FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29517

FusionGeneSummary for PTPRG_FRMD4B

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPRG_FRMD4B
Fusion gene ID: 29517
HgeneTgene
Gene symbol

PTPRG

FRMD4B

Gene ID

5793

23150

Gene nameprotein tyrosine phosphatase, receptor type GFERM domain containing 4B
SynonymsHPTPG|PTPG|R-PTP-GAMMA|RPTPG6030440G05Rik|GRSP1
Cytomap

3p14.2

3p14.1

Type of geneprotein-codingprotein-coding
Descriptionreceptor-type tyrosine-protein phosphatase gammaH_RG317H01.1protein tyrosine phosphatase gammaprotein tyrosine phosphatase, receptor type, gamma polypeptidereceptor type protein tyrosine phosphatase gammareceptor tyrosine phosphatase gammareceptor-tFERM domain-containing protein 4BGRP1-binding protein GRSP1
Modification date2018052720180519
UniProtAcc

P23470

Q9Y2L6

Ensembl transtripts involved in fusion geneENST00000295874, ENST00000474889, 
ENST00000495879, 
ENST00000398540, 
ENST00000542259, ENST00000497757, 
ENST00000478263, 
Fusion gene scores* DoF score11 X 6 X 7=4629 X 7 X 8=504
# samples 1311
** MAII scorelog2(13/462*10)=-1.8293812283876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/504*10)=-2.19592020997526
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PTPRG [Title/Abstract] AND FRMD4B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-HC-A9TH-01APTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000295874ENST00000398540PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
In-frameENST00000295874ENST00000542259PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
5CDS-intronENST00000295874ENST00000497757PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
5CDS-intronENST00000295874ENST00000478263PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
In-frameENST00000474889ENST00000398540PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
In-frameENST00000474889ENST00000542259PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
5CDS-intronENST00000474889ENST00000497757PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
5CDS-intronENST00000474889ENST00000478263PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
3UTR-3CDSENST00000495879ENST00000398540PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
3UTR-3CDSENST00000495879ENST00000542259PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
3UTR-intronENST00000495879ENST00000497757PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-
3UTR-intronENST00000495879ENST00000478263PTPRGchr3

61734656

+FRMD4Bchr3

69225807

-

Top

FusionProtFeatures for PTPRG_FRMD4B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPRG

P23470

FRMD4B

Q9Y2L6

Possesses tyrosine phosphatase activity.{ECO:0000269|PubMed:19167335}. Member of GRP1 signaling complexes that are acutelyrecruited to plasma membrane ruffles in response to insulinreceptor signaling. May function as a scaffolding protein thatregulates epithelial cell polarity by connecting ARF6 activationwith the PAR3 complex. Plays a redundant role with FRMD4A inepithelial polarization. {ECO:0000250|UniProtKB:Q920B0}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPRGchr3:61734656chr3:69225807ENST00000295874+2291150_1410631417DomainTyrosine-protein phosphatase 2
HgenePTPRGchr3:61734656chr3:69225807ENST00000295874+229349_448631417DomainFibronectin type-III
HgenePTPRGchr3:61734656chr3:69225807ENST00000295874+22958_321631417DomainAlpha-carbonic anhydrase
HgenePTPRGchr3:61734656chr3:69225807ENST00000295874+229848_1119631417DomainTyrosine-protein phosphatase 1
HgenePTPRGchr3:61734656chr3:69225807ENST00000474889+2301150_1410631446DomainTyrosine-protein phosphatase 2
HgenePTPRGchr3:61734656chr3:69225807ENST00000474889+230349_448631446DomainFibronectin type-III
HgenePTPRGchr3:61734656chr3:69225807ENST00000474889+23058_321631446DomainAlpha-carbonic anhydrase
HgenePTPRGchr3:61734656chr3:69225807ENST00000474889+230848_1119631446DomainTyrosine-protein phosphatase 1
HgenePTPRGchr3:61734656chr3:69225807ENST00000295874+2291060_1066631417RegionSubstrate binding
HgenePTPRGchr3:61734656chr3:69225807ENST00000474889+2301060_1066631446RegionSubstrate binding
HgenePTPRGchr3:61734656chr3:69225807ENST00000295874+22920_736631417Topological domainExtracellular
HgenePTPRGchr3:61734656chr3:69225807ENST00000295874+229763_1445631417Topological domainCytoplasmic
HgenePTPRGchr3:61734656chr3:69225807ENST00000474889+23020_736631446Topological domainExtracellular
HgenePTPRGchr3:61734656chr3:69225807ENST00000474889+230763_1445631446Topological domainCytoplasmic
HgenePTPRGchr3:61734656chr3:69225807ENST00000295874+229737_762631417TransmembraneHelical
HgenePTPRGchr3:61734656chr3:69225807ENST00000474889+230737_762631446TransmembraneHelical
TgeneFRMD4Bchr3:61734656chr3:69225807ENST00000398540-2023417_4509501035Coiled coilOntology_term=ECO:0000255
TgeneFRMD4Bchr3:61734656chr3:69225807ENST00000398540-2023531_5619501035Coiled coilOntology_term=ECO:0000255
TgeneFRMD4Bchr3:61734656chr3:69225807ENST00000398540-202359_3619501035DomainFERM
TgeneFRMD4Bchr3:61734656chr3:69225807ENST00000398540-2023542_9719501035RegionNecessary for adherens junction and tight junction localization


