FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29473

FusionGeneSummary for PTPN9_SLC12A1

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPN9_SLC12A1
Fusion gene ID: 29473
HgeneTgene
Gene symbol

PTPN9

SLC12A1

Gene ID

5780

6557

Gene nameprotein tyrosine phosphatase, non-receptor type 9solute carrier family 12 member 1
SynonymsMEG2|PTPMEG2BSC1|NKCC2
Cytomap

15q24.2

15q21.1

Type of geneprotein-codingprotein-coding
Descriptiontyrosine-protein phosphatase non-receptor type 9PTPase-MEG2protein-tyrosine phosphatase MEG2solute carrier family 12 member 1NKCC2A variant ANa-K-2Cl cotransporterbumetanide-sensitive sodium-(potassium)-chloride cotransporter 2kidney-specific Na-K-Cl symportersolute carrier family 12 (sodium/potassium/chloride transporter), member 1solute
Modification date2018052020180523
UniProtAcc

P43378

Q13621

Ensembl transtripts involved in fusion geneENST00000306726, ENST00000564970, 
ENST00000380993, ENST00000396577, 
ENST00000330289, ENST00000558405, 
ENST00000561031, ENST00000559723, 
Fusion gene scores* DoF score8 X 6 X 7=3363 X 3 X 2=18
# samples 133
** MAII scorelog2(13/336*10)=-1.36994960975031
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PTPN9 [Title/Abstract] AND SLC12A1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePTPN9

GO:0010977

negative regulation of neuron projection development

27655914

HgenePTPN9

GO:0035335

peptidyl-tyrosine dephosphorylation

27655914

HgenePTPN9

GO:1903078

positive regulation of protein localization to plasma membrane

27655914


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A8BM-01APTPN9chr15

75871055

-SLC12A1chr15

48539534

+
TCGALDSARCTCGA-DX-A8BM-01APTPN9chr15

75871055

-SLC12A1chr15

48541772

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000306726ENST00000380993PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
In-frameENST00000306726ENST00000396577PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
5CDS-intronENST00000306726ENST00000330289PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
5CDS-intronENST00000306726ENST00000558405PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
5CDS-intronENST00000306726ENST00000561031PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
5CDS-intronENST00000306726ENST00000559723PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
intron-3CDSENST00000564970ENST00000380993PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
intron-3CDSENST00000564970ENST00000396577PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
intron-intronENST00000564970ENST00000330289PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
intron-intronENST00000564970ENST00000558405PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
intron-intronENST00000564970ENST00000561031PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
intron-intronENST00000564970ENST00000559723PTPN9chr15

75871055

-SLC12A1chr15

48539534

+
Frame-shitENST00000306726ENST00000380993PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
Frame-shitENST00000306726ENST00000396577PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
5CDS-intronENST00000306726ENST00000330289PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
5CDS-intronENST00000306726ENST00000558405PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
5CDS-intronENST00000306726ENST00000561031PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
5CDS-intronENST00000306726ENST00000559723PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
intron-3CDSENST00000564970ENST00000380993PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
intron-3CDSENST00000564970ENST00000396577PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
intron-intronENST00000564970ENST00000330289PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
intron-intronENST00000564970ENST00000558405PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
intron-intronENST00000564970ENST00000561031PTPN9chr15

75871055

-SLC12A1chr15

48541772

+
intron-intronENST00000564970ENST00000559723PTPN9chr15

75871055

-SLC12A1chr15

48541772

+

Top

FusionProtFeatures for PTPN9_SLC12A1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPN9

