FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28961

FusionGeneSummary for PRRC2A_COL1A1

check button Fusion gene summary
Fusion gene informationFusion gene name: PRRC2A_COL1A1
Fusion gene ID: 28961
HgeneTgene
Gene symbol

PRRC2A

COL1A1

Gene ID

7916

1277

Gene nameproline rich coiled-coil 2Acollagen type I alpha 1 chain
SynonymsBAT2|D6S51|D6S51E|G2EDSARTH1|EDSC|OI1|OI2|OI3|OI4
Cytomap

6p21.33

17q21.33

Type of geneprotein-codingprotein-coding
Descriptionprotein PRRC2AHLA-B-associated transcript 2large proline-rich protein BAT2proline-rich and coiled-coil-containing protein 2Aprotein G2collagen alpha-1(I) chainalpha-1 type I collagenalpha1(I) procollagencollagen alpha 1 chain type Icollagen alpha-1(I) chain preproproteincollagen of skin, tendon and bone, alpha-1 chaincollagen, type I, alpha 1pro-alpha-1 collagen type 1type I pro
Modification date2018052320180527
UniProtAcc

P48634

P02452

Ensembl transtripts involved in fusion geneENST00000376007, ENST00000469577, 
ENST00000376033, ENST00000549037, 
ENST00000551794, ENST00000435971, 
ENST00000485195, ENST00000428775, 
ENST00000550674, ENST00000548373, 
ENST00000439762, ENST00000416335, 
ENST00000473169, ENST00000550109, 
ENST00000550609, ENST00000454306, 
ENST00000468994, ENST00000432252, 
ENST00000551341, ENST00000547457, 
ENST00000383464, ENST00000470109, 
ENST00000383455, ENST00000547056, 
ENST00000549383, ENST00000458561, 
ENST00000466607, ENST00000414956, 
ENST00000547669, ENST00000549768, 
ENST00000430737, ENST00000484613, 
ENST00000422962, 
ENST00000225964, 
Fusion gene scores* DoF score8 X 8 X 5=32025 X 35 X 6=5250
# samples 839
** MAII scorelog2(8/320*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(39/5250*10)=-3.75077139369124
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PRRC2A [Title/Abstract] AND COL1A1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCOL1A1

GO:0010718

positive regulation of epithelial to mesenchymal transition

20018240

TgeneCOL1A1

GO:0030335

positive regulation of cell migration

20018240

TgeneCOL1A1

GO:0034504

protein localization to nucleus

20018240

TgeneCOL1A1

GO:0045893

positive regulation of transcription, DNA-templated

20018240

TgeneCOL1A1

GO:0090263

positive regulation of canonical Wnt signaling pathway

20018240


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-34-5928-01APRRC2Achr6

31602951

+COL1A1chr17

48267269

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000376007ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000469577ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
In-frameENST00000376033ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000549037ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000551794ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000435971ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000485195ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000428775ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000550674ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000548373ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000439762ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000416335ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000473169ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000550109ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000550609ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000454306ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000468994ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000432252ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000551341ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000547457ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000383464ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000470109ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000383455ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000547056ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000549383ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000458561ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000466607ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000414956ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000547669ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000549768ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000430737ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000484613ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-
intron-3CDSENST00000422962ENST00000225964PRRC2Achr6

31602951

+COL1A1chr17

48267269

-

Top

FusionProtFeatures for PRRC2A_COL1A1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PRRC2A

P48634

COL1A1

P02452


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCOL1A1chr6:31602951chr17:48267269ENST00000225964-35511229_14648531465DomainFibrillar collagen NC1
TgeneCOL1A1chr6:31602951chr17:48267269ENST00000225964-35511093_10958531465MotifCell attachment site
TgeneCOL1A1chr6:31602951chr17:48267269ENST00000225964-35511193_12188531465RegionNote=Nonhelical region (C-terminal)

