FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29472

FusionGeneSummary for PTPN9_SCAPER

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPN9_SCAPER
Fusion gene ID: 29472
HgeneTgene
Gene symbol

PTPN9

SCAPER

Gene ID

5780

49855

Gene nameprotein tyrosine phosphatase, non-receptor type 9S-phase cyclin A associated protein in the ER
SynonymsMEG2|PTPMEG2MSTP063|ZNF291|Zfp291
Cytomap

15q24.2

15q24.3

Type of geneprotein-codingprotein-coding
Descriptiontyrosine-protein phosphatase non-receptor type 9PTPase-MEG2protein-tyrosine phosphatase MEG2S phase cyclin A-associated protein in the endoplasmic reticulumzinc finger protein 291
Modification date2018052020180519
UniProtAcc

P43378

Q9BY12

Ensembl transtripts involved in fusion geneENST00000306726, ENST00000564970, 
ENST00000538941, ENST00000563290, 
ENST00000324767, ENST00000562890, 
Fusion gene scores* DoF score8 X 6 X 7=3366 X 6 X 3=108
# samples 136
** MAII scorelog2(13/336*10)=-1.36994960975031
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/108*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PTPN9 [Title/Abstract] AND SCAPER [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePTPN9

GO:0010977

negative regulation of neuron projection development

27655914

HgenePTPN9

GO:0035335

peptidyl-tyrosine dephosphorylation

27655914

HgenePTPN9

GO:1903078

positive regulation of protein localization to plasma membrane

27655914


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-13-1511-01APTPN9chr15

75871055

-SCAPERchr15

76726651

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000306726ENST00000538941PTPN9chr15

75871055

-SCAPERchr15

76726651

-
In-frameENST00000306726ENST00000563290PTPN9chr15

75871055

-SCAPERchr15

76726651

-
In-frameENST00000306726ENST00000324767PTPN9chr15

75871055

-SCAPERchr15

76726651

-
5CDS-intronENST00000306726ENST00000562890PTPN9chr15

75871055

-SCAPERchr15

76726651

-
intron-3CDSENST00000564970ENST00000538941PTPN9chr15

75871055

-SCAPERchr15

76726651

-
intron-3CDSENST00000564970ENST00000563290PTPN9chr15

75871055

-SCAPERchr15

76726651

-
intron-3CDSENST00000564970ENST00000324767PTPN9chr15

75871055

-SCAPERchr15

76726651

-
intron-intronENST00000564970ENST00000562890PTPN9chr15

75871055

-SCAPERchr15

76726651

-

Top

FusionProtFeatures for PTPN9_SCAPER


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPN9

P43378

SCAPER

Q9BY12

Protein-tyrosine phosphatase that could participate inthe transfer of hydrophobic ligands or in functions of the Golgiapparatus. {ECO:0000269|PubMed:19167335}. CCNA2/CDK2 regulatory protein that transiently maintainsCCNA2 in the cytoplasm. {ECO:0000269|PubMed:17698606}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSCAPERchr15:75871055chr15:76726651ENST00000538941-2432792_8167801155Zinc fingerNote=C2H2-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPN9chr15:75871055chr15:76726651ENST00000306726-113303_57421594DomainTyrosine-protein phosphatase
HgenePTPN9chr15:75871055chr15:76726651ENST00000306726-11384_24321594DomainCRAL-TRIO
HgenePTPN9chr15:75871055chr15:76726651ENST00000306726-113515_52121594RegionSubstrate binding
TgeneSCAPERchr15:75871055chr15:76726651ENST00000324767-2331395_77010261401Compositional biasNote=Glu-rich
TgeneSCAPERchr15:75871055chr15:76726651ENST00000538941-2432395_7707801155Compositional biasNote=Glu-rich
TgeneSCAPERchr15:75871055chr15:76726651ENST00000563290-2432395_77010261401Compositional biasNote=Glu-rich
TgeneSCAPERchr15:75871055chr15:76726651ENST00000324767-2331792_81610261401Zinc fingerNote=C2H2-type
TgeneSCAPERchr15:75871055chr15:76726651ENST00000563290-2432792_81610261401Zinc fingerNote=C2H2-type


Top

FusionGeneSequence for PTPN9_SCAPER


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SCAPER_ENST00000538941_chr15_76726651_-_396aa
MEPATAPRPDMAPELTPEEEQVTVPDENNTILGRNTNKQVFEGLTTGLLKVSAVVLGCLIANRPDGNCQPATPKIPTQEMKNKPSQGDPF
NNRVQDLISYVVNMGLIDKLCACFLSVQGPVDENPKMAIFLQHAAGLLHAMCTLCFAVTGRSYSIFDNNRQDPTGLTAALQATDLAGVLH
MLYCVLFHGTILDPSTASPKENYTQNTIQVAIQSLRFFNSFAALHLPAFQSIVGAEGLSLAFRHMASSLLGHCSQVSCESLLHEVIVCVG
YFTVNHPDNQVIVQSGRHPTVLQKLCQLPFQTFSDPRLIKVLFPSLIAACYNNHQNKIILEQEMSCVLLATFIQDLAQTPGQAENQPYQP

>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SCAPER_ENST00000563290_chr15_76726651_-_396aa
MEPATAPRPDMAPELTPEEEQVTVPDENNTILGRNTNKQVFEGLTTGLLKVSAVVLGCLIANRPDGNCQPATPKIPTQEMKNKPSQGDPF
NNRVQDLISYVVNMGLIDKLCACFLSVQGPVDENPKMAIFLQHAAGLLHAMCTLCFAVTGRSYSIFDNNRQDPTGLTAALQATDLAGVLH
MLYCVLFHGTILDPSTASPKENYTQNTIQVAIQSLRFFNSFAALHLPAFQSIVGAEGLSLAFRHMASSLLGHCSQVSCESLLHEVIVCVG
YFTVNHPDNQVIVQSGRHPTVLQKLCQLPFQTFSDPRLIKVLFPSLIAACYNNHQNKIILEQEMSCVLLATFIQDLAQTPGQAENQPYQP

>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SCAPER_ENST00000324767_chr15_76726651_-_396aa
MEPATAPRPDMAPELTPEEEQVTVPDENNTILGRNTNKQVFEGLTTGLLKVSAVVLGCLIANRPDGNCQPATPKIPTQEMKNKPSQGDPF
NNRVQDLISYVVNMGLIDKLCACFLSVQGPVDENPKMAIFLQHAAGLLHAMCTLCFAVTGRSYSIFDNNRQDPTGLTAALQATDLAGVLH
MLYCVLFHGTILDPSTASPKENYTQNTIQVAIQSLRFFNSFAALHLPAFQSIVGAEGLSLAFRHMASSLLGHCSQVSCESLLHEVIVCVG
YFTVNHPDNQVIVQSGRHPTVLQKLCQLPFQTFSDPRLIKVLFPSLIAACYNNHQNKIILEQEMSCVLLATFIQDLAQTPGQAENQPYQP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SCAPER_ENST00000538941_chr15_76726651_-_1188nt
ATGGAGCCCGCGACCGCGCCCCGGCCCGACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGTTTATGTTCCAGATGAAAATAATACT
ATTTTGGGGAGAAATACAAATAAACAAGTTTTTGAAGGCTTGACAACTGGACTTCTCAAAGTCAGTGCTGTGGTTTTGGGCTGCCTGATT
GCCAATCGACCAGATGGAAACTGCCAGCCAGCTACCCCAAAAATACCAACACAGGAAATGAAAAACAAACCCTCACAAGGTGATCCTTTT
AACAATCGAGTTCAGGACCTTATCAGCTACGTGGTGAACATGGGTCTGATTGACAAACTGTGTGCCTGCTTCCTCTCGGTGCAAGGCCCA
GTGGATGAGAATCCCAAGATGGCCATATTTCTGCAGCATGCCGCAGGACTCTTACATGCAATGTGTACACTGTGCTTTGCTGTCACTGGA
AGGTCATACAGCATATTTGACAATAATCGCCAGGATCCCACAGGGCTGACAGCTGCTCTTCAGGCAACCGACCTGGCTGGAGTTCTTCAT
ATGCTCTACTGTGTCCTCTTCCATGGCACCATCTTGGACCCCAGCACTGCCAGTCCCAAGGAGAATTACACTCAAAATACCATCCAAGTG
GCCATTCAGAGTTTACGTTTCTTCAACAGCTTTGCAGCTCTTCATCTGCCTGCTTTTCAGTCTATTGTAGGGGCAGAGGGCTTGTCCCTT
GCATTCCGGCACATGGCCAGCTCCCTGCTGGGCCACTGCAGCCAAGTCTCCTGTGAAAGCCTCCTTCATGAGGTCATCGTCTGTGTGGGC
TACTTCACTGTCAACCACCCAGATAACCAGGTGATCGTGCAGTCCGGCCGCCACCCCACAGTGCTGCAGAAGCTCTGCCAGTTGCCCTTC
CAGTATTTCAGTGACCCACGGCTGATCAAAGTACTGTTCCCTTCACTTATCGCTGCTTGTTACAACAACCATCAGAACAAGATCATTCTG
GAGCAAGAGATGAGCTGTGTTTTACTGGCCACTTTCATTCAGGATTTGGCACAGACTCCAGGTCAAGCGGAAAACCAGCCTTACCAACCC
AAAGGGAAATGCCTTGGTTCCCAAGACTATCTTGAGCTGGCTAACAGATTTCCTCAGCAGGCCTGGGAAGAAGCTCGACAGTTTTTCTTG

>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SCAPER_ENST00000563290_chr15_76726651_-_1188nt
ATGGAGCCCGCGACCGCGCCCCGGCCCGACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGTTTATGTTCCAGATGAAAATAATACT
ATTTTGGGGAGAAATACAAATAAACAAGTTTTTGAAGGCTTGACAACTGGACTTCTCAAAGTCAGTGCTGTGGTTTTGGGCTGCCTGATT
GCCAATCGACCAGATGGAAACTGCCAGCCAGCTACCCCAAAAATACCAACACAGGAAATGAAAAACAAACCCTCACAAGGTGATCCTTTT
AACAATCGAGTTCAGGACCTTATCAGCTACGTGGTGAACATGGGTCTGATTGACAAACTGTGTGCCTGCTTCCTCTCGGTGCAAGGCCCA
GTGGATGAGAATCCCAAGATGGCCATATTTCTGCAGCATGCCGCAGGACTCTTACATGCAATGTGTACACTGTGCTTTGCTGTCACTGGA
AGGTCATACAGCATATTTGACAATAATCGCCAGGATCCCACAGGGCTGACAGCTGCTCTTCAGGCAACCGACCTGGCTGGAGTTCTTCAT
ATGCTCTACTGTGTCCTCTTCCATGGCACCATCTTGGACCCCAGCACTGCCAGTCCCAAGGAGAATTACACTCAAAATACCATCCAAGTG
GCCATTCAGAGTTTACGTTTCTTCAACAGCTTTGCAGCTCTTCATCTGCCTGCTTTTCAGTCTATTGTAGGGGCAGAGGGCTTGTCCCTT
GCATTCCGGCACATGGCCAGCTCCCTGCTGGGCCACTGCAGCCAAGTCTCCTGTGAAAGCCTCCTTCATGAGGTCATCGTCTGTGTGGGC
TACTTCACTGTCAACCACCCAGATAACCAGGTGATCGTGCAGTCCGGCCGCCACCCCACAGTGCTGCAGAAGCTCTGCCAGTTGCCCTTC
CAGTATTTCAGTGACCCACGGCTGATCAAAGTACTGTTCCCTTCACTTATCGCTGCTTGTTACAACAACCATCAGAACAAGATCATTCTG
GAGCAAGAGATGAGCTGTGTTTTACTGGCCACTTTCATTCAGGATTTGGCACAGACTCCAGGTCAAGCGGAAAACCAGCCTTACCAACCC
AAAGGGAAATGCCTTGGTTCCCAAGACTATCTTGAGCTGGCTAACAGATTTCCTCAGCAGGCCTGGGAAGAAGCTCGACAGTTTTTCTTG

