAGTCTGCTTCCCTGCGCTGTGCCTGCTCCTTAATCTTCACGCTGCAGGGTGCTTTTCAGGAAACAATGATCATTTT
TTGGCAATTAATCAGAAGAAGAGTGGGAAGCCGGTATTCATTTATAAGCATTCACAAGACATTGAGAAGAGCCTGGATATAGCCCCACAA
AAAATCTACAGACATAGCTACCATTCCTCTTCCGAAGCTCAAGTAAGCAAACGCCACCAGATTGTCAATTCAGCATTTCCTAGACCCGCA
TATGACCCGTCTCTCAATCTGCTGGCCATGGATGGTCAAGATCTTGAAGTGGAAAATCTCCCAATCCCAGCAGCAAATGTAATTGTGGTG
ACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAG
CAAGTGCACATCAATCGCCTCATTGAAAAACAGGTAACCATCACTGAAACCCTGTGGGACCAGGTGCTGACAGTTTTTAAGGATATACAA
AAGGAGCTGCAGGAAGATGCTCGGATTCGAGGGATGAGCAACTGCTCCATGACACCCATGACATCAGCACCCAGGACTGGAAGCATAAGG
CCTCCAGATTCCTTGATGACCCCAAAGTTGAGAAGATTGCAGTTCAGCTCTGGAGAGCAGCCATCAGGAGGCCGTATCCACAACCTGAAG
ACACAGCTCTTCAGTCAATCAGCTTACTACCCTGGACCCTAACTCTACAATCAAGGAAGAAGGACATCTCTGCTTCCGCCAGCACAGCTT
CAGTTGGGGAAGATATTAGCAGACATCATCACTGAACCCAGAAGAGAGGGTGGTGCCCATGAGTGGAGATGCCAGGGTCTATGGCTGAAA
CTGGGAACTTGGAAATCAAGTGAGACCCAAGCAAGGAAACCAACTGCCAAAGCAAGGAAACCAGCTTGGTTTGGCAAACAGCTGATGAAA

>In-frame_PTPRR_ENST00000342084_chr12_71158445_-_C12orf54_ENST00000314014_chr12_48880471_+_941nt
AAACAGTACCAGGCGGTTACCTCCAGGTGACTAAATGAGGCTTCATCTCAGCACACAAGCTTAGAAAGCTTTACGATTAGTCCTGCTTGC
TATGGTAAGGAAATAACACAAAGAAGAGTGCAAATGGAAGTCGACTTCATCACAACATGCAGTCAATTTCCAAACAGACACTGCAAATGG
ATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAGCAAGTGCACATCA
ATCGCCTCATTGAAAAACAGGTAACCATCACTGAAACCCTGTGGGACCAGGTGCTGACAGTTTTTAAGGATATACAAAAGGAGCTGCAGG
AAGATGCTCGGATTCGAGGGATGAGCAACTGCTCCATGACACCCATGACATCAGCACCCAGGACTGGAAGCATAAGGCCTCCAGATTCCT
TGATGACCCCAAAGTTGAGAAGATTGCAGTTCAGCTCTGGAGAGCAGCCATCAGGAGGCCGTATCCACAACCTGAAGACACAGCTCTTCA
GTCAATCAGCTTACTACCCTGGACCCTAACTCTACAATCAAGGAAGAAGGACATCTCTGCTTCCGCCAGCACAGCTTCAGTTGGGGAAGA
TATTAGCAGACATCATCACTGAACCCAGAAGAGAGGGTGGTGCCCATGAGTGGAGATGCCAGGGTCTATGGCTGAAACTGGGAACTTGGA
AATCAAGTGAGACCCAAGCAAGGAAACCAACTGCCAAAGCAAGGAAACCAGCTTGGTTTGGCAAACAGCTGATGAAATAAATGTGACGTA
GAAGACTTGCCTTCCTGGTTCTTCCTGGGCTGTGGAATGGGTAGTGATAGAATTTCCAAGTATGATAGTGCATTTGGTTCAAAGAACAGC

>In-frame_PTPRR_ENST00000342084_chr12_71158445_-_C12orf54_ENST00000548364_chr12_48880471_+_815nt
AAACAGTACCAGGCGGTTACCTCCAGGTGACTAAATGAGGCTTCATCTCAGCACACAAGCTTAGAAAGCTTTACGATTAGTCCTGCTTGC
TATGGTAAGGAAATAACACAAAGAAGAGTGCAAATGGAAGTCGACTTCATCACAACATGCAGTCAATTTCCAAACAGACACTGCAAATGG
ATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAGCAAGTGCACATCA
ATCGCCTCATTGAAAAACAGGTAACCATCACTGAAACCCTGTGGGACCAGGTGCTGACAGTTTTTAAGGATATACAAAAGGAGCTGCAGG
AAGATGCTCGGATTCGAGGGATGAGCAACTGCTCCATGACACCCATGACATCAGCACCCAGGACTGGAAGCATAAGGCCTCCAGATTCCT
TGATGACCCCAAAGTTGAGAAGATTGCAGTTCAGCTCTGGAGAGCAGCCATCAGGAGGCCGTATCCACAACCTGAAGACACAGCTCTTCA
GTCAATCAGCTTACTACCCTGGACCCTAACTCTACAATCAAGGAAGAAGGACATCTCTGCTTCCGCCAGCACAGCTTCAGTTGGGGAAGA
TATTAGCAGACATCATCACTGAACCCAGAAGAGAGGGTGGTGCCCATGAGTGGAGATGCCAGGGTCTATGGCTGAAACTGGGAACTTGGA
AATCAAGTGAGACCCAAGCAAGGAAACCAACTGCCAAAGCAAGGAAACCAGCTTGGTTTGGCAAACAGCTGATGAAATAAATGTGACGTA


Top

FusionGenePPI for PTPRR_C12orf54


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPRRMAPK1, MAPK3, MAPK7, MAPK14, NTRK1, CEP290, EGFR, ERBB2, IGF1R, RET, MST1R, ERBB4, FGFR2, FGFR4, KDR, TEK, INSR, ALDH18A1, DHPS, PNMA2, TRIM11, KIAA0196, TBC1D5, DNAJC13, SNX6, PTPRR, MAPK1IP1L, MAPKAPK3, MAD2L1BP, CBS, MAPK11, CCT8L1P, HSPA4L, LMTK2, AATK, ERBB3, RYK, ROR1, ROR2, PTK7, EPHA2C12orf54


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPRR_C12orf54


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTPRR_C12orf54


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTPRRC0041696Unipolar Depression1PSYGENET
HgenePTPRRC1269683Major Depressive Disorder1PSYGENET