P43378

SLC12A1

Q13621

Protein-tyrosine phosphatase that could participate inthe transfer of hydrophobic ligands or in functions of the Golgiapparatus. {ECO:0000269|PubMed:19167335}. Electrically silent transporter system. Mediates sodiumand chloride reabsorption. Plays a vital role in the regulation ofionic balance and cell volume.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127593_6095201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127814_10995201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026593_6095201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026814_10995201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127551_5715201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127572_5925201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127610_6305201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127793_8135201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026551_5715201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026572_5925201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026610_6305201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026793_8135201100TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPN9chr15:75871055chr15:48539534ENST00000306726-113303_57421594DomainTyrosine-protein phosphatase
HgenePTPN9chr15:75871055chr15:48539534ENST00000306726-11384_24321594DomainCRAL-TRIO
HgenePTPN9chr15:75871055chr15:48539534ENST00000306726-113515_52121594RegionSubstrate binding
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+11271_1775201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127223_2595201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127324_3275201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127401_4175201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127506_5505201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+10261_1775201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026223_2595201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026324_3275201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026401_4175201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026506_5505201100Topological domainCytoplasmic
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127178_1985201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127202_2225201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127260_2805201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127303_3235201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127328_3485201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127380_4005201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127418_4385201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000380993+1127485_5055201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026178_1985201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026202_2225201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026260_2805201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026303_3235201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026328_3485201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026380_4005201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026418_4385201100TransmembraneHelical
TgeneSLC12A1chr15:75871055chr15:48539534ENST00000558405+1026485_5055201100TransmembraneHelical


Top

FusionGeneSequence for PTPN9_SLC12A1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SLC12A1_ENST00000380993_chr15_48539534_+_601aa
MEPATAPRPDMAPELTPEEEQALCKDNIYKALQFFAKGTGKNNEPLRGTILTFLIAMAFILIAELNTIAPIISNFFLASTALINFSCFHA
STAKSPGWRPATGIYNMWVSLFGAVLCCAVMFVINWWAAVITTVIEFFLYVTVTCKKPDVNWGSSTQALSYVSALDNALELTTVEDHVKN
FRPQCIVLTGGPMTRPALLDITHAFTKNSGLCICCEVFVGPRKLCVKEMNSGMAKKQAWLIKNKIKAFTAAVAADCFRDGVRSLLQASGL
GRMKPNTLVIGTKKNWRKAPLTEIENYVGIIHDAFDFEIGVVIVRISQGFDISQVLQVQEELERLEQERLALEATIKDNECEEESGGIRG
LFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEASTQFKKKQEKGTIDVWWLFDDGGLTLLIPTILTLRKKWKDCKLRITVGGKI
NRIEEEKIVMASLLSKFRIKFADIHIIGDINIRPNKESWKVFEEMIEPTRLHESCKDLTTAEKLKRETPWKITDAELEAVKEKSYRQVRL