Top

FusionGeneSequence for PTPRG_FRMD4B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPRG_ENST00000295874_chr3_61734656_+_FRMD4B_ENST00000398540_chr3_69225807_-_148aa
MRRLLEPCWWILFLKITSSVLHTVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSVSSTNASGNWRTQLTIGLSDYETPAHS

>In-frame_PTPRG_ENST00000295874_chr3_61734656_+_FRMD4B_ENST00000542259_chr3_69225807_-_148aa
MRRLLEPCWWILFLKITSSVLHTVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSVSSTNASGNWRTQLTIGLSDYETPAHS

>In-frame_PTPRG_ENST00000474889_chr3_61734656_+_FRMD4B_ENST00000398540_chr3_69225807_-_148aa
MRRLLEPCWWILFLKITSSVLHTVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSVSSTNASGNWRTQLTIGLSDYETPAHS

>In-frame_PTPRG_ENST00000474889_chr3_61734656_+_FRMD4B_ENST00000542259_chr3_69225807_-_148aa
MRRLLEPCWWILFLKITSSVLHTVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSVSSTNASGNWRTQLTIGLSDYETPAHS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPRG_ENST00000295874_chr3_61734656_+_FRMD4B_ENST00000398540_chr3_69225807_-_444nt
ATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCCGTGCTCCATTATGTCGTGTGCTTCCCCGCGTTG
ACAGAAGGCTACGTTGGGGCCCTGCACGAGAATAGACACGGCAGCGCAGTGCAGATCCGCAGGCGCAAGGCTTCAGGCGACCCGTACTGG
GCCTACTCTGTGTCTTCTACAAATGCTTCTGGGAACTGGAGGACCCAGTTAACCATAGGGCTGTCGGATTACGAGACTCCAGCACATTCT
TCTTACACCAGCTGCTATGGCAATGTCTATAATCCTTTACCCTCTCCAAGCAGACAATACACAGAAATCAGTCAACTGGATGGTACAGAT

>In-frame_PTPRG_ENST00000295874_chr3_61734656_+_FRMD4B_ENST00000542259_chr3_69225807_-_444nt
ATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCCGTGCTCCATTATGTCGTGTGCTTCCCCGCGTTG
ACAGAAGGCTACGTTGGGGCCCTGCACGAGAATAGACACGGCAGCGCAGTGCAGATCCGCAGGCGCAAGGCTTCAGGCGACCCGTACTGG
GCCTACTCTGTGTCTTCTACAAATGCTTCTGGGAACTGGAGGACCCAGTTAACCATAGGGCTGTCGGATTACGAGACTCCAGCACATTCT
TCTTACACCAGCTGCTATGGCAATGTCTATAATCCTTTACCCTCTCCAAGCAGACAATACACAGAAATCAGTCAACTGGATGGTACAGAT