>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SCAPER_ENST00000324767_chr15_76726651_-_1188nt
ATGGAGCCCGCGACCGCGCCCCGGCCCGACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGTTTATGTTCCAGATGAAAATAATACT
ATTTTGGGGAGAAATACAAATAAACAAGTTTTTGAAGGCTTGACAACTGGACTTCTCAAAGTCAGTGCTGTGGTTTTGGGCTGCCTGATT
GCCAATCGACCAGATGGAAACTGCCAGCCAGCTACCCCAAAAATACCAACACAGGAAATGAAAAACAAACCCTCACAAGGTGATCCTTTT
AACAATCGAGTTCAGGACCTTATCAGCTACGTGGTGAACATGGGTCTGATTGACAAACTGTGTGCCTGCTTCCTCTCGGTGCAAGGCCCA
GTGGATGAGAATCCCAAGATGGCCATATTTCTGCAGCATGCCGCAGGACTCTTACATGCAATGTGTACACTGTGCTTTGCTGTCACTGGA
AGGTCATACAGCATATTTGACAATAATCGCCAGGATCCCACAGGGCTGACAGCTGCTCTTCAGGCAACCGACCTGGCTGGAGTTCTTCAT
ATGCTCTACTGTGTCCTCTTCCATGGCACCATCTTGGACCCCAGCACTGCCAGTCCCAAGGAGAATTACACTCAAAATACCATCCAAGTG
GCCATTCAGAGTTTACGTTTCTTCAACAGCTTTGCAGCTCTTCATCTGCCTGCTTTTCAGTCTATTGTAGGGGCAGAGGGCTTGTCCCTT
GCATTCCGGCACATGGCCAGCTCCCTGCTGGGCCACTGCAGCCAAGTCTCCTGTGAAAGCCTCCTTCATGAGGTCATCGTCTGTGTGGGC
TACTTCACTGTCAACCACCCAGATAACCAGGTGATCGTGCAGTCCGGCCGCCACCCCACAGTGCTGCAGAAGCTCTGCCAGTTGCCCTTC
CAGTATTTCAGTGACCCACGGCTGATCAAAGTACTGTTCCCTTCACTTATCGCTGCTTGTTACAACAACCATCAGAACAAGATCATTCTG
GAGCAAGAGATGAGCTGTGTTTTACTGGCCACTTTCATTCAGGATTTGGCACAGACTCCAGGTCAAGCGGAAAACCAGCCTTACCAACCC
AAAGGGAAATGCCTTGGTTCCCAAGACTATCTTGAGCTGGCTAACAGATTTCCTCAGCAGGCCTGGGAAGAAGCTCGACAGTTTTTCTTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SCAPER_ENST00000538941_chr15_76726651_-_2149nt
AGCCTGGCTGAGGCAGCCGCGCAGGTCGCAGGGCCAGCGTCCGCGAGGACGGCCCGGCTGGGCGGCCCCGAGCTCTGTGGCGCTGTGGAG
GAGCGGGAGCGCGGCCGAGGAAGCGGGGCGCCGAGGGGGTCGGCGGCCTTCGGGAAATTTCCGCCGACCCTTCGCTCCCGGCTCTAAAAG
TTCCTGATTTCCTATTTCCTTTTAAATCCCGAGTGGCTGTTAGCTCTTCGCCTGCACTTTTTCTTCCCCAGGAGATAAGGGGGAGTGTGA
GGAACGGAGCGAATAATATAAAAAAGGATTTCCTCCCGGAAGAGAGCGGCAGTTCGGAGAGATTTTTCTTAAGGAAGCAGAAGCGGCGTT