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1311139_1142-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1311239_1244-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1311355_1360-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1311413_1421-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1311451_1457-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131466_471-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131472_475-682158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131658_669-682158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131696_700-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131826_833-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131913_916-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131955_958-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1311139_1142-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1311239_1244-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1311355_1360-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1311413_1421-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1311451_1457-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131466_471-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131472_475-782158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131658_669-782158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131696_700-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131826_833-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131913_916-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131955_958-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1311139_1142-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1311239_1244-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1311355_1360-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1311413_1421-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1311451_1457-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131466_471-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131472_475-782158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131658_669-782158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131696_700-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131826_833-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131913_916-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131955_958-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1311139_1142-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1311239_1244-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1311355_1360-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1311413_1421-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1311451_1457-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131466_471-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131472_475-682158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131658_669-682158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131696_700-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131826_833-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131913_916-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131955_958-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1311139_1142-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1311239_1244-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1311355_1360-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1311413_1421-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1311451_1457-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131466_471-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131472_475-782158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131658_669-782158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131696_700-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131826_833-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131913_916-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131955_958-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1311139_1142-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1311239_1244-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1311355_1360-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1311413_1421-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1311451_1457-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131466_471-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131472_475-782158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131658_669-782158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131696_700-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131826_833-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131913_916-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131955_958-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1311139_1142-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1311239_1244-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1311355_1360-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1311413_1421-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1311451_1457-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131466_471-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131472_475-782158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131658_669-782158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131696_700-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131826_833-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131913_916-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131955_958-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1311139_1142-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1311239_1244-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1311355_1360-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1311413_1421-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1311451_1457-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131466_471-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131472_475-782158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131658_669-782158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131696_700-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131826_833-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131913_916-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131955_958-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1311139_1142-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1311239_1244-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1311355_1360-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1311413_1421-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1311451_1457-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131466_471-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131472_475-682158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131658_669-682158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131696_700-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131826_833-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131913_916-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131955_958-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1311139_1142-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1311239_1244-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1311355_1360-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1311413_1421-782158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1311451_1457-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131466_471-782158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131472_475-782158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131658_669-782158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131696_700-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131826_833-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131913_916-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131955_958-782158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1311139_1142-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1311239_1244-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1311355_1360-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1311413_1421-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1311451_1457-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131466_471-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131472_475-682158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131658_669-682158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131696_700-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131826_833-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131913_916-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131955_958-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1311139_1142-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1311239_1244-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1311355_1360-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1311413_1421-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1311451_1457-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131466_471-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131472_475-682158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131658_669-682158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131696_700-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131826_833-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131913_916-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131955_958-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1311139_1142-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1311239_1244-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1311355_1360-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1311413_1421-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1311451_1457-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131466_471-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131472_475-682158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131658_669-682158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131696_700-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131826_833-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131913_916-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131955_958-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1311139_1142-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1311239_1244-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1311355_1360-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1311413_1421-682158Compositional biasNote=Poly-Gly
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1311451_1457-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131466_471-682158Compositional biasNote=Poly-Arg
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131472_475-682158Compositional biasNote=Poly-Glu
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131658_669-682158Compositional biasNote=Poly-Gln
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131696_700-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131826_833-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131913_916-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131955_958-682158Compositional biasNote=Poly-Pro