>In-frame_PTPRG_ENST00000474889_chr3_61734656_+_FRMD4B_ENST00000398540_chr3_69225807_-_444nt
ATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCCGTGCTCCATTATGTCGTGTGCTTCCCCGCGTTG
ACAGAAGGCTACGTTGGGGCCCTGCACGAGAATAGACACGGCAGCGCAGTGCAGATCCGCAGGCGCAAGGCTTCAGGCGACCCGTACTGG
GCCTACTCTGTGTCTTCTACAAATGCTTCTGGGAACTGGAGGACCCAGTTAACCATAGGGCTGTCGGATTACGAGACTCCAGCACATTCT
TCTTACACCAGCTGCTATGGCAATGTCTATAATCCTTTACCCTCTCCAAGCAGACAATACACAGAAATCAGTCAACTGGATGGTACAGAT

>In-frame_PTPRG_ENST00000474889_chr3_61734656_+_FRMD4B_ENST00000542259_chr3_69225807_-_444nt
ATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCCGTGCTCCATTATGTCGTGTGCTTCCCCGCGTTG
ACAGAAGGCTACGTTGGGGCCCTGCACGAGAATAGACACGGCAGCGCAGTGCAGATCCGCAGGCGCAAGGCTTCAGGCGACCCGTACTGG
GCCTACTCTGTGTCTTCTACAAATGCTTCTGGGAACTGGAGGACCCAGTTAACCATAGGGCTGTCGGATTACGAGACTCCAGCACATTCT
TCTTACACCAGCTGCTATGGCAATGTCTATAATCCTTTACCCTCTCCAAGCAGACAATACACAGAAATCAGTCAACTGGATGGTACAGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPRG_ENST00000295874_chr3_61734656_+_FRMD4B_ENST00000398540_chr3_69225807_-_2692nt
CTCAAGTTGGGGATCCTCGGCTGCTCGCCGCCGCCGCCCGCGGTCCCTGCCTGCCCCAGGCCCGGGGCATCGCCGCCGGCCGCCGACTCC
GCGCCCTGCCCGATCGGCTCTCTCCTTTTTAAACGGAAAGCAGCCTTTCTCCGCCGAGAGGATCGTCCCCAGCGTGGCTCTGCGTTCCCG
GTCACTTTTTGAGATTTTCCGGGGGGCGCTCGGCGGCTTCCCGGATTCCAAGGGGACTCGGGCCGCCGAGCGCGGGGGGCCCGTGGAGCG
GGCGAGCCGGGGAAGCGCCCCGGCTTAGCGGAGGCTCGCACGGAGGCAAGAACTTATTCAACAAGTTTACCTCCCTGCTTTCCTCTTTTC
GATGTGCGTTTTCGGACATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCCGTGCTCCATTATGTCG
TGTGCTTCCCCGCGTTGACAGAAGGCTACGTTGGGGCCCTGCACGAGAATAGACACGGCAGCGCAGTGCAGATCCGCAGGCGCAAGGCTT
CAGGCGACCCGTACTGGGCCTACTCTGTGTCTTCTACAAATGCTTCTGGGAACTGGAGGACCCAGTTAACCATAGGGCTGTCGGATTACG
AGACTCCAGCACATTCTTCTTACACCAGCTGCTATGGCAATGTCTATAATCCTTTACCCTCTCCAAGCAGACAATACACAGAAATCAGTC
AACTGGATGGTACAGATGGAAACCAGCTGGAAGACAACCTGGAGAGTAGTGAGCAGAGACTCTTTTGGCATGAAGATTCAAAGCCTGGAA