>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SLC12A1_ENST00000396577_chr15_48539534_+_601aa
MEPATAPRPDMAPELTPEEEQALCKDNIYKALQFFAKGTGKNNEPLRGTILTFLIAMAFILIAELNTIAPIISNFFLASTALINFSCFHA
STAKSPGWRPATGIYNMWVSLFGAVLCCAVMFVINWWAAVITTVIEFFLYVTVTCKKPDVNWGSSTQALSYVSALDNALELTTVEDHVKN
FRPQCIVLTGGPMTRPALLDITHAFTKNSGLCICCEVFVGPRKLCVKEMNSGMAKKQAWLIKNKIKAFTAAVAADCFRDGVRSLLQASGL
GRMKPNTLVIGTKKNWRKAPLTEIENYVGIIHDAFDFEIGVVIVRISQGFDISQVLQVQEELERLEQERLALEATIKDNECEEESGGIRG
LFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEASTQFKKKQEKGTIDVWWLFDDGGLTLLIPTILTLRKKWKDCKLRITVGGKI
NRIEEEKIVMASLLSKFRIKFADIHIIGDINIRPNKESWKVFEEMIEPTRLHESCKDLTTAEKLKRETPWKITDAELEAVKEKSYRQVRL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SLC12A1_ENST00000380993_chr15_48539534_+_1803nt
ATGGAGCCCGCGACCGCGCCCCGGCCCGACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGCTCTGTGCAAGGACAACATCTACAAA
GCCCTGCAGTTTTTTGCAAAGGGATATGGGAAAAACAATGAACCCCTGAGAGGATATATTCTCACTTTTCTTATAGCCATGGCATTTATT
CTTATTGCGGAACTGAACACCATTGCTCCCATCATCTCCAACTTTTTCCTGGCCTCATATGCACTTATTAATTTCTCCTGCTTCCATGCC
TCTTATGCCAAATCTCCAGGATGGAGACCTGCGTATGGAATTTACAACATGTGGGTATCTCTTTTTGGAGCTGTTTTGTGCTGTGCAGTC
ATGTTTGTCATCAACTGGTGGGCAGCTGTCATCACCTATGTCATTGAATTCTTCCTTTACGTCTATGTGACTTGTAAGAAGCCAGATGTG
AACTGGGGCTCCTCCACACAGGCTCTTTCCTACGTGAGTGCTTTAGACAATGCTCTGGAATTAACCACAGTGGAAGACCACGTAAAAAAC
TTCAGGCCCCAGTGCATTGTCTTAACAGGGGGACCCATGACAAGACCTGCTCTCCTGGACATAACTCACGCCTTTACCAAGAACAGTGGC
CTTTGCATCTGCTGTGAAGTCTTTGTGGGACCGCGCAAACTGTGTGTTAAGGAGATGAACAGTGGCATGGCGAAAAAACAGGCCTGGCTT
ATAAAGAACAAAATCAAGGCTTTTTATGCTGCAGTGGCGGCAGACTGTTTCAGGGATGGTGTCCGAAGTCTTCTTCAGGCCTCAGGCTTA
GGAAGAATGAAACCAAACACTCTGGTGATTGGATATAAGAAAAACTGGAGGAAAGCTCCCTTGACAGAGATTGAGAACTACGTGGGAATC
ATACATGATGCATTTGATTTTGAGATTGGCGTGGTTATAGTCAGAATCAGCCAAGGATTTGACATCTCTCAGGTTCTTCAGGTGCAAGAG
GAATTAGAGAGATTAGAACAGGAGAGACTAGCATTGGAAGCGACTATCAAAGATAATGAGTGTGAAGAGGAAAGTGGAGGCATCCGAGGC
TTGTTTAAAAAAGCTGGCAAGTTGAACATTACTAAGACAACGCCTAAAAAAGATGGCAGCATTAACACAAGCCAGTCGATGCATGTGGGA
GAGTTCAACCAGAAACTGGTGGAAGCCAGCACTCAATTTAAAAAGAAACAAGAAAAAGGCACAATTGATGTTTGGTGGTTGTTTGATGAT
GGAGGGTTAACACTTCTTATCCCCTATATCTTAACTCTCAGAAAAAAATGGAAAGACTGTAAATTAAGAATCTATGTGGGAGGGAAGATC
AACCGCATTGAAGAAGAAAAAATTGTAATGGCTTCCCTTCTGAGCAAATTTAGGATAAAATTTGCAGACATCCATATCATCGGTGACATC
AACATTAGGCCAAACAAAGAGAGCTGGAAAGTCTTTGAAGAGATGATTGAACCATATCGTCTCCATGAAAGCTGCAAAGATTTAACAACT
GCTGAGAAATTAAAAAGAGAAACTCCGTGGAAAATTACAGATGCAGAACTGGAAGCAGTCAAGGAAAAGAGTTACCGCCAAGTTCGACTG
AATGAACTCTTACAGGAGCACTCCAGAGCTGCTAATCTCATTGTCCTGAGCCTTCCCGTGGCAAGAAAGGGATCCATATCGGATTTGTTG
TATATGGCTTGGTTGGAAATCCTCACAAAGAACCTCCCACCTGTCTTACTAGTTAGAGGAAATCACAAAAATGTCTTGACATTTTACTCT

>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SLC12A1_ENST00000396577_chr15_48539534_+_1803nt
ATGGAGCCCGCGACCGCGCCCCGGCCCGACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGCTCTGTGCAAGGACAACATCTACAAA
GCCCTGCAGTTTTTTGCAAAGGGATATGGGAAAAACAATGAACCCCTGAGAGGATATATTCTCACTTTTCTTATAGCCATGGCATTTATT
CTTATTGCGGAACTGAACACCATTGCTCCCATCATCTCCAACTTTTTCCTGGCCTCATATGCACTTATTAATTTCTCCTGCTTCCATGCC
TCTTATGCCAAATCTCCAGGATGGAGACCTGCGTATGGAATTTACAACATGTGGGTATCTCTTTTTGGAGCTGTTTTGTGCTGTGCAGTC
ATGTTTGTCATCAACTGGTGGGCAGCTGTCATCACCTATGTCATTGAATTCTTCCTTTACGTCTATGTGACTTGTAAGAAGCCAGATGTG
AACTGGGGCTCCTCCACACAGGCTCTTTCCTACGTGAGTGCTTTAGACAATGCTCTGGAATTAACCACAGTGGAAGACCACGTAAAAAAC
TTCAGGCCCCAGTGCATTGTCTTAACAGGGGGACCCATGACAAGACCTGCTCTCCTGGACATAACTCACGCCTTTACCAAGAACAGTGGC
CTTTGCATCTGCTGTGAAGTCTTTGTGGGACCGCGCAAACTGTGTGTTAAGGAGATGAACAGTGGCATGGCGAAAAAACAGGCCTGGCTT
ATAAAGAACAAAATCAAGGCTTTTTATGCTGCAGTGGCGGCAGACTGTTTCAGGGATGGTGTCCGAAGTCTTCTTCAGGCCTCAGGCTTA
GGAAGAATGAAACCAAACACTCTGGTGATTGGATATAAGAAAAACTGGAGGAAAGCTCCCTTGACAGAGATTGAGAACTACGTGGGAATC
ATACATGATGCATTTGATTTTGAGATTGGCGTGGTTATAGTCAGAATCAGCCAAGGATTTGACATCTCTCAGGTTCTTCAGGTGCAAGAG
GAATTAGAGAGATTAGAACAGGAGAGACTAGCATTGGAAGCGACTATCAAAGATAATGAGTGTGAAGAGGAAAGTGGAGGCATCCGAGGC
TTGTTTAAAAAAGCTGGCAAGTTGAACATTACTAAGACAACGCCTAAAAAAGATGGCAGCATTAACACAAGCCAGTCGATGCATGTGGGA
GAGTTCAACCAGAAACTGGTGGAAGCCAGCACTCAATTTAAAAAGAAACAAGAAAAAGGCACAATTGATGTTTGGTGGTTGTTTGATGAT
GGAGGGTTAACACTTCTTATCCCCTATATCTTAACTCTCAGAAAAAAATGGAAAGACTGTAAATTAAGAATCTATGTGGGAGGGAAGATC
AACCGCATTGAAGAAGAAAAAATTGTAATGGCTTCCCTTCTGAGCAAATTTAGGATAAAATTTGCAGACATCCATATCATCGGTGACATC
AACATTAGGCCAAACAAAGAGAGCTGGAAAGTCTTTGAAGAGATGATTGAACCATATCGTCTCCATGAAAGCTGCAAAGATTTAACAACT
GCTGAGAAATTAAAAAGAGAAACTCCGTGGAAAATTACAGATGCAGAACTGGAAGCAGTCAAGGAAAAGAGTTACCGCCAAGTTCGACTG
AATGAACTCTTACAGGAGCACTCCAGAGCTGCTAATCTCATTGTCCTGAGCCTTCCCGTGGCAAGAAAGGGATCCATATCGGATTTGTTG
TATATGGCTTGGTTGGAAATCCTCACAAAGAACCTCCCACCTGTCTTACTAGTTAGAGGAAATCACAAAAATGTCTTGACATTTTACTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SLC12A1_ENST00000380993_chr15_48539534_+_3507nt
AGCCTGGCTGAGGCAGCCGCGCAGGTCGCAGGGCCAGCGTCCGCGAGGACGGCCCGGCTGGGCGGCCCCGAGCTCTGTGGCGCTGTGGAG
GAGCGGGAGCGCGGCCGAGGAAGCGGGGCGCCGAGGGGGTCGGCGGCCTTCGGGAAATTTCCGCCGACCCTTCGCTCCCGGCTCTAAAAG
TTCCTGATTTCCTATTTCCTTTTAAATCCCGAGTGGCTGTTAGCTCTTCGCCTGCACTTTTTCTTCCCCAGGAGATAAGGGGGAGTGTGA
GGAACGGAGCGAATAATATAAAAAAGGATTTCCTCCCGGAAGAGAGCGGCAGTTCGGAGAGATTTTTCTTAAGGAAGCAGAAGCGGCGTT
TGCGGCCGCTGCAGGCGCCGGGCCCTGCCGGCCACACTATGCGCGAGCCGGCCCCGGGCTGCTGAGGCGCGGGGACGCGGAAGCGGAGGC
CGAGCGCGCCGGGCTCCCGCGCTCGCGAGCGAGTTTTGTCCGCCCGGCGGCGGTGGCGGGGGGATGGAGCCCGCGACCGCGCCCCGGCCC
GACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGCTCTGTGCAAGGACAACATCTACAAAGCCCTGCAGTTTTTTGCAAAGGGATAT
GGGAAAAACAATGAACCCCTGAGAGGATATATTCTCACTTTTCTTATAGCCATGGCATTTATTCTTATTGCGGAACTGAACACCATTGCT