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1311916_2106-682158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131337_561-682158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+13141_1812-682158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1311916_2106-782158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131337_561-782158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+13141_1812-782158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1311916_2106-782158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131337_561-782158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+13141_1812-782158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1311916_2106-682158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131337_561-682158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+13141_1812-682158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1311916_2106-782158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131337_561-782158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+13141_1812-782158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1311916_2106-782158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131337_561-782158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+13141_1812-782158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1311916_2106-782158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131337_561-782158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+13141_1812-782158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1311916_2106-782158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131337_561-782158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+13141_1812-782158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1311916_2106-682158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131337_561-682158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+13141_1812-682158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1311916_2106-782158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131337_561-782158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+13141_1812-782158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1311916_2106-682158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131337_561-682158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+13141_1812-682158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1311916_2106-682158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131337_561-682158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+13141_1812-682158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1311916_2106-682158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131337_561-682158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+13141_1812-682158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1311916_2106-682158RegionNote=3 X 50 AA type C repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131337_561-682158RegionNote=2 X type B repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+13141_1812-682158RegionNote=4 X 57 AA type A repeats
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1311757_1812-682158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1311916_1965-682158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1311982_2031-682158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+1312057_2106-682158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131281_337-682158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131337_430-682158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+13141_95-682158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+131488_561-682158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376007+13198_154-682158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1311757_1812-782158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1311916_1965-782158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1311982_2031-782158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+1312057_2106-782158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131281_337-782158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131337_430-782158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+13141_95-782158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+131488_561-782158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000376033+13198_154-782158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1311757_1812-782158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1311916_1965-782158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1311982_2031-782158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+1312057_2106-782158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131281_337-782158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131337_430-782158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+13141_95-782158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+131488_561-782158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383455+13198_154-782158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1311757_1812-682158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1311916_1965-682158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1311982_2031-682158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+1312057_2106-682158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131281_337-682158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131337_430-682158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+13141_95-682158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+131488_561-682158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000383464+13198_154-682158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1311757_1812-782158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1311916_1965-782158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1311982_2031-782158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+1312057_2106-782158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131281_337-782158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131337_430-782158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+13141_95-782158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+131488_561-782158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000414956+13198_154-782158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1311757_1812-782158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1311916_1965-782158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1311982_2031-782158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+1312057_2106-782158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131281_337-782158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131337_430-782158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+13141_95-782158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+131488_561-782158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000416335+13198_154-782158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1311757_1812-782158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1311916_1965-782158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1311982_2031-782158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+1312057_2106-782158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131281_337-782158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131337_430-782158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+13141_95-782158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+131488_561-782158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000422962+13198_154-782158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1311757_1812-782158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1311916_1965-782158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1311982_2031-782158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+1312057_2106-782158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131281_337-782158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131337_430-782158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+13141_95-782158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+131488_561-782158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000428775+13198_154-782158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1311757_1812-682158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1311916_1965-682158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1311982_2031-682158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+1312057_2106-682158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131281_337-682158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131337_430-682158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+13141_95-682158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+131488_561-682158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000430737+13198_154-682158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1311757_1812-782158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1311916_1965-782158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1311982_2031-782158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+1312057_2106-782158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131281_337-782158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131337_430-782158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+13141_95-782158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+131488_561-782158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000432252+13198_154-782158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1311757_1812-682158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1311916_1965-682158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1311982_2031-682158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+1312057_2106-682158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131281_337-682158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131337_430-682158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+13141_95-682158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+131488_561-682158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000435971+13198_154-682158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1311757_1812-682158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1311916_1965-682158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1311982_2031-682158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+1312057_2106-682158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131281_337-682158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131337_430-682158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+13141_95-682158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+131488_561-682158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000439762+13198_154-682158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1311757_1812-682158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1311916_1965-682158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1311982_2031-682158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+1312057_2106-682158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131281_337-682158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131337_430-682158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+13141_95-682158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+131488_561-682158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000454306+13198_154-682158RepeatNote=1-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1311757_1812-682158RepeatNote=1-4
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1311916_1965-682158RepeatNote=3-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1311982_2031-682158RepeatNote=3-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+1312057_2106-682158RepeatNote=3-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131281_337-682158RepeatNote=1-3
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131337_430-682158RepeatNote=2-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+13141_95-682158RepeatNote=1-1
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+131488_561-682158RepeatNote=2-2
HgenePRRC2Achr6:31602951chr17:48267269ENST00000458561+13198_154-682158RepeatNote=1-2
TgeneCOL1A1chr6:31602951chr17:48267269ENST00000225964-355138_968531465DomainVWFC
TgeneCOL1A1chr6:31602951chr17:48267269ENST00000225964-3551745_7478531465MotifCell attachment site
TgeneCOL1A1chr6:31602951chr17:48267269ENST00000225964-3551162_1788531465RegionNote=Nonhelical region (N-terminal)
TgeneCOL1A1chr6:31602951chr17:48267269ENST00000225964-3551179_11928531465RegionNote=Triple-helical region