CATTAGTCTGAACTGCAGTTGGACCTCCTGACCAAGCACTGCGTTCTCACACTAGTGTGCCTTGCAAATTGTATTTGTCTTCCGAGAGGA
TGTTCGTTTTAGAAACCTAAAGACATCAAAGGTTGAAGAGAAGACTTAGTTGCCCTGGAAGTGAATCAGTGAATCACACACCAAGCCCCA
CAAAGCCCCTAAAGGAGGATTTGGCCTTTCAAACTCTAGGCACTAACGTAACTGTAGGGTCTGCCCACATGTTGAAGTATTGCCAAGAGA
GGACTCAGTGTGAAGCCTTCATCAATAGCAAGCACTTTTTAAGGGAGTAAAAGTTGTTAAAGGCAAACCTCAAAAACATGAAAGGGCATT
CAGGATGTCCCATGGCAATAAGAACAGGGGAAATCTCAGAGCACAATTCAGCAGGATGAGAGAAGGGGAACCAGAAGCTCCGGAGTCATT
GCTCACTTCAGAGTTTGAATTCGTGAGCTGACAAAGAGTAACATGCTCTTTCTACACAGACATGGACAATTTAGACAGTATTGGAAAATT
ACTTGAAGCTGGATTTTCATGAAGTTCTGAATGAGTGTAAATGTTTTTTAGGATACTATAAAGAGTGATGTTTTTCATAAGCACCATAAA
ATGGGTTCTGGAAAAACTGATTACCTTAGCATCCTGTAATATAACTTATGGTAGCAGATTGGGGAAAATGAAGCAGCCCACTGAATAATT
GACAAAGTCTGCTTGGAGAACATTCTAAGGTACAATATCATGGAGCTCCTTTTTCCTTTCTCCACTAATTGCGTGATGAGCTATTGTTCT
GGCTGTTAATTCTCCAACTCGGCTGTCATTTGAAGTGGCAGACTTAATATGGAAAGTTTTTATAATTATGAGTTTGAAAAAGCATTTTAA
GATGATACAGAAAGTATCCAAAACAACAGAAAAAAAAAGCCACGTCATTTTAGATGAATTGCGTGCCTTAAAATGGTGAACGTTAGAAAA
TTAAACAAGTCTGGATTCCACAAGTAGTTCCAAGTCACCAAGTGACAAAAACAAGGTTAACATTAAAAAAGAAAAACAACAACAACGACA
AAAAGCTCCAAGCTGCAGTGGATTTAATTATGAGGCTAAAACTACCTCATACTTTCCTTGGAAGAACTAATTAGCTATGGTTTATTGTAG
GGTTTTGTTTGTTTGTTTTTTAAAGCAAATGATTTCCATATTCCAGATTGATCTTTTTTGTCATCTTTGCTTCAAAATTACATAAAAGGT
GCTCCTTTCCCCCTTCTTTTATACAAGTTTCTTGTTCATATTGTGAATAGAAAAGTTTCTGAACAACTTTTTTGGAACATTTTCTATCTA
TATTCCAAAGCATGTAATATATACATAAAAACGATTTGTTAAACTGGTCCTTAGTCATTTGTATAATTAGAAATGAAGTTTGGGAAAAAA
TTTTGGAAAAAAGACAAGCAAAAAAAAATAACTTATTCCTTTTTTGCATATTTGTATAGCCTTCTAGAATCAGAAATAACCTTTTTGCAT
ATTCTTTTATTGTTCTGACTTTTCAAGACCTATTATTTTTTTACATAGGTCAATAAACAAAAGGTGTGCTACTGAAAATGTTTACGTTTT
CTTCCATTTATGTCAGGGGTTCATGTGAAGCAGGTCGCAGTGCTCTACTTCAAGTAATCATATTGGGCAAGGCTTCGGATTTTTATTTAT
AGTATTACCGTATTTTATTAATTCCGGGATGTACATTTTTAAATATTTACATTAAAAACATGGTTCATCTTTTTATTGATGGCATATTCT