CCCATCATCTCCAACTTTTTCCTGGCCTCATATGCACTTATTAATTTCTCCTGCTTCCATGCCTCTTATGCCAAATCTCCAGGATGGAGA
CCTGCGTATGGAATTTACAACATGTGGGTATCTCTTTTTGGAGCTGTTTTGTGCTGTGCAGTCATGTTTGTCATCAACTGGTGGGCAGCT
GTCATCACCTATGTCATTGAATTCTTCCTTTACGTCTATGTGACTTGTAAGAAGCCAGATGTGAACTGGGGCTCCTCCACACAGGCTCTT
TCCTACGTGAGTGCTTTAGACAATGCTCTGGAATTAACCACAGTGGAAGACCACGTAAAAAACTTCAGGCCCCAGTGCATTGTCTTAACA
GGGGGACCCATGACAAGACCTGCTCTCCTGGACATAACTCACGCCTTTACCAAGAACAGTGGCCTTTGCATCTGCTGTGAAGTCTTTGTG
GGACCGCGCAAACTGTGTGTTAAGGAGATGAACAGTGGCATGGCGAAAAAACAGGCCTGGCTTATAAAGAACAAAATCAAGGCTTTTTAT
GCTGCAGTGGCGGCAGACTGTTTCAGGGATGGTGTCCGAAGTCTTCTTCAGGCCTCAGGCTTAGGAAGAATGAAACCAAACACTCTGGTG
ATTGGATATAAGAAAAACTGGAGGAAAGCTCCCTTGACAGAGATTGAGAACTACGTGGGAATCATACATGATGCATTTGATTTTGAGATT
GGCGTGGTTATAGTCAGAATCAGCCAAGGATTTGACATCTCTCAGGTTCTTCAGGTGCAAGAGGAATTAGAGAGATTAGAACAGGAGAGA
CTAGCATTGGAAGCGACTATCAAAGATAATGAGTGTGAAGAGGAAAGTGGAGGCATCCGAGGCTTGTTTAAAAAAGCTGGCAAGTTGAAC
ATTACTAAGACAACGCCTAAAAAAGATGGCAGCATTAACACAAGCCAGTCGATGCATGTGGGAGAGTTCAACCAGAAACTGGTGGAAGCC
AGCACTCAATTTAAAAAGAAACAAGAAAAAGGCACAATTGATGTTTGGTGGTTGTTTGATGATGGAGGGTTAACACTTCTTATCCCCTAT
ATCTTAACTCTCAGAAAAAAATGGAAAGACTGTAAATTAAGAATCTATGTGGGAGGGAAGATCAACCGCATTGAAGAAGAAAAAATTGTA
ATGGCTTCCCTTCTGAGCAAATTTAGGATAAAATTTGCAGACATCCATATCATCGGTGACATCAACATTAGGCCAAACAAAGAGAGCTGG
AAAGTCTTTGAAGAGATGATTGAACCATATCGTCTCCATGAAAGCTGCAAAGATTTAACAACTGCTGAGAAATTAAAAAGAGAAACTCCG
TGGAAAATTACAGATGCAGAACTGGAAGCAGTCAAGGAAAAGAGTTACCGCCAAGTTCGACTGAATGAACTCTTACAGGAGCACTCCAGA
GCTGCTAATCTCATTGTCCTGAGCCTTCCCGTGGCAAGAAAGGGATCCATATCGGATTTGTTGTATATGGCTTGGTTGGAAATCCTCACA
AAGAACCTCCCACCTGTCTTACTAGTTAGAGGAAATCACAAAAATGTCTTGACATTTTACTCTTAAAACATGAAAGATTGGAATACATTT
TAACTTAATGTAATGCATAATTAAGAAACATGTTCCAGTACTTTATGTTGTAAATCTGATCTATGGATATGCAAACCTCTGGAGAGGATC
CTACCAGATTCTACATACATTGCATAATTTTTATCAGTTAATGCGAGCTTTTTTTTCTCTTCTCAGCTTAAGGGGTTGTCAAAGCCAATG
TTATCCCTAGAAAAACATTTTTGTCACTGCTGTTGATAAACAAGAAAATCAAGGAAACTCATGTTGGCTTATGCTCATGAAAACCACCAA
TGTGATTGTAAACTTCTCCAGACAAACTTAACCTTTTGTTTCTTAATTTTTTGTTTTGAGTGTTTGCTTCTCAGCCCTGGTATAGGTCTC
AGCCCCACAGCAGGATCTCAATAAATGCTTATTGACAGGCTGGCATAGTAACCACAGGTGGTTATCAAAGGAAAAGACCAATAGGCTGGG
GAACATAATTATGCTTGGCCCCCTCAGAGGCTTATACCTCCAAAGCAGATTTAAAAATCAGTAACTCAAAACTTTAAGAAGTAGTTGAGT
CTACAAAATATTCAAAGCAGTTACCTAAATAAGGTTATTTAATGTAACAGATTATATACTTAAAGTGATCTGAGCAATCATTGATAACAT
ATGGCTTAAATTTGCTGCTGCCTGAAAAGTATATTAACTAGATTAGAAGACACCATATACTCCAATAAAATGAAATATATTCTATTCTCA
ATATATAAACTTTAATTGTACTCCCTATCAAATATTTTGAAATTTCCATCACGGCATTACTTTGCATATTTTTTTCTAATTAAATGGTTA
GTACAGATGAAATCTTTATAGATGACTACTTGAAAACTAAGTGCTACAAATTTTCAAACCATTATTAAGAAATATATCCTGAATCATATA
TTTAGTTACTTTCTATAGTGATTGTATGGATTTAAAAGAATAATTAAAATGTGAAGTTGAAAAACTTGTAAAATTTGGAATATACAGATA
CTGATTTTTTTCATTTTTGTTAGTATACCTATAATACATAATCACATTGACAAACCAATGAAAATATTGATTTTCTGATGAATGGCTTGA