Top

FusionGeneSequence for PRRC2A_COL1A1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PRRC2A_ENST00000376007_chr6_31602951_+_COL1A1_ENST00000225964_chr17_48267269_-_2379aa
MSDRSGPTAKGKDGKKTSSLNLFDTTKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQ
EQSDPKSSDASTAQPPESQPLPASQTPASNQPKRPPAAPENTPLVPSGVKSWAQASVTHGAHGDGGRASSLLSRFSREEFPTLQAAGDQD
KAAKERESAEQSSGPGPSLRPQNSTTWRDGGGRGPDELEGPDSKLHHGHDPRGGLQPSGPPQFPPYRGMMPPFMTPPTLPFPPPTGPQGP
YRYPTPDGPSRFPRVAGPRGSGPPMRLVEPVGRPSILKEDNLKEFDQLDQENDDGWAGAHEEVDYTEKLKFSDEEDGRDSDEEGAEGHRD
SQSASGEERPPEADGKKGNSPNSEPPTPKTAWAETSRPPETEPGPPAPKPPLPPPHRGPAGNWGPPGDYPDRGGPPCKPPAPEDEDEAWR
QRRKQSSSEISLAVERARRRREEEERRMQEERRAACAEKLKRLDEKFGAPDKRLKAEPAAPPAAPSTPAPPPAVPKELPAPPAPPPASAP
TPETEPEEPAQAPPAQSTPTPGVAAAPTLVSGGGSTSSTSSGSFEASPVEPQLPSKEGPEPPEEVPPPTTPPVPKVEPKGDGIGPTRQPP
SQGLGYPKTQKSLPPRFQRQQQEQLLKQQQQHQWQQHQQGSAPPTPVPPSPPQPVTLGAVPAPQAPPPPPKALYPGALGRPPPMPPMNFD
PRWMMIPPTVDPRLLQGRPPLDFYPPGVHPSGLVPRERSDSGGSSSEPFDRHAPAMLRERGTPPVDPKLAWVGDVFTATPAEPRPLTSPL
RQAADEDDKGMRSETPPVPPPPPTLASTPGFPENGAPGPPISRFPLEEPGPRPLPWPPGSDEVAKIQTPPPKKEPPKEETAQLTGPEAGR
KPARGVGSGGQGPPPPRRESRTETRWGPRPGSSRRGIPPEEPGAPPRRAGPIKKPPPPTKVEELPPKPLEQGDETPKPPKPDPLKITKGK
LGGPKETPPNGNLSPAPRLRRDTSTERVGPTSCRGRGRGETFARGRGFRGTTGGRGRGARSREFRSYREFRGDDGRGGGTGGPNHPPAPR
GRTASETRSEGSETEEIPKRRRQRGSETGSETHESDLAPSDKEAPTPKEGTLTQVPLAPPPPGAPPSPAPARFTARGGRVFTPRGVPSRR
GRGGGRPPPQVCPGWSPPAKSLAPKKPPTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGERPRRRRHGRAQQQDKPPRFRRL
KQERENAARGSEGKPSLTLPASAPGPEEALTTVTVAPAPRRAAAKSPDLSNQNSDQANEEWETASESSDFTSERRGDKEAPPPVLLTPKA
VGTPGGGGGGAVPGISAMSRGDLSQRAKDLSKRSFSSQRPGMERQNRRPGPGGKAGSSGSSSGGGGGGPGGRTGPGRGDKRSWPSPKNRS
RPPEERPPGLPLPPPPPSSSAVFRLDQVIHSNPAGIQQALAQLSSRQGSVTAPGGHPRHKPGLPQAPQGPSPRPPTRYEPQRVNSGLSSD
PHFEEPGPMVRGVGGTPRDSAGVSPFPPKRRERPPRKPELLQEESLPPPHSSGFLGSKPEGPGPQAESRDTGTEALTPHIWNRLHTATSR
KSYRPSSMEPWMEPLSPFEDVAGTEMSQSDSGVDLSGDSQVSSGPCSQRSSPDGGLKGAAEGPPKRPGGSSPLNAVPCEGPPGSEPPRRP
PPAPHDGDRKELPREQPLPPGPIGTERSQRTDRGTEPGPIRPSHRPGPPVQFGTSDKGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPP
GPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLP
GPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDR
GETGPAGPTGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLN
GLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIR
SPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQF
ETGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTV

>In-frame_PRRC2A_ENST00000376033_chr6_31602951_+_COL1A1_ENST00000225964_chr17_48267269_-_2379aa
MSDRSGPTAKGKDGKKTSSLNLFDTTKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQ
EQSDPKSSDASTAQPPESQPLPASQTPASNQPKRPPAAPENTPLVPSGVKSWAQASVTHGAHGDGGRASSLLSRFSREEFPTLQAAGDQD
KAAKERESAEQSSGPGPSLRPQNSTTWRDGGGRGPDELEGPDSKLHHGHDPRGGLQPSGPPQFPPYRGMMPPFMTPPTLPFPPPTGPQGP
YRYPTPDGPSRFPRVAGPRGSGPPMRLVEPVGRPSILKEDNLKEFDQLDQENDDGWAGAHEEVDYTEKLKFSDEEDGRDSDEEGAEGHRD
SQSASGEERPPEADGKKGNSPNSEPPTPKTAWAETSRPPETEPGPPAPKPPLPPPHRGPAGNWGPPGDYPDRGGPPCKPPAPEDEDEAWR
QRRKQSSSEISLAVERARRRREEEERRMQEERRAACAEKLKRLDEKFGAPDKRLKAEPAAPPAAPSTPAPPPAVPKELPAPPAPPPASAP
TPETEPEEPAQAPPAQSTPTPGVAAAPTLVSGGGSTSSTSSGSFEASPVEPQLPSKEGPEPPEEVPPPTTPPVPKVEPKGDGIGPTRQPP
SQGLGYPKTQKSLPPRFQRQQQEQLLKQQQQHQWQQHQQGSAPPTPVPPSPPQPVTLGAVPAPQAPPPPPKALYPGALGRPPPMPPMNFD
PRWMMIPPTVDPRLLQGRPPLDFYPPGVHPSGLVPRERSDSGGSSSEPFDRHAPAMLRERGTPPVDPKLAWVGDVFTATPAEPRPLTSPL
RQAADEDDKGMRSETPPVPPPPPTLASTPGFPENGAPGPPISRFPLEEPGPRPLPWPPGSDEVAKIQTPPPKKEPPKEETAQLTGPEAGR
KPARGVGSGGQGPPPPRRESRTETRWGPRPGSSRRGIPPEEPGAPPRRAGPIKKPPPPTKVEELPPKPLEQGDETPKPPKPDPLKITKGK
LGGPKETPPNGNLSPAPRLRRDTSTERVGPTSCRGRGRGETFARGRGFRGTTGGRGRGARSREFRSYREFRGDDGRGGGTGGPNHPPAPR
GRTASETRSEGSETEEIPKRRRQRGSETGSETHESDLAPSDKEAPTPKEGTLTQVPLAPPPPGAPPSPAPARFTARGGRVFTPRGVPSRR
GRGGGRPPPQVCPGWSPPAKSLAPKKPPTGPLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGERPRRRRHGRAQQQDKPPRFRRL
KQERENAARGSEGKPSLTLPASAPGPEEALTTVTVAPAPRRAAAKSPDLSNQNSDQANEEWETASESSDFTSERRGDKEAPPPVLLTPKA
VGTPGGGGGGAVPGISAMSRGDLSQRAKDLSKRSFSSQRPGMERQNRRPGPGGKAGSSGSSSGGGGGGPGGRTGPGRGDKRSWPSPKNRS
RPPEERPPGLPLPPPPPSSSAVFRLDQVIHSNPAGIQQALAQLSSRQGSVTAPGGHPRHKPGLPQAPQGPSPRPPTRYEPQRVNSGLSSD
PHFEEPGPMVRGVGGTPRDSAGVSPFPPKRRERPPRKPELLQEESLPPPHSSGFLGSKPEGPGPQAESRDTGTEALTPHIWNRLHTATSR
KSYRPSSMEPWMEPLSPFEDVAGTEMSQSDSGVDLSGDSQVSSGPCSQRSSPDGGLKGAAEGPPKRPGGSSPLNAVPCEGPPGSEPPRRP
PPAPHDGDRKELPREQPLPPGPIGTERSQRTDRGTEPGPIRPSHRPGPPVQFGTSDKGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPP
GPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLP
GPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDR
GETGPAGPTGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLN
GLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIR
SPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQF
ETGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PRRC2A_ENST00000376007_chr6_31602951_+_COL1A1_ENST00000225964_chr17_48267269_-_7137nt
ATGTCCGATCGCTCGGGGCCGACTGCCAAGGGAAAGGATGGAAAGAAGTATTCCTCGCTCAACCTGTTTGATACGTATAAGGGCAAGTCC
TTAGAGATCCAGAAACCCGCTGTTGCCCCTCGCCATGGCCTGCAGAGTCTCGGGAAAGTTGCCATTGCCCGGCGTATGCCACCTCCAGCC
AACCTTCCAAGCCTGAAAGCCGAGAACAAAGGCAATGACCCCAATGTCTCACTAGTGCCAAAAGACGGAACAGGATGGGCAAGCAAACAG
GAGCAGTCCGACCCCAAGAGTTCCGATGCCTCAACCGCTCAGCCGCCGGAATCGCAGCCACTGCCGGCTTCACAGACGCCTGCCTCCAAC
CAGCCGAAACGACCCCCAGCAGCCCCCGAGAACACTCCTTTGGTTCCAAGCGGGGTAAAGTCCTGGGCACAAGCCAGCGTCACCCATGGA
GCACATGGAGATGGTGGAAGGGCATCAAGCCTACTGTCACGATTCTCTCGAGAGGAATTTCCGACCCTGCAGGCGGCTGGCGACCAGGAC
AAGGCTGCCAAGGAAAGGGAGTCTGCCGAACAGTCGTCTGGGCCCGGACCAAGCCTCCGCCCCCAAAATTCTACAACTTGGAGGGACGGA
GGTGGGCGTGGCCCTGATGAGCTGGAGGGCCCGGACTCCAAACTTCATCATGGTCATGATCCCCGGGGTGGGCTACAGCCTTCAGGCCCA
CCCCAGTTCCCTCCCTACCGCGGAATGATGCCGCCTTTCATGTATCCCCCATATCTCCCGTTCCCTCCGCCCTATGGACCCCAGGGGCCT
TACCGATACCCCACTCCTGATGGGCCCAGCCGTTTTCCCCGTGTGGCGGGCCCCCGAGGCTCAGGGCCACCAATGCGCTTAGTAGAGCCT
GTGGGTCGTCCCTCTATTCTCAAAGAGGATAATCTCAAAGAGTTTGATCAGTTGGATCAGGAGAATGATGATGGTTGGGCAGGGGCCCAT
GAAGAGGTTGACTACACTGAAAAGCTCAAGTTCAGCGATGAGGAAGATGGGCGAGACTCTGATGAGGAGGGTGCTGAGGGCCACAGGGAT
TCCCAATCAGCTTCTGGTGAGGAACGGCCCCCTGAAGCAGATGGCAAAAAGGGCAACTCCCCCAACAGCGAACCGCCCACTCCTAAGACG
GCCTGGGCAGAAACCTCTCGGCCTCCAGAGACAGAGCCGGGACCTCCTGCCCCAAAGCCTCCCCTACCCCCACCTCACCGGGGCCCCGCC
GGGAACTGGGGCCCCCCTGGGGACTACCCAGATCGTGGGGGTCCTCCCTGCAAGCCCCCAGCACCTGAAGATGAGGATGAGGCATGGCGG
CAGCGACGAAAGCAGTCGTCATCTGAGATTTCCCTGGCAGTGGAGCGGGCCCGGCGACGGCGAGAAGAAGAGGAGCGGCGCATGCAAGAA
GAGCGCCGGGCAGCCTGTGCTGAGAAGCTCAAGCGACTCGATGAAAAGTTTGGGGCACCTGACAAGCGGCTCAAAGCAGAGCCTGCTGCC
CCACCTGCTGCCCCTTCTACCCCAGCTCCACCACCTGCAGTCCCTAAAGAACTCCCTGCACCTCCAGCTCCACCTCCAGCATCAGCCCCA
ACACCAGAGACAGAACCTGAAGAGCCAGCACAGGCCCCTCCTGCCCAATCTACTCCTACTCCAGGTGTGGCTGCGGCTCCCACTCTGGTG
AGTGGTGGTGGCAGTACCAGTAGCACCAGCAGTGGCAGCTTCGAAGCCAGCCCAGTGGAACCACAACTGCCCTCAAAAGAGGGTCCTGAA
CCACCAGAAGAGGTTCCTCCTCCTACCACACCCCCAGTTCCAAAGGTGGAACCCAAGGGTGATGGGATTGGTCCCACCCGCCAGCCCCCT
AGTCAGGGCTTGGGCTACCCCAAATATCAGAAGTCGTTGCCTCCTCGTTTCCAGCGGCAGCAGCAGGAGCAGCTCCTGAAGCAGCAGCAG
CAGCACCAGTGGCAGCAGCATCAACAGGGCTCTGCCCCTCCTACCCCAGTGCCCCCATCACCACCACAGCCTGTGACCCTGGGGGCTGTG
CCAGCTCCACAGGCTCCACCCCCGCCCCCCAAGGCCCTGTACCCAGGTGCTCTGGGCCGGCCCCCACCCATGCCCCCAATGAACTTTGAT
CCCCGATGGATGATGATTCCTCCTTATGTGGACCCCCGGCTCCTCCAGGGTCGTCCCCCTCTAGACTTCTACCCTCCTGGTGTGCATCCC
TCTGGCCTAGTTCCCCGAGAGCGTTCAGACAGTGGGGGCTCAAGCTCAGAGCCATTTGACCGTCATGCACCTGCTATGTTACGGGAACGG
GGCACTCCACCGGTGGATCCAAAGTTGGCCTGGGTAGGAGATGTCTTCACCGCCACACCCGCTGAACCCCGCCCACTTACCTCACCTCTG
CGCCAGGCTGCGGATGAGGATGACAAGGGGATGAGGAGCGAGACTCCTCCAGTACCTCCCCCACCACCCTATCTGGCCAGTTATCCAGGC
TTTCCTGAGAATGGAGCCCCTGGGCCCCCAATCTCTCGCTTTCCTCTGGAGGAACCAGGGCCCCGTCCACTCCCCTGGCCCCCAGGCAGT
GATGAAGTGGCCAAGATACAAACTCCACCACCCAAGAAGGAGCCCCCTAAGGAGGAGACTGCACAGCTGACGGGGCCAGAAGCAGGCCGA
AAGCCTGCCCGCGGAGTCGGGAGTGGAGGCCAGGGCCCCCCACCACCACGCAGAGAGAGTCGCACAGAGACCCGCTGGGGCCCTCGTCCA