>In-frame_PTPRG_ENST00000295874_chr3_61734656_+_FRMD4B_ENST00000542259_chr3_69225807_-_2687nt
CTCAAGTTGGGGATCCTCGGCTGCTCGCCGCCGCCGCCCGCGGTCCCTGCCTGCCCCAGGCCCGGGGCATCGCCGCCGGCCGCCGACTCC
GCGCCCTGCCCGATCGGCTCTCTCCTTTTTAAACGGAAAGCAGCCTTTCTCCGCCGAGAGGATCGTCCCCAGCGTGGCTCTGCGTTCCCG
GTCACTTTTTGAGATTTTCCGGGGGGCGCTCGGCGGCTTCCCGGATTCCAAGGGGACTCGGGCCGCCGAGCGCGGGGGGCCCGTGGAGCG
GGCGAGCCGGGGAAGCGCCCCGGCTTAGCGGAGGCTCGCACGGAGGCAAGAACTTATTCAACAAGTTTACCTCCCTGCTTTCCTCTTTTC
GATGTGCGTTTTCGGACATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCCGTGCTCCATTATGTCG
TGTGCTTCCCCGCGTTGACAGAAGGCTACGTTGGGGCCCTGCACGAGAATAGACACGGCAGCGCAGTGCAGATCCGCAGGCGCAAGGCTT
CAGGCGACCCGTACTGGGCCTACTCTGTGTCTTCTACAAATGCTTCTGGGAACTGGAGGACCCAGTTAACCATAGGGCTGTCGGATTACG
AGACTCCAGCACATTCTTCTTACACCAGCTGCTATGGCAATGTCTATAATCCTTTACCCTCTCCAAGCAGACAATACACAGAAATCAGTC
AACTGGATGGTACAGATGGAAACCAGCTGGAAGACAACCTGGAGAGTAGTGAGCAGAGACTCTTTTGGCATGAAGATTCAAAGCCTGGAA
CATTAGTCTGAACTGCAGTTGGACCTCCTGACCAAGCACTGCGTTCTCACACTAGTGTGCCTTGCAAATTGTATTTGTCTTCCGAGAGGA
TGTTCGTTTTAGAAACCTAAAGACATCAAAGGTTGAAGAGAAGACTTAGTTGCCCTGGAAGTGAATCAGTGAATCACACACCAAGCCCCA
CAAAGCCCCTAAAGGAGGATTTGGCCTTTCAAACTCTAGGCACTAACGTAACTGTAGGGTCTGCCCACATGTTGAAGTATTGCCAAGAGA
GGACTCAGTGTGAAGCCTTCATCAATAGCAAGCACTTTTTAAGGGAGTAAAAGTTGTTAAAGGCAAACCTCAAAAACATGAAAGGGCATT
CAGGATGTCCCATGGCAATAAGAACAGGGGAAATCTCAGAGCACAATTCAGCAGGATGAGAGAAGGGGAACCAGAAGCTCCGGAGTCATT
GCTCACTTCAGAGTTTGAATTCGTGAGCTGACAAAGAGTAACATGCTCTTTCTACACAGACATGGACAATTTAGACAGTATTGGAAAATT
ACTTGAAGCTGGATTTTCATGAAGTTCTGAATGAGTGTAAATGTTTTTTAGGATACTATAAAGAGTGATGTTTTTCATAAGCACCATAAA
ATGGGTTCTGGAAAAACTGATTACCTTAGCATCCTGTAATATAACTTATGGTAGCAGATTGGGGAAAATGAAGCAGCCCACTGAATAATT
GACAAAGTCTGCTTGGAGAACATTCTAAGGTACAATATCATGGAGCTCCTTTTTCCTTTCTCCACTAATTGCGTGATGAGCTATTGTTCT
GGCTGTTAATTCTCCAACTCGGCTGTCATTTGAAGTGGCAGACTTAATATGGAAAGTTTTTATAATTATGAGTTTGAAAAAGCATTTTAA
GATGATACAGAAAGTATCCAAAACAACAGAAAAAAAAAGCCACGTCATTTTAGATGAATTGCGTGCCTTAAAATGGTGAACGTTAGAAAA
TTAAACAAGTCTGGATTCCACAAGTAGTTCCAAGTCACCAAGTGACAAAAACAAGGTTAACATTAAAAAAGAAAAACAACAACAACGACA
AAAAGCTCCAAGCTGCAGTGGATTTAATTATGAGGCTAAAACTACCTCATACTTTCCTTGGAAGAACTAATTAGCTATGGTTTATTGTAG
GGTTTTGTTTGTTTGTTTTTTAAAGCAAATGATTTCCATATTCCAGATTGATCTTTTTTGTCATCTTTGCTTCAAAATTACATAAAAGGT
GCTCCTTTCCCCCTTCTTTTATACAAGTTTCTTGTTCATATTGTGAATAGAAAAGTTTCTGAACAACTTTTTTGGAACATTTTCTATCTA
TATTCCAAAGCATGTAATATATACATAAAAACGATTTGTTAAACTGGTCCTTAGTCATTTGTATAATTAGAAATGAAGTTTGGGAAAAAA
TTTTGGAAAAAAGACAAGCAAAAAAAAATAACTTATTCCTTTTTTGCATATTTGTATAGCCTTCTAGAATCAGAAATAACCTTTTTGCAT
ATTCTTTTATTGTTCTGACTTTTCAAGACCTATTATTTTTTTACATAGGTCAATAAACAAAAGGTGTGCTACTGAAAATGTTTACGTTTT
CTTCCATTTATGTCAGGGGTTCATGTGAAGCAGGTCGCAGTGCTCTACTTCAAGTAATCATATTGGGCAAGGCTTCGGATTTTTATTTAT
AGTATTACCGTATTTTATTAATTCCGGGATGTACATTTTTAAATATTTACATTAAAAACATGGTTCATCTTTTTATTGATGGCATATTCT