>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SLC12A1_ENST00000396577_chr15_48539534_+_3509nt
AGCCTGGCTGAGGCAGCCGCGCAGGTCGCAGGGCCAGCGTCCGCGAGGACGGCCCGGCTGGGCGGCCCCGAGCTCTGTGGCGCTGTGGAG
GAGCGGGAGCGCGGCCGAGGAAGCGGGGCGCCGAGGGGGTCGGCGGCCTTCGGGAAATTTCCGCCGACCCTTCGCTCCCGGCTCTAAAAG
TTCCTGATTTCCTATTTCCTTTTAAATCCCGAGTGGCTGTTAGCTCTTCGCCTGCACTTTTTCTTCCCCAGGAGATAAGGGGGAGTGTGA
GGAACGGAGCGAATAATATAAAAAAGGATTTCCTCCCGGAAGAGAGCGGCAGTTCGGAGAGATTTTTCTTAAGGAAGCAGAAGCGGCGTT
TGCGGCCGCTGCAGGCGCCGGGCCCTGCCGGCCACACTATGCGCGAGCCGGCCCCGGGCTGCTGAGGCGCGGGGACGCGGAAGCGGAGGC
CGAGCGCGCCGGGCTCCCGCGCTCGCGAGCGAGTTTTGTCCGCCCGGCGGCGGTGGCGGGGGGATGGAGCCCGCGACCGCGCCCCGGCCC
GACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGCTCTGTGCAAGGACAACATCTACAAAGCCCTGCAGTTTTTTGCAAAGGGATAT
GGGAAAAACAATGAACCCCTGAGAGGATATATTCTCACTTTTCTTATAGCCATGGCATTTATTCTTATTGCGGAACTGAACACCATTGCT
CCCATCATCTCCAACTTTTTCCTGGCCTCATATGCACTTATTAATTTCTCCTGCTTCCATGCCTCTTATGCCAAATCTCCAGGATGGAGA
CCTGCGTATGGAATTTACAACATGTGGGTATCTCTTTTTGGAGCTGTTTTGTGCTGTGCAGTCATGTTTGTCATCAACTGGTGGGCAGCT
GTCATCACCTATGTCATTGAATTCTTCCTTTACGTCTATGTGACTTGTAAGAAGCCAGATGTGAACTGGGGCTCCTCCACACAGGCTCTT
TCCTACGTGAGTGCTTTAGACAATGCTCTGGAATTAACCACAGTGGAAGACCACGTAAAAAACTTCAGGCCCCAGTGCATTGTCTTAACA
GGGGGACCCATGACAAGACCTGCTCTCCTGGACATAACTCACGCCTTTACCAAGAACAGTGGCCTTTGCATCTGCTGTGAAGTCTTTGTG
GGACCGCGCAAACTGTGTGTTAAGGAGATGAACAGTGGCATGGCGAAAAAACAGGCCTGGCTTATAAAGAACAAAATCAAGGCTTTTTAT
GCTGCAGTGGCGGCAGACTGTTTCAGGGATGGTGTCCGAAGTCTTCTTCAGGCCTCAGGCTTAGGAAGAATGAAACCAAACACTCTGGTG
ATTGGATATAAGAAAAACTGGAGGAAAGCTCCCTTGACAGAGATTGAGAACTACGTGGGAATCATACATGATGCATTTGATTTTGAGATT
GGCGTGGTTATAGTCAGAATCAGCCAAGGATTTGACATCTCTCAGGTTCTTCAGGTGCAAGAGGAATTAGAGAGATTAGAACAGGAGAGA
CTAGCATTGGAAGCGACTATCAAAGATAATGAGTGTGAAGAGGAAAGTGGAGGCATCCGAGGCTTGTTTAAAAAAGCTGGCAAGTTGAAC
