FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29242

FusionGeneSummary for PSPC1_METTL21C

check button Fusion gene summary
Fusion gene informationFusion gene name: PSPC1_METTL21C
Fusion gene ID: 29242
HgeneTgene
Gene symbol

PSPC1

METTL21C

Gene ID

55269

196541

Gene nameparaspeckle component 1methyltransferase like 21C
SynonymsPSP1C13orf39
Cytomap

13q12.11

13q33.1

Type of geneprotein-codingprotein-coding
Descriptionparaspeckle component 1paraspeckle protein 1protein-lysine methyltransferase METTL21Cmethyltransferase-like protein 21C
Modification date2018052520180519
UniProtAcc

Q8WXF1

Q5VZV1

Ensembl transtripts involved in fusion geneENST00000338910, ENST00000497722, 
ENST00000267273, 
Fusion gene scores* DoF score4 X 4 X 4=641 X 1 X 1=1
# samples 51
** MAII scorelog2(5/64*10)=-0.356143810225275
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: PSPC1 [Title/Abstract] AND METTL21C [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePSPC1

GO:0002218

activation of innate immune response

28712728

TgeneMETTL21C

GO:0006479

protein methylation

22948820


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-GJ-A9DB-01APSPC1chr13

20356526

-METTL21Cchr13

103339407

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000338910ENST00000267273PSPC1chr13

20356526

-METTL21Cchr13

103339407

-
intron-3CDSENST00000497722ENST00000267273PSPC1chr13

20356526

-METTL21Cchr13

103339407

-

Top

FusionProtFeatures for PSPC1_METTL21C


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PSPC1

Q8WXF1

METTL21C

Q5VZV1

Regulates, cooperatively with NONO and SFPQ, androgenreceptor-mediated gene transcription activity in Sertoli cell line(By similarity). Binds to poly(A), poly(G) and poly(U) RNAhomopolymers. Regulates the circadian clock by repressing thetranscriptional activator activity of the CLOCK-ARNTL/BMAL1heterodimer (By similarity). Together with NONO, required for theformation of nuclear paraspeckles. Plays a role in the regulationof DNA virus-mediated innate immune response by assembling intothe HDP-RNP complex, a complex that serves as a platform for IRF3phosphorylation and subsequent innate immune response activationthrough the cGAS-STING pathway. {ECO:0000250|UniProtKB:Q8R326,ECO:0000269|PubMed:22416126, ECO:0000269|PubMed:28712728}. Protein-lysine methyltransferase.{ECO:0000269|PubMed:22948820}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMETTL21Cchr13:20356526chr13:103339407ENST00000267273-14120_12294265RegionS-adenosyl-L-methionine binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePSPC1chr13:20356526chr13:103339407ENST00000338910-19283_377124524Coiled coilOntology_term=ECO:0000255
HgenePSPC1chr13:20356526chr13:103339407ENST00000338910-19394_516124524Compositional biasNote=Gly-rich
HgenePSPC1chr13:20356526chr13:103339407ENST00000338910-19156_237124524DomainRRM 2
HgenePSPC1chr13:20356526chr13:103339407ENST00000338910-1982_154124524DomainRRM 1
HgenePSPC1chr13:20356526chr13:103339407ENST00000338910-19125_358124524RegionNote=Sufficient for paraspeckles localization