>In-frame_PTPRG_ENST00000474889_chr3_61734656_+_FRMD4B_ENST00000398540_chr3_69225807_-_2692nt
CTCAAGTTGGGGATCCTCGGCTGCTCGCCGCCGCCGCCCGCGGTCCCTGCCTGCCCCAGGCCCGGGGCATCGCCGCCGGCCGCCGACTCC
GCGCCCTGCCCGATCGGCTCTCTCCTTTTTAAACGGAAAGCAGCCTTTCTCCGCCGAGAGGATCGTCCCCAGCGTGGCTCTGCGTTCCCG
GTCACTTTTTGAGATTTTCCGGGGGGCGCTCGGCGGCTTCCCGGATTCCAAGGGGACTCGGGCCGCCGAGCGCGGGGGGCCCGTGGAGCG
GGCGAGCCGGGGAAGCGCCCCGGCTTAGCGGAGGCTCGCACGGAGGCAAGAACTTATTCAACAAGTTTACCTCCCTGCTTTCCTCTTTTC
GATGTGCGTTTTCGGACATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCCGTGCTCCATTATGTCG
TGTGCTTCCCCGCGTTGACAGAAGGCTACGTTGGGGCCCTGCACGAGAATAGACACGGCAGCGCAGTGCAGATCCGCAGGCGCAAGGCTT
CAGGCGACCCGTACTGGGCCTACTCTGTGTCTTCTACAAATGCTTCTGGGAACTGGAGGACCCAGTTAACCATAGGGCTGTCGGATTACG
AGACTCCAGCACATTCTTCTTACACCAGCTGCTATGGCAATGTCTATAATCCTTTACCCTCTCCAAGCAGACAATACACAGAAATCAGTC
AACTGGATGGTACAGATGGAAACCAGCTGGAAGACAACCTGGAGAGTAGTGAGCAGAGACTCTTTTGGCATGAAGATTCAAAGCCTGGAA
CATTAGTCTGAACTGCAGTTGGACCTCCTGACCAAGCACTGCGTTCTCACACTAGTGTGCCTTGCAAATTGTATTTGTCTTCCGAGAGGA
TGTTCGTTTTAGAAACCTAAAGACATCAAAGGTTGAAGAGAAGACTTAGTTGCCCTGGAAGTGAATCAGTGAATCACACACCAAGCCCCA
CAAAGCCCCTAAAGGAGGATTTGGCCTTTCAAACTCTAGGCACTAACGTAACTGTAGGGTCTGCCCACATGTTGAAGTATTGCCAAGAGA
GGACTCAGTGTGAAGCCTTCATCAATAGCAAGCACTTTTTAAGGGAGTAAAAGTTGTTAAAGGCAAACCTCAAAAACATGAAAGGGCATT
CAGGATGTCCCATGGCAATAAGAACAGGGGAAATCTCAGAGCACAATTCAGCAGGATGAGAGAAGGGGAACCAGAAGCTCCGGAGTCATT
GCTCACTTCAGAGTTTGAATTCGTGAGCTGACAAAGAGTAACATGCTCTTTCTACACAGACATGGACAATTTAGACAGTATTGGAAAATT
ACTTGAAGCTGGATTTTCATGAAGTTCTGAATGAGTGTAAATGTTTTTTAGGATACTATAAAGAGTGATGTTTTTCATAAGCACCATAAA
ATGGGTTCTGGAAAAACTGATTACCTTAGCATCCTGTAATATAACTTATGGTAGCAGATTGGGGAAAATGAAGCAGCCCACTGAATAATT
GACAAAGTCTGCTTGGAGAACATTCTAAGGTACAATATCATGGAGCTCCTTTTTCCTTTCTCCACTAATTGCGTGATGAGCTATTGTTCT
GGCTGTTAATTCTCCAACTCGGCTGTCATTTGAAGTGGCAGACTTAATATGGAAAGTTTTTATAATTATGAGTTTGAAAAAGCATTTTAA
GATGATACAGAAAGTATCCAAAACAACAGAAAAAAAAAGCCACGTCATTTTAGATGAATTGCGTGCCTTAAAATGGTGAACGTTAGAAAA
TTAAACAAGTCTGGATTCCACAAGTAGTTCCAAGTCACCAAGTGACAAAAACAAGGTTAACATTAAAAAAGAAAAACAACAACAACGACA
AAAAGCTCCAAGCTGCAGTGGATTTAATTATGAGGCTAAAACTACCTCATACTTTCCTTGGAAGAACTAATTAGCTATGGTTTATTGTAG
GGTTTTGTTTGTTTGTTTTTTAAAGCAAATGATTTCCATATTCCAGATTGATCTTTTTTGTCATCTTTGCTTCAAAATTACATAAAAGGT
GCTCCTTTCCCCCTTCTTTTATACAAGTTTCTTGTTCATATTGTGAATAGAAAAGTTTCTGAACAACTTTTTTGGAACATTTTCTATCTA
TATTCCAAAGCATGTAATATATACATAAAAACGATTTGTTAAACTGGTCCTTAGTCATTTGTATAATTAGAAATGAAGTTTGGGAAAAAA
TTTTGGAAAAAAGACAAGCAAAAAAAAATAACTTATTCCTTTTTTGCATATTTGTATAGCCTTCTAGAATCAGAAATAACCTTTTTGCAT
ATTCTTTTATTGTTCTGACTTTTCAAGACCTATTATTTTTTTACATAGGTCAATAAACAAAAGGTGTGCTACTGAAAATGTTTACGTTTT
CTTCCATTTATGTCAGGGGTTCATGTGAAGCAGGTCGCAGTGCTCTACTTCAAGTAATCATATTGGGCAAGGCTTCGGATTTTTATTTAT
AGTATTACCGTATTTTATTAATTCCGGGATGTACATTTTTAAATATTTACATTAAAAACATGGTTCATCTTTTTATTGATGGCATATTCT

>In-frame_PTPRG_ENST00000474889_chr3_61734656_+_FRMD4B_ENST00000542259_chr3_69225807_-_2687nt
CTCAAGTTGGGGATCCTCGGCTGCTCGCCGCCGCCGCCCGCGGTCCCTGCCTGCCCCAGGCCCGGGGCATCGCCGCCGGCCGCCGACTCC
GCGCCCTGCCCGATCGGCTCTCTCCTTTTTAAACGGAAAGCAGCCTTTCTCCGCCGAGAGGATCGTCCCCAGCGTGGCTCTGCGTTCCCG
GTCACTTTTTGAGATTTTCCGGGGGGCGCTCGGCGGCTTCCCGGATTCCAAGGGGACTCGGGCCGCCGAGCGCGGGGGGCCCGTGGAGCG
GGCGAGCCGGGGAAGCGCCCCGGCTTAGCGGAGGCTCGCACGGAGGCAAGAACTTATTCAACAAGTTTACCTCCCTGCTTTCCTCTTTTC
GATGTGCGTTTTCGGACATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCCGTGCTCCATTATGTCG
TGTGCTTCCCCGCGTTGACAGAAGGCTACGTTGGGGCCCTGCACGAGAATAGACACGGCAGCGCAGTGCAGATCCGCAGGCGCAAGGCTT
CAGGCGACCCGTACTGGGCCTACTCTGTGTCTTCTACAAATGCTTCTGGGAACTGGAGGACCCAGTTAACCATAGGGCTGTCGGATTACG
AGACTCCAGCACATTCTTCTTACACCAGCTGCTATGGCAATGTCTATAATCCTTTACCCTCTCCAAGCAGACAATACACAGAAATCAGTC
AACTGGATGGTACAGATGGAAACCAGCTGGAAGACAACCTGGAGAGTAGTGAGCAGAGACTCTTTTGGCATGAAGATTCAAAGCCTGGAA
CATTAGTCTGAACTGCAGTTGGACCTCCTGACCAAGCACTGCGTTCTCACACTAGTGTGCCTTGCAAATTGTATTTGTCTTCCGAGAGGA
TGTTCGTTTTAGAAACCTAAAGACATCAAAGGTTGAAGAGAAGACTTAGTTGCCCTGGAAGTGAATCAGTGAATCACACACCAAGCCCCA
CAAAGCCCCTAAAGGAGGATTTGGCCTTTCAAACTCTAGGCACTAACGTAACTGTAGGGTCTGCCCACATGTTGAAGTATTGCCAAGAGA
GGACTCAGTGTGAAGCCTTCATCAATAGCAAGCACTTTTTAAGGGAGTAAAAGTTGTTAAAGGCAAACCTCAAAAACATGAAAGGGCATT
CAGGATGTCCCATGGCAATAAGAACAGGGGAAATCTCAGAGCACAATTCAGCAGGATGAGAGAAGGGGAACCAGAAGCTCCGGAGTCATT
GCTCACTTCAGAGTTTGAATTCGTGAGCTGACAAAGAGTAACATGCTCTTTCTACACAGACATGGACAATTTAGACAGTATTGGAAAATT
ACTTGAAGCTGGATTTTCATGAAGTTCTGAATGAGTGTAAATGTTTTTTAGGATACTATAAAGAGTGATGTTTTTCATAAGCACCATAAA
ATGGGTTCTGGAAAAACTGATTACCTTAGCATCCTGTAATATAACTTATGGTAGCAGATTGGGGAAAATGAAGCAGCCCACTGAATAATT
GACAAAGTCTGCTTGGAGAACATTCTAAGGTACAATATCATGGAGCTCCTTTTTCCTTTCTCCACTAATTGCGTGATGAGCTATTGTTCT
GGCTGTTAATTCTCCAACTCGGCTGTCATTTGAAGTGGCAGACTTAATATGGAAAGTTTTTATAATTATGAGTTTGAAAAAGCATTTTAA
GATGATACAGAAAGTATCCAAAACAACAGAAAAAAAAAGCCACGTCATTTTAGATGAATTGCGTGCCTTAAAATGGTGAACGTTAGAAAA
TTAAACAAGTCTGGATTCCACAAGTAGTTCCAAGTCACCAAGTGACAAAAACAAGGTTAACATTAAAAAAGAAAAACAACAACAACGACA
AAAAGCTCCAAGCTGCAGTGGATTTAATTATGAGGCTAAAACTACCTCATACTTTCCTTGGAAGAACTAATTAGCTATGGTTTATTGTAG
GGTTTTGTTTGTTTGTTTTTTAAAGCAAATGATTTCCATATTCCAGATTGATCTTTTTTGTCATCTTTGCTTCAAAATTACATAAAAGGT
GCTCCTTTCCCCCTTCTTTTATACAAGTTTCTTGTTCATATTGTGAATAGAAAAGTTTCTGAACAACTTTTTTGGAACATTTTCTATCTA
TATTCCAAAGCATGTAATATATACATAAAAACGATTTGTTAAACTGGTCCTTAGTCATTTGTATAATTAGAAATGAAGTTTGGGAAAAAA
TTTTGGAAAAAAGACAAGCAAAAAAAAATAACTTATTCCTTTTTTGCATATTTGTATAGCCTTCTAGAATCAGAAATAACCTTTTTGCAT
ATTCTTTTATTGTTCTGACTTTTCAAGACCTATTATTTTTTTACATAGGTCAATAAACAAAAGGTGTGCTACTGAAAATGTTTACGTTTT
CTTCCATTTATGTCAGGGGTTCATGTGAAGCAGGTCGCAGTGCTCTACTTCAAGTAATCATATTGGGCAAGGCTTCGGATTTTTATTTAT
AGTATTACCGTATTTTATTAATTCCGGGATGTACATTTTTAAATATTTACATTAAAAACATGGTTCATCTTTTTATTGATGGCATATTCT


Top

FusionGenePPI for PTPRG_FRMD4B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPRGDLG4, PTPRG, LGALS8, FYTTD1, FCN1, TMEM185A, CCNL2, DUSP26, PTPRB, SEC24A, FCHO2, CEP89, CDC42BPB, FAM129B, PSD3, PALM, CASKIN2, HSPA12A, GPRIN1, NF2, RPS15, CLNS1A, SLC39A10, ADD2, FARP1, GJB7, SDC1, DUS4L, MED21, PCDHGC3, DUSP22, ISG20, SERPINA12, ZNF517, ACBD7, NCSTN, NPB, SCGB2A2, CLCC1, DUSP23, DEFB104A, IER3IP1, PACS1, PTPRAFRMD4BXPO1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPRG_FRMD4B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTPRG_FRMD4B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTPRGC0038356Stomach Neoplasms1CTD_human