TGCGGCCGCTGCAGGCGCCGGGCCCTGCCGGCCACACTATGCGCGAGCCGGCCCCGGGCTGCTGAGGCGCGGGGACGCGGAAGCGGAGGC
CGAGCGCGCCGGGCTCCCGCGCTCGCGAGCGAGTTTTGTCCGCCCGGCGGCGGTGGCGGGGGGATGGAGCCCGCGACCGCGCCCCGGCCC
GACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGTTTATGTTCCAGATGAAAATAATACTATTTTGGGGAGAAATACAAATAAACAA
GTTTTTGAAGGCTTGACAACTGGACTTCTCAAAGTCAGTGCTGTGGTTTTGGGCTGCCTGATTGCCAATCGACCAGATGGAAACTGCCAG
CCAGCTACCCCAAAAATACCAACACAGGAAATGAAAAACAAACCCTCACAAGGTGATCCTTTTAACAATCGAGTTCAGGACCTTATCAGC
TACGTGGTGAACATGGGTCTGATTGACAAACTGTGTGCCTGCTTCCTCTCGGTGCAAGGCCCAGTGGATGAGAATCCCAAGATGGCCATA
TTTCTGCAGCATGCCGCAGGACTCTTACATGCAATGTGTACACTGTGCTTTGCTGTCACTGGAAGGTCATACAGCATATTTGACAATAAT
CGCCAGGATCCCACAGGGCTGACAGCTGCTCTTCAGGCAACCGACCTGGCTGGAGTTCTTCATATGCTCTACTGTGTCCTCTTCCATGGC
ACCATCTTGGACCCCAGCACTGCCAGTCCCAAGGAGAATTACACTCAAAATACCATCCAAGTGGCCATTCAGAGTTTACGTTTCTTCAAC
AGCTTTGCAGCTCTTCATCTGCCTGCTTTTCAGTCTATTGTAGGGGCAGAGGGCTTGTCCCTTGCATTCCGGCACATGGCCAGCTCCCTG
CTGGGCCACTGCAGCCAAGTCTCCTGTGAAAGCCTCCTTCATGAGGTCATCGTCTGTGTGGGCTACTTCACTGTCAACCACCCAGATAAC
CAGGTGATCGTGCAGTCCGGCCGCCACCCCACAGTGCTGCAGAAGCTCTGCCAGTTGCCCTTCCAGTATTTCAGTGACCCACGGCTGATC
AAAGTACTGTTCCCTTCACTTATCGCTGCTTGTTACAACAACCATCAGAACAAGATCATTCTGGAGCAAGAGATGAGCTGTGTTTTACTG
GCCACTTTCATTCAGGATTTGGCACAGACTCCAGGTCAAGCGGAAAACCAGCCTTACCAACCCAAAGGGAAATGCCTTGGTTCCCAAGAC
TATCTTGAGCTGGCTAACAGATTTCCTCAGCAGGCCTGGGAAGAAGCTCGACAGTTTTTCTTGAAAAAAGAGAAAAAATAAATGTTTTGG
TTGATTCTGTATTTGAGTACCCTTGTTAATATTTTAAATTGTCCAAACAAACATTCTAATTGTTCCTTAAGAACTCATTTTCCCATGTTT
ATACTCTTCCCACACTGTAGATATGGCATGTACTTTACACTATTTATAATGACTGTAGATACTTGAATGTTCTACTTGCTAATTTTGCAA
GTTGAGTTTATTTCATTTATGCAGAGTATCTTGGAGTTTGGTAATTTCCATCTTATGATAATATATACTTTGCATTTGTGATATGGGTGA
AAGGAGACATAAAATTAGCAAGTCTGTTTTGTTCTTGTAATAAAGTAACTTATTCTGTTTTCATTGTTGACTTTTCATGTTAAGGAAATA

>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SCAPER_ENST00000563290_chr15_76726651_-_2149nt
AGCCTGGCTGAGGCAGCCGCGCAGGTCGCAGGGCCAGCGTCCGCGAGGACGGCCCGGCTGGGCGGCCCCGAGCTCTGTGGCGCTGTGGAG
GAGCGGGAGCGCGGCCGAGGAAGCGGGGCGCCGAGGGGGTCGGCGGCCTTCGGGAAATTTCCGCCGACCCTTCGCTCCCGGCTCTAAAAG
TTCCTGATTTCCTATTTCCTTTTAAATCCCGAGTGGCTGTTAGCTCTTCGCCTGCACTTTTTCTTCCCCAGGAGATAAGGGGGAGTGTGA
GGAACGGAGCGAATAATATAAAAAAGGATTTCCTCCCGGAAGAGAGCGGCAGTTCGGAGAGATTTTTCTTAAGGAAGCAGAAGCGGCGTT
TGCGGCCGCTGCAGGCGCCGGGCCCTGCCGGCCACACTATGCGCGAGCCGGCCCCGGGCTGCTGAGGCGCGGGGACGCGGAAGCGGAGGC
CGAGCGCGCCGGGCTCCCGCGCTCGCGAGCGAGTTTTGTCCGCCCGGCGGCGGTGGCGGGGGGATGGAGCCCGCGACCGCGCCCCGGCCC
GACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGTTTATGTTCCAGATGAAAATAATACTATTTTGGGGAGAAATACAAATAAACAA
GTTTTTGAAGGCTTGACAACTGGACTTCTCAAAGTCAGTGCTGTGGTTTTGGGCTGCCTGATTGCCAATCGACCAGATGGAAACTGCCAG
CCAGCTACCCCAAAAATACCAACACAGGAAATGAAAAACAAACCCTCACAAGGTGATCCTTTTAACAATCGAGTTCAGGACCTTATCAGC
TACGTGGTGAACATGGGTCTGATTGACAAACTGTGTGCCTGCTTCCTCTCGGTGCAAGGCCCAGTGGATGAGAATCCCAAGATGGCCATA
TTTCTGCAGCATGCCGCAGGACTCTTACATGCAATGTGTACACTGTGCTTTGCTGTCACTGGAAGGTCATACAGCATATTTGACAATAAT
CGCCAGGATCCCACAGGGCTGACAGCTGCTCTTCAGGCAACCGACCTGGCTGGAGTTCTTCATATGCTCTACTGTGTCCTCTTCCATGGC
ACCATCTTGGACCCCAGCACTGCCAGTCCCAAGGAGAATTACACTCAAAATACCATCCAAGTGGCCATTCAGAGTTTACGTTTCTTCAAC
AGCTTTGCAGCTCTTCATCTGCCTGCTTTTCAGTCTATTGTAGGGGCAGAGGGCTTGTCCCTTGCATTCCGGCACATGGCCAGCTCCCTG
CTGGGCCACTGCAGCCAAGTCTCCTGTGAAAGCCTCCTTCATGAGGTCATCGTCTGTGTGGGCTACTTCACTGTCAACCACCCAGATAAC
CAGGTGATCGTGCAGTCCGGCCGCCACCCCACAGTGCTGCAGAAGCTCTGCCAGTTGCCCTTCCAGTATTTCAGTGACCCACGGCTGATC
AAAGTACTGTTCCCTTCACTTATCGCTGCTTGTTACAACAACCATCAGAACAAGATCATTCTGGAGCAAGAGATGAGCTGTGTTTTACTG
GCCACTTTCATTCAGGATTTGGCACAGACTCCAGGTCAAGCGGAAAACCAGCCTTACCAACCCAAAGGGAAATGCCTTGGTTCCCAAGAC
TATCTTGAGCTGGCTAACAGATTTCCTCAGCAGGCCTGGGAAGAAGCTCGACAGTTTTTCTTGAAAAAAGAGAAAAAATAAATGTTTTGG
TTGATTCTGTATTTGAGTACCCTTGTTAATATTTTAAATTGTCCAAACAAACATTCTAATTGTTCCTTAAGAACTCATTTTCCCATGTTT
ATACTCTTCCCACACTGTAGATATGGCATGTACTTTACACTATTTATAATGACTGTAGATACTTGAATGTTCTACTTGCTAATTTTGCAA
GTTGAGTTTATTTCATTTATGCAGAGTATCTTGGAGTTTGGTAATTTCCATCTTATGATAATATATACTTTGCATTTGTGATATGGGTGA
AAGGAGACATAAAATTAGCAAGTCTGTTTTGTTCTTGTAATAAAGTAACTTATTCTGTTTTCATTGTTGACTTTTCATGTTAAGGAAATA

>In-frame_PTPN9_ENST00000306726_chr15_75871055_-_SCAPER_ENST00000324767_chr15_76726651_-_2146nt
AGCCTGGCTGAGGCAGCCGCGCAGGTCGCAGGGCCAGCGTCCGCGAGGACGGCCCGGCTGGGCGGCCCCGAGCTCTGTGGCGCTGTGGAG
GAGCGGGAGCGCGGCCGAGGAAGCGGGGCGCCGAGGGGGTCGGCGGCCTTCGGGAAATTTCCGCCGACCCTTCGCTCCCGGCTCTAAAAG
TTCCTGATTTCCTATTTCCTTTTAAATCCCGAGTGGCTGTTAGCTCTTCGCCTGCACTTTTTCTTCCCCAGGAGATAAGGGGGAGTGTGA
GGAACGGAGCGAATAATATAAAAAAGGATTTCCTCCCGGAAGAGAGCGGCAGTTCGGAGAGATTTTTCTTAAGGAAGCAGAAGCGGCGTT
TGCGGCCGCTGCAGGCGCCGGGCCCTGCCGGCCACACTATGCGCGAGCCGGCCCCGGGCTGCTGAGGCGCGGGGACGCGGAAGCGGAGGC
CGAGCGCGCCGGGCTCCCGCGCTCGCGAGCGAGTTTTGTCCGCCCGGCGGCGGTGGCGGGGGGATGGAGCCCGCGACCGCGCCCCGGCCC
GACATGGCGCCGGAGCTGACCCCGGAGGAGGAGCAGGTTTATGTTCCAGATGAAAATAATACTATTTTGGGGAGAAATACAAATAAACAA
GTTTTTGAAGGCTTGACAACTGGACTTCTCAAAGTCAGTGCTGTGGTTTTGGGCTGCCTGATTGCCAATCGACCAGATGGAAACTGCCAG
CCAGCTACCCCAAAAATACCAACACAGGAAATGAAAAACAAACCCTCACAAGGTGATCCTTTTAACAATCGAGTTCAGGACCTTATCAGC
TACGTGGTGAACATGGGTCTGATTGACAAACTGTGTGCCTGCTTCCTCTCGGTGCAAGGCCCAGTGGATGAGAATCCCAAGATGGCCATA
TTTCTGCAGCATGCCGCAGGACTCTTACATGCAATGTGTACACTGTGCTTTGCTGTCACTGGAAGGTCATACAGCATATTTGACAATAAT
CGCCAGGATCCCACAGGGCTGACAGCTGCTCTTCAGGCAACCGACCTGGCTGGAGTTCTTCATATGCTCTACTGTGTCCTCTTCCATGGC
ACCATCTTGGACCCCAGCACTGCCAGTCCCAAGGAGAATTACACTCAAAATACCATCCAAGTGGCCATTCAGAGTTTACGTTTCTTCAAC
AGCTTTGCAGCTCTTCATCTGCCTGCTTTTCAGTCTATTGTAGGGGCAGAGGGCTTGTCCCTTGCATTCCGGCACATGGCCAGCTCCCTG
CTGGGCCACTGCAGCCAAGTCTCCTGTGAAAGCCTCCTTCATGAGGTCATCGTCTGTGTGGGCTACTTCACTGTCAACCACCCAGATAAC
CAGGTGATCGTGCAGTCCGGCCGCCACCCCACAGTGCTGCAGAAGCTCTGCCAGTTGCCCTTCCAGTATTTCAGTGACCCACGGCTGATC
AAAGTACTGTTCCCTTCACTTATCGCTGCTTGTTACAACAACCATCAGAACAAGATCATTCTGGAGCAAGAGATGAGCTGTGTTTTACTG
GCCACTTTCATTCAGGATTTGGCACAGACTCCAGGTCAAGCGGAAAACCAGCCTTACCAACCCAAAGGGAAATGCCTTGGTTCCCAAGAC
TATCTTGAGCTGGCTAACAGATTTCCTCAGCAGGCCTGGGAAGAAGCTCGACAGTTTTTCTTGAAAAAAGAGAAAAAATAAATGTTTTGG
TTGATTCTGTATTTGAGTACCCTTGTTAATATTTTAAATTGTCCAAACAAACATTCTAATTGTTCCTTAAGAACTCATTTTCCCATGTTT
ATACTCTTCCCACACTGTAGATATGGCATGTACTTTACACTATTTATAATGACTGTAGATACTTGAATGTTCTACTTGCTAATTTTGCAA
GTTGAGTTTATTTCATTTATGCAGAGTATCTTGGAGTTTGGTAATTTCCATCTTATGATAATATATACTTTGCATTTGTGATATGGGTGA
AAGGAGACATAAAATTAGCAAGTCTGTTTTGTTCTTGTAATAAAGTAACTTATTCTGTTTTCATTGTTGACTTTTCATGTTAAGGAAATA


Top

FusionGenePPI for PTPN9_SCAPER


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPN9RTN3, GHR, MYC, TP53BP1, VCP, AGTRAP, REEP6, MAL2, CMTM5, ENO1, MOV10, NXF1, NTRK1, CREB3, LZTR1, PC, EYA1, RAD51C, FAM26D, VSIG8, C5AR2, MDK, PDCD1, PTPN9, GEMIN8, FSIP1, SMN1, DDX20, GEMIN4, PMPCA, SLC39A7, STRAP, TUBA3C, AAR2, SMN2, TUBA3D, LMNASCAPERCALM1, HECW2, CCNA2, APPL1, MZT1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPN9_SCAPER


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTPN9_SCAPER


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSCAPERC3714756Intellectual Disability1CTD_human