Top

FusionGeneSequence for PSPC1_METTL21C


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PSPC1_ENST00000338910_chr13_20356526_-_METTL21C_ENST00000267273_chr13_103339407_-_295aa
MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAPAPPEDHPDEEMGFTIDIKSFLKPGEKTYTQRCRLFVGNLP
TDITEEDFKRLFERTGEPSEVFINRDRGFGFIRLAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQ
YNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYTDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDTEFLDKFKQV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PSPC1_ENST00000338910_chr13_20356526_-_METTL21C_ENST00000267273_chr13_103339407_-_885nt
ATGATGTTAAGAGGAAACCTGAAGCAAGTGCGCATTGAGAAAAACCCGGCCCGCCTTCGCGCCCTGGAGTCCGCGGTGGGCGAGAGCGAG
CCGGCGGCCGCGGCAGCCATGGCGCTCGCTCTTGCCGGGGAGCCGGCACCGCCCGCGCCCGCGCCTCCAGAGGACCACCCGGACGAGGAG
ATGGGGTTCACTATCGACATCAAGAGTTTCCTCAAGCCGGGCGAGAAGACGTACACGCAGCGCTGCCGCCTCTTCGTGGGAAATCTGCCC
ACCGACATCACGGAGGAGGACTTCAAGAGGCTCTTCGAACGCTATGGCGAGCCCAGCGAAGTCTTCATCAACCGGGACCGTGGCTTCGGC
TTCATCCGCTTGGCTATGGCTTTGTGTCAATACTTGGAGGAACATGCCGAGGAATTGAATTTCCAAGATGCAAAAATACTTGAAATTGGT
GCCGGACCAGGCCTTGTTTCCATTGTGGCCAGTATTTTAGGAGCTCAAGTCACAGCAACAGATTTGCCTGATGTCCTGGGAAACCTTCAA
TACAATCTTTTAAAAAACACACTACAATGTACAGCACATCTGCCTGAAGTGAAAGAACTGGTATGGGGGGAAGACCTGGACAAAAACTTT
CCCAAGTCAGCTTTTTACTATGATTACGTCCTAGCCTCAGATGTGGTCTACCATCACTACTTCCTGGACAAGCTGCTCACCACCATGGTG
TACCTTTCCCAGCCAGGGACGGTGCTGCTTTGGGCAAACAAATTCAGGTTCAGCACCGACTATGAATTTTTAGATAAATTCAAGCAAGTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PSPC1_ENST00000338910_chr13_20356526_-_METTL21C_ENST00000267273_chr13_103339407_-_1332nt
CGTGAGTTGGGGGAGGACGGGTTGCCGACTCGCCTACCTAGCGGTCTCTTGATTGTCGATATTTTGTTGGCATAGGTTTATGTAGAGACG
TATACATATATATAGACACACTGTCTATAAATCTAGGCCTGTATCCGGTGTCCGAGGCGAACTCAGTAAGATGATGTTAAGAGGAAACCT
GAAGCAAGTGCGCATTGAGAAAAACCCGGCCCGCCTTCGCGCCCTGGAGTCCGCGGTGGGCGAGAGCGAGCCGGCGGCCGCGGCAGCCAT
GGCGCTCGCTCTTGCCGGGGAGCCGGCACCGCCCGCGCCCGCGCCTCCAGAGGACCACCCGGACGAGGAGATGGGGTTCACTATCGACAT
CAAGAGTTTCCTCAAGCCGGGCGAGAAGACGTACACGCAGCGCTGCCGCCTCTTCGTGGGAAATCTGCCCACCGACATCACGGAGGAGGA
CTTCAAGAGGCTCTTCGAACGCTATGGCGAGCCCAGCGAAGTCTTCATCAACCGGGACCGTGGCTTCGGCTTCATCCGCTTGGCTATGGC
TTTGTGTCAATACTTGGAGGAACATGCCGAGGAATTGAATTTCCAAGATGCAAAAATACTTGAAATTGGTGCCGGACCAGGCCTTGTTTC
CATTGTGGCCAGTATTTTAGGAGCTCAAGTCACAGCAACAGATTTGCCTGATGTCCTGGGAAACCTTCAATACAATCTTTTAAAAAACAC
ACTACAATGTACAGCACATCTGCCTGAAGTGAAAGAACTGGTATGGGGGGAAGACCTGGACAAAAACTTTCCCAAGTCAGCTTTTTACTA
TGATTACGTCCTAGCCTCAGATGTGGTCTACCATCACTACTTCCTGGACAAGCTGCTCACCACCATGGTGTACCTTTCCCAGCCAGGGAC
GGTGCTGCTTTGGGCAAACAAATTCAGGTTCAGCACCGACTATGAATTTTTAGATAAATTCAAGCAAGTTTTTGACACAACACTGTTGGC
TGAATATCCAGAGTCATCAGTCAAACTTTTTAAGGGGATACTAAAATGGGACTAAATCCAACAAAATGCCTTTCACAACGTTACTGTGTC
TTTTGAGCAATGTGTTAGAAATTGCTTTGGTAATAGACTTCTTTCACAGGATTGAGAAGGTAGTGCATAGAAACAACTTGTATACTTGGA
ACAAATGTAACAATACTGCAGAAACTTTCTAATTTCTAAGATAATTTAAGATTATCTGGTTAATCTAAATATCTAAAAAGAACAACATAA


Top

FusionGenePPI for PSPC1_METTL21C


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PSPC1AR, LRIF1, NONO, TADA2A, AGO3, RAD21, NR2C1, CUL3, SMAD2, SMAD3, RANBP17, TNN, TCERG1, WBP4, FUS, KRT31, KRTAP13-1, CUL7, OBSL1, EED, BMI1, EGFR, ESR1, ORC6, CEP170, TRPV5, RPS6KB2, DNAJB4, EIF4H, HIP1R, LZTFL1, PPP5C, U2AF2, TATDN1, WDR12, NTRK1, SCARNA22, IFI16, SFPQ, CCDC22, STYX, CD2BP2, DLD, PDHA1METTL21CCARM1, CCDC88A, CCT3, DYNC1H1, GTF3C4, HSPA1L, HSPA5, HSPA8, KDM1A, MAD1L1, METTL21A, TUBB2A, TUBGCP2, UBB, UBC, TCEB1, BCKDK


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PSPC1_METTL21C


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PSPC1_METTL21C


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource