FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29403

FusionGeneSummary for PTPN11_CUX2

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPN11_CUX2
Fusion gene ID: 29403
HgeneTgene
Gene symbol

PTPN11

CUX2

Gene ID

5781

23316

Gene nameprotein tyrosine phosphatase, non-receptor type 11cut like homeobox 2
SynonymsBPTP3|CFC|JMML|METCDS|NS1|PTP-1D|PTP2C|SH-PTP2|SH-PTP3|SHP2CDP2|CUTL2
Cytomap

12q24.13

12q24.11-q24.12

Type of geneprotein-codingprotein-coding
Descriptiontyrosine-protein phosphatase non-receptor type 11PTP-2Cprotein-tyrosine phosphatase 1Dprotein-tyrosine phosphatase 2Chomeobox protein cut-like 2homeobox protein cux-2
Modification date2018052720180523
UniProtAcc

Q06124

O14529

Ensembl transtripts involved in fusion geneENST00000531326, ENST00000392597, 
ENST00000351677, 
ENST00000261726, 
ENST00000551604, 
Fusion gene scores* DoF score7 X 6 X 4=1686 X 5 X 5=150
# samples 67
** MAII scorelog2(6/168*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/150*10)=-1.09953567355091
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PTPN11 [Title/Abstract] AND CUX2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePTPN11

GO:0035335

peptidyl-tyrosine dephosphorylation

15133037

HgenePTPN11

GO:0038127

ERBB signaling pathway

15133037

HgenePTPN11

GO:0043254

regulation of protein complex assembly

7493946

HgenePTPN11

GO:0048013

ephrin receptor signaling pathway

10655584

HgenePTPN11

GO:2001275

positive regulation of glucose import in response to insulin stimulus

7493946

TgeneCUX2

GO:0000122

negative regulation of transcription by RNA polymerase II

15656993


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCSTCGA-N6-A4VG-01APTPN11chr12

112910844

+CUX2chr12

111779584

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000531326ENST00000261726PTPN11chr12

112910844

+CUX2chr12

111779584

+
intron-intronENST00000531326ENST00000551604PTPN11chr12

112910844

+CUX2chr12

111779584

+
In-frameENST00000392597ENST00000261726PTPN11chr12

112910844

+CUX2chr12

111779584

+
5CDS-intronENST00000392597ENST00000551604PTPN11chr12

112910844

+CUX2chr12

111779584

+
In-frameENST00000351677ENST00000261726PTPN11chr12

112910844

+CUX2chr12

111779584

+
5CDS-intronENST00000351677ENST00000551604PTPN11chr12

112910844

+CUX2chr12

111779584

+

Top

FusionProtFeatures for PTPN11_CUX2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPN11

Q06124

CUX2

O14529

Acts downstream of various receptor and cytoplasmicprotein tyrosine kinases to participate in the signal transductionfrom the cell surface to the nucleus. Positively regulates MAPKsignal transduction pathway (PubMed:28074573). DephosphorylatesGAB1, ARHGAP35 and EGFR (PubMed:28074573). Dephosphorylates ROCK2at 'Tyr-722' resulting in stimulatation of its RhoA bindingactivity. Dephosphorylates CDC73 (PubMed:26742426).{ECO:0000269|PubMed:10655584, ECO:0000269|PubMed:18559669,ECO:0000269|PubMed:18829466, ECO:0000269|PubMed:26742426,ECO:0000269|PubMed:28074573}. May be a transcription factor involved in neuralspecification. Binds to DNA in a sequence-specific manner (Bysimilarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PTPN11_CUX2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPN11_ENST00000392597_chr12_112910844_+_CUX2_ENST00000261726_chr12_111779584_+_643aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYTDLTGGEKFATLAELVQTYMEHHGQLKE
KNGDVIELKTPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHTKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQR
QENKNKNRTKNILPSYLKRRTGLISTGSDSESPATRSECPSPCLQPQDLSLLQIKKPRVVLAPEEKEALRKATQLEPYPSQQTIELLSFQ
LNLKTNTVINWFHNYRSRMRREMLVEGTQDEPDLDPSGGPGILPPGHSHPDPTPQSPDSETEDQKPTVKELELQEGPEENSTPLTTQDKA
QVRIKQEQMEEDAEEEAGSQPQDSGELDKGQGPPKEEHPDPPGNDGLPKVAPGPLLPGGSTPDCPSLHPQQESEAGERLHPDPLSFKSAS
ESSRCSLEVSLNSPSAASSPGLMMSVSPVPSSSAPISPSPPGAPPAKVPSASPTADMAGALHPSAKVNPNLQRRHEKMANLNNIIYRVER

>In-frame_PTPN11_ENST00000351677_chr12_112910844_+_CUX2_ENST00000261726_chr12_111779584_+_643aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYTDLTGGEKFATLAELVQTYMEHHGQLKE
KNGDVIELKTPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHTKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQR
QENKNKNRTKNILPSYLKRRTGLISTGSDSESPATRSECPSPCLQPQDLSLLQIKKPRVVLAPEEKEALRKATQLEPYPSQQTIELLSFQ
LNLKTNTVINWFHNYRSRMRREMLVEGTQDEPDLDPSGGPGILPPGHSHPDPTPQSPDSETEDQKPTVKELELQEGPEENSTPLTTQDKA
QVRIKQEQMEEDAEEEAGSQPQDSGELDKGQGPPKEEHPDPPGNDGLPKVAPGPLLPGGSTPDCPSLHPQQESEAGERLHPDPLSFKSAS
ESSRCSLEVSLNSPSAASSPGLMMSVSPVPSSSAPISPSPPGAPPAKVPSASPTADMAGALHPSAKVNPNLQRRHEKMANLNNIIYRVER


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPN11_ENST00000392597_chr12_112910844_+_CUX2_ENST00000261726_chr12_111779584_+_1929nt
ATGACATCGCGGAGATGGTTTCACCCAAATATCACTGGTGTGGAGGCAGAAAACCTACTGTTGACAAGAGGAGTTGATGGCAGTTTTTTG
GCAAGGCCTAGTAAAAGTAACCCTGGAGACTTCACACTTTCCGTTAGAAGAAATGGAGCTGTCACCCACATCAAGATTCAGAACACTGGT
GATTACTATGACCTGTATGGAGGGGAGAAATTTGCCACTTTGGCTGAGTTGGTCCAGTATTACATGGAACATCACGGGCAATTAAAAGAG
AAGAATGGAGATGTCATTGAGCTTAAATATCCTCTGAACTGTGCAGATCCTACCTCTGAAAGGTGGTTTCATGGACATCTCTCTGGGAAA
GAAGCAGAGAAATTATTAACTGAAAAAGGAAAACATGGTAGTTTTCTTGTACGAGAGAGCCAGAGCCACCCTGGAGATTTTGTTCTTTCT
GTGCGCACTGGTGATGACAAAGGGGAGAGCAATGACGGCAAGTCTAAAGTGACCCATGTTATGATTCGCTGTCAGGAACTGAAATACGAC
GTTGGTGGAGGAGAACGGTTTGATTCTTTGACAGATCTTGTGGAACATTATAAGAAGAATCCTATGGTGGAAACATTGGGTACAGTACTA
CAACTCAAGCAGCCCCTTAACACGACTCGTATAAATGCTGCTGAAATAGAAAGCAGAGTTCGAGAACTAAGCAAATTAGCTGAGACCACA
GATAAAGTCAAACAAGGCTTTTGGGAAGAATTTGAGACACTACAACAACAGGAGTGCAAACTTCTCTACAGCCGAAAAGAGGGTCAAAGG
CAAGAAAACAAAAACAAAAATAGATATAAAAACATCCTGCCCTCCTACCTGAAACGTCGCTATGGCCTCATCAGCACCGGCTCAGACAGT
GAGTCCCCGGCCACCCGCTCAGAGTGCCCCAGCCCCTGCCTGCAGCCCCAGGACCTGAGCCTCCTGCAGATCAAGAAGCCCCGGGTGGTG
CTGGCACCCGAGGAGAAGGAGGCACTGCGGAAGGCCTATCAGCTGGAACCCTACCCCTCGCAGCAGACCATCGAGCTCCTCTCCTTCCAG
CTCAACCTCAAGACCAACACCGTCATCAACTGGTTCCACAACTACAGGTCCCGGATGCGCCGGGAGATGTTGGTGGAGGGGACCCAGGAT
GAGCCAGACCTTGATCCAAGCGGGGGTCCTGGAATCCTACCGCCAGGCCACTCCCACCCAGACCCCACCCCGCAGAGCCCTGACTCTGAG
ACTGAGGACCAGAAGCCAACCGTGAAGGAACTGGAGCTTCAGGAGGGCCCTGAGGAGAACAGCACACCCCTGACCACCCAGGACAAGGCC
CAAGTGAGGATCAAGCAGGAACAGATGGAGGAGGATGCTGAGGAAGAGGCAGGCAGCCAGCCCCAGGACTCAGGGGAGCTGGACAAAGGC
CAAGGTCCCCCCAAAGAGGAGCATCCCGACCCTCCGGGTAATGATGGACTCCCAAAAGTGGCTCCCGGGCCCCTCCTTCCAGGTGGATCC
ACCCCAGACTGTCCCTCACTTCATCCCCAACAGGAGAGTGAGGCCGGGGAGCGACTTCACCCGGACCCTTTAAGTTTTAAGTCAGCCTCA
GAGTCCTCACGCTGCAGCCTGGAGGTGTCACTGAACTCGCCCTCGGCCGCCTCCTCACCAGGCCTCATGATGTCTGTGTCACCTGTCCCC
TCCTCCTCAGCTCCCATCTCCCCATCCCCACCTGGCGCCCCCCCTGCCAAAGTGCCGAGTGCCAGCCCCACTGCTGACATGGCTGGAGCC
TTGCACCCCAGTGCCAAGGTGAACCCCAACTTGCAGCGGCGGCATGAGAAGATGGCCAATCTGAACAACATCATTTACCGAGTAGAGCGG

>In-frame_PTPN11_ENST00000351677_chr12_112910844_+_CUX2_ENST00000261726_chr12_111779584_+_1929nt
ATGACATCGCGGAGATGGTTTCACCCAAATATCACTGGTGTGGAGGCAGAAAACCTACTGTTGACAAGAGGAGTTGATGGCAGTTTTTTG
GCAAGGCCTAGTAAAAGTAACCCTGGAGACTTCACACTTTCCGTTAGAAGAAATGGAGCTGTCACCCACATCAAGATTCAGAACACTGGT
GATTACTATGACCTGTATGGAGGGGAGAAATTTGCCACTTTGGCTGAGTTGGTCCAGTATTACATGGAACATCACGGGCAATTAAAAGAG
AAGAATGGAGATGTCATTGAGCTTAAATATCCTCTGAACTGTGCAGATCCTACCTCTGAAAGGTGGTTTCATGGACATCTCTCTGGGAAA
GAAGCAGAGAAATTATTAACTGAAAAAGGAAAACATGGTAGTTTTCTTGTACGAGAGAGCCAGAGCCACCCTGGAGATTTTGTTCTTTCT
GTGCGCACTGGTGATGACAAAGGGGAGAGCAATGACGGCAAGTCTAAAGTGACCCATGTTATGATTCGCTGTCAGGAACTGAAATACGAC
GTTGGTGGAGGAGAACGGTTTGATTCTTTGACAGATCTTGTGGAACATTATAAGAAGAATCCTATGGTGGAAACATTGGGTACAGTACTA
CAACTCAAGCAGCCCCTTAACACGACTCGTATAAATGCTGCTGAAATAGAAAGCAGAGTTCGAGAACTAAGCAAATTAGCTGAGACCACA
GATAAAGTCAAACAAGGCTTTTGGGAAGAATTTGAGACACTACAACAACAGGAGTGCAAACTTCTCTACAGCCGAAAAGAGGGTCAAAGG
CAAGAAAACAAAAACAAAAATAGATATAAAAACATCCTGCCCTCCTACCTGAAACGTCGCTATGGCCTCATCAGCACCGGCTCAGACAGT
GAGTCCCCGGCCACCCGCTCAGAGTGCCCCAGCCCCTGCCTGCAGCCCCAGGACCTGAGCCTCCTGCAGATCAAGAAGCCCCGGGTGGTG
CTGGCACCCGAGGAGAAGGAGGCACTGCGGAAGGCCTATCAGCTGGAACCCTACCCCTCGCAGCAGACCATCGAGCTCCTCTCCTTCCAG
CTCAACCTCAAGACCAACACCGTCATCAACTGGTTCCACAACTACAGGTCCCGGATGCGCCGGGAGATGTTGGTGGAGGGGACCCAGGAT
GAGCCAGACCTTGATCCAAGCGGGGGTCCTGGAATCCTACCGCCAGGCCACTCCCACCCAGACCCCACCCCGCAGAGCCCTGACTCTGAG
ACTGAGGACCAGAAGCCAACCGTGAAGGAACTGGAGCTTCAGGAGGGCCCTGAGGAGAACAGCACACCCCTGACCACCCAGGACAAGGCC
CAAGTGAGGATCAAGCAGGAACAGATGGAGGAGGATGCTGAGGAAGAGGCAGGCAGCCAGCCCCAGGACTCAGGGGAGCTGGACAAAGGC
CAAGGTCCCCCCAAAGAGGAGCATCCCGACCCTCCGGGTAATGATGGACTCCCAAAAGTGGCTCCCGGGCCCCTCCTTCCAGGTGGATCC
ACCCCAGACTGTCCCTCACTTCATCCCCAACAGGAGAGTGAGGCCGGGGAGCGACTTCACCCGGACCCTTTAAGTTTTAAGTCAGCCTCA
GAGTCCTCACGCTGCAGCCTGGAGGTGTCACTGAACTCGCCCTCGGCCGCCTCCTCACCAGGCCTCATGATGTCTGTGTCACCTGTCCCC
TCCTCCTCAGCTCCCATCTCCCCATCCCCACCTGGCGCCCCCCCTGCCAAAGTGCCGAGTGCCAGCCCCACTGCTGACATGGCTGGAGCC
TTGCACCCCAGTGCCAAGGTGAACCCCAACTTGCAGCGGCGGCATGAGAAGATGGCCAATCTGAACAACATCATTTACCGAGTAGAGCGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPN11_ENST00000392597_chr12_112910844_+_CUX2_ENST00000261726_chr12_111779584_+_4361nt
GCGGAGGAGGAGCGAGCCGGGCCGGGGGGCAGCTGCACAGTCTCCGGGATCCCCAGGCCTGGAGGGGGGTCTGTGCGCGGCCGGCTGGCT
CTGCCCCGCGTCCGGTCCCGAGCGGGCCTCCCTCGGGCCAGCCCGATGTGACCGAGCCCAGCGGAGCCTGAGCAAGGAGCGGGTCCGTCG
CGGAGCCGGAGGGCGGGAGGAACATGACATCGCGGAGATGGTTTCACCCAAATATCACTGGTGTGGAGGCAGAAAACCTACTGTTGACAA
GAGGAGTTGATGGCAGTTTTTTGGCAAGGCCTAGTAAAAGTAACCCTGGAGACTTCACACTTTCCGTTAGAAGAAATGGAGCTGTCACCC
ACATCAAGATTCAGAACACTGGTGATTACTATGACCTGTATGGAGGGGAGAAATTTGCCACTTTGGCTGAGTTGGTCCAGTATTACATGG
AACATCACGGGCAATTAAAAGAGAAGAATGGAGATGTCATTGAGCTTAAATATCCTCTGAACTGTGCAGATCCTACCTCTGAAAGGTGGT
TTCATGGACATCTCTCTGGGAAAGAAGCAGAGAAATTATTAACTGAAAAAGGAAAACATGGTAGTTTTCTTGTACGAGAGAGCCAGAGCC
ACCCTGGAGATTTTGTTCTTTCTGTGCGCACTGGTGATGACAAAGGGGAGAGCAATGACGGCAAGTCTAAAGTGACCCATGTTATGATTC
GCTGTCAGGAACTGAAATACGACGTTGGTGGAGGAGAACGGTTTGATTCTTTGACAGATCTTGTGGAACATTATAAGAAGAATCCTATGG
TGGAAACATTGGGTACAGTACTACAACTCAAGCAGCCCCTTAACACGACTCGTATAAATGCTGCTGAAATAGAAAGCAGAGTTCGAGAAC
TAAGCAAATTAGCTGAGACCACAGATAAAGTCAAACAAGGCTTTTGGGAAGAATTTGAGACACTACAACAACAGGAGTGCAAACTTCTCT
ACAGCCGAAAAGAGGGTCAAAGGCAAGAAAACAAAAACAAAAATAGATATAAAAACATCCTGCCCTCCTACCTGAAACGTCGCTATGGCC
TCATCAGCACCGGCTCAGACAGTGAGTCCCCGGCCACCCGCTCAGAGTGCCCCAGCCCCTGCCTGCAGCCCCAGGACCTGAGCCTCCTGC
AGATCAAGAAGCCCCGGGTGGTGCTGGCACCCGAGGAGAAGGAGGCACTGCGGAAGGCCTATCAGCTGGAACCCTACCCCTCGCAGCAGA
CCATCGAGCTCCTCTCCTTCCAGCTCAACCTCAAGACCAACACCGTCATCAACTGGTTCCACAACTACAGGTCCCGGATGCGCCGGGAGA
TGTTGGTGGAGGGGACCCAGGATGAGCCAGACCTTGATCCAAGCGGGGGTCCTGGAATCCTACCGCCAGGCCACTCCCACCCAGACCCCA
CCCCGCAGAGCCCTGACTCTGAGACTGAGGACCAGAAGCCAACCGTGAAGGAACTGGAGCTTCAGGAGGGCCCTGAGGAGAACAGCACAC
CCCTGACCACCCAGGACAAGGCCCAAGTGAGGATCAAGCAGGAACAGATGGAGGAGGATGCTGAGGAAGAGGCAGGCAGCCAGCCCCAGG
ACTCAGGGGAGCTGGACAAAGGCCAAGGTCCCCCCAAAGAGGAGCATCCCGACCCTCCGGGTAATGATGGACTCCCAAAAGTGGCTCCCG
GGCCCCTCCTTCCAGGTGGATCCACCCCAGACTGTCCCTCACTTCATCCCCAACAGGAGAGTGAGGCCGGGGAGCGACTTCACCCGGACC
CTTTAAGTTTTAAGTCAGCCTCAGAGTCCTCACGCTGCAGCCTGGAGGTGTCACTGAACTCGCCCTCGGCCGCCTCCTCACCAGGCCTCA
TGATGTCTGTGTCACCTGTCCCCTCCTCCTCAGCTCCCATCTCCCCATCCCCACCTGGCGCCCCCCCTGCCAAAGTGCCGAGTGCCAGCC
CCACTGCTGACATGGCTGGAGCCTTGCACCCCAGTGCCAAGGTGAACCCCAACTTGCAGCGGCGGCATGAGAAGATGGCCAATCTGAACA
ACATCATTTACCGAGTAGAGCGGGCTGCCAATCGGGAGGAGGCCCTGGAGTGGGAGTTCTGAAGGCAGGGTGAGGGGGCAAGGGACATAC
CCTGGTAACTACCTTCCTTCTCGCACTTACTCTCCTCAACAGGATGGGGTAAGGGAGGGAGGAACTCAACCATCAAAATGTGGACAGCAA
TGTTATGCCGTTTACGTTTTTTGTTGTAATCCTAGTTCTATGAAGCTGTGTGAGCAGGTGGGTCAAATGCCATTGCCTCCACTTTTCTGC
ACCCCCCTGCTCCTCTTCACCCTGACCCCTCTGCAGGAGGCAGAAGCAAAATGGCACCACATATTCACCTGAAAACTCCAAACTCTTTTA
GAAAAATAAATAAATATTTATAGACCTCTTTTAGATATTTTAATAAAGGATCCTTTGGAATTTATCCCAGCTGATGCTGTTTTGATATTA
CAGAGAGTTATAAAATCAGGATGCTGTCACAACTGTTGCGAAGTATACACTGAAGTTGTGTCGTTTTTGCCACTAGATGAGATTAAAAGA
AGACAATTATTCAAAGCCATCACAAAACACTATAAGACTGACCAAAATTTAGATAACCTTTGAACCACGATTTTTTTCCACATCTGTCTG
TGAGACACAGCGCAATGCTACTGCCCTTCCAGAAACTGTGCTAAAAAGAGAAAGTCCAAAAGACTCTAAACAAAAACCTCGACGCCGTTG
AGGATGTGTTTCATTCTGGTGGTCTGTTTTGCAAGCTTGATAACAGAATGTCCGTGCCATTGTAAATGTTGTAGAGATGTGGGCCGTGGC
CCAACCGTCCTATATGAGATGTAGCATGGTACAGAACAAACTGCTTACACAGGTCTCACTAGTTAGAAACCTGTGGGCCATGGAGGTCAG
ACATCCATCTTGTCCATCTATAGGCAAGAAGTGTTTCCAGATCCTTTGGAAAGGTGGGCATGGGGCAGGTGCTTGGAGAGTGGCGTTTGA
GCCAGAGCGACCCCATTTCCCGTGTGAACCATAGGCACAACCCAGGAAGTTTCCCCACTTGTAGGAGTGTGGGTATTCCAGAGCAAGACT
GTGGCCACCATCTTCCCCTCTTGGTGTTTTCCGAAAGTGACAGTGTTGGTCATCCCATGACCACTGAAGCTTAGTAACCAGCGCCAAAAA
GTAGATTCATCAAACTAGAGACCCCAGCTCCCCTTCTCGCCATCTTCTTTCTCAAGTTGACCGTGGTGCTGTTTCTGGAAGGCATCTGCA
ACTCCAAGTCCATGCAGAACTCTGGAAGGCCAAGTTCATCGCAGCATGTTCACCATATCCCAGCCTCCAAATCTATCCTCCTACCTTCCA
ACGCATGACCTGTTGGGGAGCAGAGACTTAACCCCCAACTCAGAGGAACCCTTCCTCCAGCGTCTTTGGCATGGTTTCTAGGGTGAGAGT
TCCCAATTTGGATAGAACGGCCACCATATTGGTTACTGAATCTCTCTCCCTTGTTTTTATTACGTTTCCTTTTTCAAACTGTCCATGGGA
AGGCTGAATTGAGTGACTCCCCAGAATGAAGATGAGAAGGTGAATATAATCAATGCCAATGTAATGCCAGCGGGTGAGATGGCCGATGGA
GGTTTCAAAGATGTAGCTAGCATTTTGAAACCATATGGGCAAAACCCGGCAACCAGAAGGGGACAGATAAGGACCGTTCCAGAAATCCCA
ACTCTCACACCCAGCCCAGGCTGCAGTCTCCACACCAAACAGTCAACAAAACACAAACCCTGAAGGAAAACCTTTTCCATACACCCAGGC
TATGCATTGAAGAGTTTTCCACTGTATACATTTTTATCCAGATGAAGGTATTTTTATATTTTGACAATAGGAAACAGTGACCATTTTCAG
AGTAATCAAATCTGGAACAAATGAAACATCTTTTAGCCACCACCACCCTGTTGCAATTAAGACAACCGTGGGGGAACACACCACTTTTTA
CTGTTGAAACCAACACAACGTTGAAATCCAGGCTTATACGCAGACTCCGATTCCTAGAGAACTAAATTTGGCTTTAGTGTGACGGGATTT
GATTAAGCACTTAGTATAGTCTTTTGAACACGGAAATCCTGTTGTACTTAAAGCTAGCGGACCCGTGAACAACTTTGTCAGGTTCACGTC
CTATAACGGTTAAAAAACACACACACACATACACAAACCGTTTCTATGAGAGATTGATGAACTTTGTTTAAAATTTTAAAAAAAGGAACA

>In-frame_PTPN11_ENST00000351677_chr12_112910844_+_CUX2_ENST00000261726_chr12_111779584_+_4356nt
GGAGGAGCGAGCCGGGCCGGGGGGCAGCTGCACAGTCTCCGGGATCCCCAGGCCTGGAGGGGGGTCTGTGCGCGGCCGGCTGGCTCTGCC
CCGCGTCCGGTCCCGAGCGGGCCTCCCTCGGGCCAGCCCGATGTGACCGAGCCCAGCGGAGCCTGAGCAAGGAGCGGGTCCGTCGCGGAG
CCGGAGGGCGGGAGGAACATGACATCGCGGAGATGGTTTCACCCAAATATCACTGGTGTGGAGGCAGAAAACCTACTGTTGACAAGAGGA
GTTGATGGCAGTTTTTTGGCAAGGCCTAGTAAAAGTAACCCTGGAGACTTCACACTTTCCGTTAGAAGAAATGGAGCTGTCACCCACATC
AAGATTCAGAACACTGGTGATTACTATGACCTGTATGGAGGGGAGAAATTTGCCACTTTGGCTGAGTTGGTCCAGTATTACATGGAACAT
CACGGGCAATTAAAAGAGAAGAATGGAGATGTCATTGAGCTTAAATATCCTCTGAACTGTGCAGATCCTACCTCTGAAAGGTGGTTTCAT
GGACATCTCTCTGGGAAAGAAGCAGAGAAATTATTAACTGAAAAAGGAAAACATGGTAGTTTTCTTGTACGAGAGAGCCAGAGCCACCCT
GGAGATTTTGTTCTTTCTGTGCGCACTGGTGATGACAAAGGGGAGAGCAATGACGGCAAGTCTAAAGTGACCCATGTTATGATTCGCTGT
CAGGAACTGAAATACGACGTTGGTGGAGGAGAACGGTTTGATTCTTTGACAGATCTTGTGGAACATTATAAGAAGAATCCTATGGTGGAA
ACATTGGGTACAGTACTACAACTCAAGCAGCCCCTTAACACGACTCGTATAAATGCTGCTGAAATAGAAAGCAGAGTTCGAGAACTAAGC
AAATTAGCTGAGACCACAGATAAAGTCAAACAAGGCTTTTGGGAAGAATTTGAGACACTACAACAACAGGAGTGCAAACTTCTCTACAGC
CGAAAAGAGGGTCAAAGGCAAGAAAACAAAAACAAAAATAGATATAAAAACATCCTGCCCTCCTACCTGAAACGTCGCTATGGCCTCATC
AGCACCGGCTCAGACAGTGAGTCCCCGGCCACCCGCTCAGAGTGCCCCAGCCCCTGCCTGCAGCCCCAGGACCTGAGCCTCCTGCAGATC
AAGAAGCCCCGGGTGGTGCTGGCACCCGAGGAGAAGGAGGCACTGCGGAAGGCCTATCAGCTGGAACCCTACCCCTCGCAGCAGACCATC
GAGCTCCTCTCCTTCCAGCTCAACCTCAAGACCAACACCGTCATCAACTGGTTCCACAACTACAGGTCCCGGATGCGCCGGGAGATGTTG
GTGGAGGGGACCCAGGATGAGCCAGACCTTGATCCAAGCGGGGGTCCTGGAATCCTACCGCCAGGCCACTCCCACCCAGACCCCACCCCG
CAGAGCCCTGACTCTGAGACTGAGGACCAGAAGCCAACCGTGAAGGAACTGGAGCTTCAGGAGGGCCCTGAGGAGAACAGCACACCCCTG
ACCACCCAGGACAAGGCCCAAGTGAGGATCAAGCAGGAACAGATGGAGGAGGATGCTGAGGAAGAGGCAGGCAGCCAGCCCCAGGACTCA
GGGGAGCTGGACAAAGGCCAAGGTCCCCCCAAAGAGGAGCATCCCGACCCTCCGGGTAATGATGGACTCCCAAAAGTGGCTCCCGGGCCC
CTCCTTCCAGGTGGATCCACCCCAGACTGTCCCTCACTTCATCCCCAACAGGAGAGTGAGGCCGGGGAGCGACTTCACCCGGACCCTTTA
AGTTTTAAGTCAGCCTCAGAGTCCTCACGCTGCAGCCTGGAGGTGTCACTGAACTCGCCCTCGGCCGCCTCCTCACCAGGCCTCATGATG
TCTGTGTCACCTGTCCCCTCCTCCTCAGCTCCCATCTCCCCATCCCCACCTGGCGCCCCCCCTGCCAAAGTGCCGAGTGCCAGCCCCACT
GCTGACATGGCTGGAGCCTTGCACCCCAGTGCCAAGGTGAACCCCAACTTGCAGCGGCGGCATGAGAAGATGGCCAATCTGAACAACATC
ATTTACCGAGTAGAGCGGGCTGCCAATCGGGAGGAGGCCCTGGAGTGGGAGTTCTGAAGGCAGGGTGAGGGGGCAAGGGACATACCCTGG
TAACTACCTTCCTTCTCGCACTTACTCTCCTCAACAGGATGGGGTAAGGGAGGGAGGAACTCAACCATCAAAATGTGGACAGCAATGTTA
TGCCGTTTACGTTTTTTGTTGTAATCCTAGTTCTATGAAGCTGTGTGAGCAGGTGGGTCAAATGCCATTGCCTCCACTTTTCTGCACCCC
CCTGCTCCTCTTCACCCTGACCCCTCTGCAGGAGGCAGAAGCAAAATGGCACCACATATTCACCTGAAAACTCCAAACTCTTTTAGAAAA
ATAAATAAATATTTATAGACCTCTTTTAGATATTTTAATAAAGGATCCTTTGGAATTTATCCCAGCTGATGCTGTTTTGATATTACAGAG
AGTTATAAAATCAGGATGCTGTCACAACTGTTGCGAAGTATACACTGAAGTTGTGTCGTTTTTGCCACTAGATGAGATTAAAAGAAGACA
ATTATTCAAAGCCATCACAAAACACTATAAGACTGACCAAAATTTAGATAACCTTTGAACCACGATTTTTTTCCACATCTGTCTGTGAGA
CACAGCGCAATGCTACTGCCCTTCCAGAAACTGTGCTAAAAAGAGAAAGTCCAAAAGACTCTAAACAAAAACCTCGACGCCGTTGAGGAT
GTGTTTCATTCTGGTGGTCTGTTTTGCAAGCTTGATAACAGAATGTCCGTGCCATTGTAAATGTTGTAGAGATGTGGGCCGTGGCCCAAC
CGTCCTATATGAGATGTAGCATGGTACAGAACAAACTGCTTACACAGGTCTCACTAGTTAGAAACCTGTGGGCCATGGAGGTCAGACATC
CATCTTGTCCATCTATAGGCAAGAAGTGTTTCCAGATCCTTTGGAAAGGTGGGCATGGGGCAGGTGCTTGGAGAGTGGCGTTTGAGCCAG
AGCGACCCCATTTCCCGTGTGAACCATAGGCACAACCCAGGAAGTTTCCCCACTTGTAGGAGTGTGGGTATTCCAGAGCAAGACTGTGGC
CACCATCTTCCCCTCTTGGTGTTTTCCGAAAGTGACAGTGTTGGTCATCCCATGACCACTGAAGCTTAGTAACCAGCGCCAAAAAGTAGA
TTCATCAAACTAGAGACCCCAGCTCCCCTTCTCGCCATCTTCTTTCTCAAGTTGACCGTGGTGCTGTTTCTGGAAGGCATCTGCAACTCC
AAGTCCATGCAGAACTCTGGAAGGCCAAGTTCATCGCAGCATGTTCACCATATCCCAGCCTCCAAATCTATCCTCCTACCTTCCAACGCA
TGACCTGTTGGGGAGCAGAGACTTAACCCCCAACTCAGAGGAACCCTTCCTCCAGCGTCTTTGGCATGGTTTCTAGGGTGAGAGTTCCCA
ATTTGGATAGAACGGCCACCATATTGGTTACTGAATCTCTCTCCCTTGTTTTTATTACGTTTCCTTTTTCAAACTGTCCATGGGAAGGCT
GAATTGAGTGACTCCCCAGAATGAAGATGAGAAGGTGAATATAATCAATGCCAATGTAATGCCAGCGGGTGAGATGGCCGATGGAGGTTT
CAAAGATGTAGCTAGCATTTTGAAACCATATGGGCAAAACCCGGCAACCAGAAGGGGACAGATAAGGACCGTTCCAGAAATCCCAACTCT
CACACCCAGCCCAGGCTGCAGTCTCCACACCAAACAGTCAACAAAACACAAACCCTGAAGGAAAACCTTTTCCATACACCCAGGCTATGC
ATTGAAGAGTTTTCCACTGTATACATTTTTATCCAGATGAAGGTATTTTTATATTTTGACAATAGGAAACAGTGACCATTTTCAGAGTAA
TCAAATCTGGAACAAATGAAACATCTTTTAGCCACCACCACCCTGTTGCAATTAAGACAACCGTGGGGGAACACACCACTTTTTACTGTT
GAAACCAACACAACGTTGAAATCCAGGCTTATACGCAGACTCCGATTCCTAGAGAACTAAATTTGGCTTTAGTGTGACGGGATTTGATTA
AGCACTTAGTATAGTCTTTTGAACACGGAAATCCTGTTGTACTTAAAGCTAGCGGACCCGTGAACAACTTTGTCAGGTTCACGTCCTATA
ACGGTTAAAAAACACACACACACATACACAAACCGTTTCTATGAGAGATTGATGAACTTTGTTTAAAATTTTAAAAAAAGGAACACGTTC


Top

FusionGenePPI for PTPN11_CUX2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPN11SYNCRIP, EGFR, ERBB2, ERBB4, TREML1, BTLA, CSF2RB, STAT3, FRS2, IRS2, GRB2, ROS1, PDGFRB, STAT5A, STAT5B, INSR, CSF3R, JAK1, JAK2, IL4R, IL6ST, SOCS3, PLCG2, GAB2, IRS1, GAB3, IGF1R, PTK2, KIT, EPHA2, SLAMF1, INPP5D, PECAM1, SELE, GAB1, CAV1, CD33, BCAR1, C6orf25, EPOR, CDH5, CTNNB1, LAIR1, PILRA, FYN, CD84, LY9, PIK3R1, PRLR, SLAMF6, SOS1, MPZL1, SIGLEC11, PTK2B, GHR, CRKL, FCRL3, CEACAM1, SIT1, FCGR2B, PTPN11, CBL, SOCS1, ELAVL1, ERBB3, PAF1, CDC73, LEO1, CTR9, RTF1, WDR61, CBLB, CXCR4, LRRK1, MAP3K5, PIK3R2, CRK, CSF2RBP1, GSK3B, PPIF, FASN, RFWD2, CD274, VCAM1, IQCB1, MTPN, CHRAC1, EFHD2, MAPK14, OXCT1, RPIA, TRIM32, OVCA2, LGALS3, FCGR2A, FSD1, LGALS9, TCEAL1, CYP1A1, NTRK1, MAP2K1, STAMBP, LNX1, HIST1H2BG, FLT1, TXNIP, DNM2, PDGFRA, GAREML, LINC00673, PRPF19, SIRPA, FGFR2, FGFR4, KDR, TEK, DUSP13, SIGLEC5, NXT2, GPX7, GTF2E2, SNRNP27, THEMIS, PDCD1, FGB, LUM, TMEM220, NOSIP, MED21, PTPN6, AATK, ROR2, PTK7, EPHA1, GRASP, SRC, SIGLEC7, SIGLEC9, TRIM25, BEX1, BEX2, BLZF1, LINC01558, C9orf62, CTDSP1, DMRTC1, FAM71E1, GOLGA2, GTF2A2, NSUN5, NSUN5P2, ORMDL3, PLEKHA4, PNCK, POU2AF1, RANGRF, SERF2, SERPINF1, SRSF10, SLC38A1, SLN, STAT1, TLK1, TRMT2BCUX2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPN11_CUX2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTPN11_CUX2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTPN11C0028326Noonan Syndrome24CTD_human;ORPHANET;UNIPROT
HgenePTPN11C0175704LEOPARD Syndrome10CTD_human;ORPHANET;UNIPROT
HgenePTPN11C0349639Juvenile Myelomonocytic Leukemia4CTD_human;HPO;ORPHANET;UNIPROT
HgenePTPN11C0014084Enchondromatosis2CTD_human;HPO
HgenePTPN11C0001418Adenocarcinoma1CTD_human
HgenePTPN11C0004114Astrocytoma1CTD_human
HgenePTPN11C0007137Squamous cell carcinoma1CTD_human
HgenePTPN11C0015306Hereditary Multiple Exostoses1CTD_human
HgenePTPN11C0023418leukemia1CTD_human
HgenePTPN11C0027819Neuroblastoma1CTD_human
HgenePTPN11C0029423Cartilaginous exostosis1CTD_human
HgenePTPN11C0587248Costello syndrome (disorder)1CTD_human
HgenePTPN11C1275081Cardio-facio-cutaneous syndrome1CTD_human
TgeneCUX2C0005586Bipolar Disorder1PSYGENET
TgeneCUX2C1839839MAJOR AFFECTIVE DISORDER 21PSYGENET