ATTACTAAGACAACGCCTAAAAAAGATGGCAGCATTAACACAAGCCAGTCGATGCATGTGGGAGAGTTCAACCAGAAACTGGTGGAAGCC
AGCACTCAATTTAAAAAGAAACAAGAAAAAGGCACAATTGATGTTTGGTGGTTGTTTGATGATGGAGGGTTAACACTTCTTATCCCCTAT
ATCTTAACTCTCAGAAAAAAATGGAAAGACTGTAAATTAAGAATCTATGTGGGAGGGAAGATCAACCGCATTGAAGAAGAAAAAATTGTA
ATGGCTTCCCTTCTGAGCAAATTTAGGATAAAATTTGCAGACATCCATATCATCGGTGACATCAACATTAGGCCAAACAAAGAGAGCTGG
AAAGTCTTTGAAGAGATGATTGAACCATATCGTCTCCATGAAAGCTGCAAAGATTTAACAACTGCTGAGAAATTAAAAAGAGAAACTCCG
TGGAAAATTACAGATGCAGAACTGGAAGCAGTCAAGGAAAAGAGTTACCGCCAAGTTCGACTGAATGAACTCTTACAGGAGCACTCCAGA
GCTGCTAATCTCATTGTCCTGAGCCTTCCCGTGGCAAGAAAGGGATCCATATCGGATTTGTTGTATATGGCTTGGTTGGAAATCCTCACA
AAGAACCTCCCACCTGTCTTACTAGTTAGAGGAAATCACAAAAATGTCTTGACATTTTACTCTTAAAACATGAAAGATTGGAATACATTT
TAACTTAATGTAATGCATAATTAAGAAACATGTTCCAGTACTTTATGTTGTAAATCTGATCTATGGATATGCAAACCTCTGGAGAGGATC
CTACCAGATTCTACATACATTGCATAATTTTTATCAGTTAATGCGAGCTTTTTTTTCTCTTCTCAGCTTAAGGGGTTGTCAAAGCCAATG
TTATCCCTAGAAAAACATTTTTGTCACTGCTGTTGATAAACAAGAAAATCAAGGAAACTCATGTTGGCTTATGCTCATGAAAACCACCAA
TGTGATTGTAAACTTCTCCAGACAAACTTAACCTTTTGTTTCTTAATTTTTTGTTTTGAGTGTTTGCTTCTCAGCCCTGGTATAGGTCTC
AGCCCCACAGCAGGATCTCAATAAATGCTTATTGACAGGCTGGCATAGTAACCACAGGTGGTTATCAAAGGAAAAGACCAATAGGCTGGG
GAACATAATTATGCTTGGCCCCCTCAGAGGCTTATACCTCCAAAGCAGATTTAAAAATCAGTAACTCAAAACTTTAAGAAGTAGTTGAGT
CTACAAAATATTCAAAGCAGTTACCTAAATAAGGTTATTTAATGTAACAGATTATATACTTAAAGTGATCTGAGCAATCATTGATAACAT
ATGGCTTAAATTTGCTGCTGCCTGAAAAGTATATTAACTAGATTAGAAGACACCATATACTCCAATAAAATGAAATATATTCTATTCTCA
ATATATAAACTTTAATTGTACTCCCTATCAAATATTTTGAAATTTCCATCACGGCATTACTTTGCATATTTTTTTCTAATTAAATGGTTA
GTACAGATGAAATCTTTATAGATGACTACTTGAAAACTAAGTGCTACAAATTTTCAAACCATTATTAAGAAATATATCCTGAATCATATA
TTTAGTTACTTTCTATAGTGATTGTATGGATTTAAAAGAATAATTAAAATGTGAAGTTGAAAAACTTGTAAAATTTGGAATATACAGATA
CTGATTTTTTTCATTTTTGTTAGTATACCTATAATACATAATCACATTGACAAACCAATGAAAATATTGATTTTCTGATGAATGGCTTGA


Top

FusionGenePPI for PTPN9_SLC12A1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPN9RTN3, GHR, MYC, TP53BP1, VCP, AGTRAP, REEP6, MAL2, CMTM5, ENO1, MOV10, NXF1, NTRK1, CREB3, LZTR1, PC, EYA1, RAD51C, FAM26D, VSIG8, C5AR2, MDK, PDCD1, PTPN9, GEMIN8, FSIP1, SMN1, DDX20, GEMIN4, PMPCA, SLC39A7, STRAP, TUBA3C, AAR2, SMN2, TUBA3D, LMNASLC12A1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPN9_SLC12A1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneSLC12A1Q13621DB00214TorasemideSolute carrier family 12 member 1small moleculeapproved
TgeneSLC12A1Q13621DB00232MethyclothiazideSolute carrier family 12 member 1small moleculeapproved
TgeneSLC12A1Q13621DB00310ChlorthalidoneSolute carrier family 12 member 1small moleculeapproved
TgeneSLC12A1Q13621DB00887BumetanideSolute carrier family 12 member 1small moleculeapproved
TgeneSLC12A1Q13621DB01325QuinethazoneSolute carrier family 12 member 1small moleculeapproved
TgeneSLC12A1Q13621DB02925PiretanideSolute carrier family 12 member 1small moleculeapproved
TgeneSLC12A1Q13621DB00774HydroflumethiazideSolute carrier family 12 member 1small moleculeapproved|investigational
TgeneSLC12A1Q13621DB00903Etacrynic acidSolute carrier family 12 member 1small moleculeapproved|investigational
TgeneSLC12A1Q13621DB00695FurosemideSolute carrier family 12 member 1small moleculeapproved|vet_approved
TgeneSLC12A1Q13621DB01021TrichlormethiazideSolute carrier family 12 member 1small moleculeapproved|vet_approved
TgeneSLC12A1Q13621DB00761Potassium ChlorideSolute carrier family 12 member 1small moleculeapproved|withdrawn

Top

RelatedDiseases for PTPN9_SLC12A1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSLC12A1C0004775Bartter Disease1CTD_human
TgeneSLC12A1C1866495Bartter syndrome, antenatal type 11CTD_human;ORPHANET;UNIPROT