GGGAGCAGTCGTCGTGGAATCCCTCCAGAGGAGCCAGGGGCCCCACCCCGCCGGGCTGGGCCTATAAAGAAACCTCCACCACCTACAAAA
GTAGAAGAGCTGCCTCCCAAGCCCCTCGAACAGGGGGATGAAACCCCCAAACCCCCAAAGCCAGACCCACTCAAGATAACCAAGGGGAAG
CTAGGGGGCCCCAAGGAGACCCCACCCAATGGAAATCTTTCCCCTGCCCCAAGGCTTCGGAGGGACTATTCGTATGAAAGAGTGGGTCCT
ACCTCTTGCCGGGGTCGGGGCCGAGGCGAGTATTTTGCCAGAGGGAGGGGTTTTCGGGGGACCTATGGGGGACGAGGGCGGGGAGCCCGA
AGCCGGGAATTCCGCAGTTACCGAGAGTTTCGAGGAGATGATGGGCGTGGAGGTGGGACAGGGGGACCAAACCACCCTCCTGCTCCCCGA
GGCCGCACTGCCAGCGAGACACGGAGCGAGGGTTCAGAGTATGAGGAAATCCCCAAGCGGCGCCGGCAGCGGGGCTCAGAAACAGGCAGC
GAGACCCATGAGAGTGATCTGGCTCCTTCAGACAAGGAGGCTCCCACACCCAAGGAGGGAACACTCACCCAGGTCCCTCTCGCTCCCCCA
CCACCAGGAGCCCCACCTTCACCAGCCCCAGCCCGCTTCACTGCCCGGGGTGGGCGAGTCTTCACTCCCAGAGGGGTGCCATCTCGCCGG
GGCCGAGGAGGAGGGAGGCCCCCTCCTCAAGTTTGCCCAGGCTGGAGCCCTCCAGCCAAGTCTCTGGCTCCCAAGAAACCTCCCACAGGC
CCTTTGCCACCAAGTAAGGAGCCTTTGAAAGAGAAGTTGATCCCAGGGCCTCTGTCCCCTGTGGCGCGCGGAGGCAGCAATGGAGGTAGC
AATGTGGGCATGGAAGATGGGGAGCGACCCCGAAGGAGGCGACATGGGAGGGCTCAGCAGCAGGATAAACCGCCTCGTTTCCGGAGGCTG
AAGCAGGAACGGGAGAATGCCGCAAGGGGGTCTGAGGGCAAGCCCTCCCTAACCCTTCCAGCCTCCGCTCCTGGACCTGAGGAGGCCCTC
ACAACAGTCACAGTGGCCCCAGCACCTCGCCGGGCAGCTGCCAAGTCTCCTGATCTGTCAAACCAGAACTCAGACCAAGCCAATGAGGAA
TGGGAGACTGCATCAGAGAGCAGTGACTTCACCAGTGAGCGCCGAGGGGACAAAGAGGCACCCCCACCAGTACTGCTGACACCCAAGGCT
GTGGGAACTCCTGGGGGAGGTGGAGGTGGAGCCGTACCAGGTATTTCAGCCATGTCCCGCGGAGATCTGAGCCAGAGAGCCAAGGATTTG
AGTAAACGGAGCTTCTCAAGTCAGCGGCCAGGCATGGAACGGCAGAATCGGCGCCCTGGCCCAGGGGGCAAGGCTGGCAGCAGTGGCAGC
AGCAGTGGAGGAGGCGGTGGGGGTCCTGGAGGAAGGACCGGGCCAGGACGAGGCGACAAGAGGAGCTGGCCCTCTCCCAAGAACCGAAGT
CGTCCTCCAGAGGAGCGTCCCCCGGGGCTTCCCCTGCCTCCCCCACCTCCCAGCAGTTCTGCTGTCTTCCGCCTGGACCAAGTTATCCAC
AGCAACCCTGCTGGCATCCAACAGGCTCTGGCCCAGCTTAGTAGCCGTCAAGGGAGTGTAACTGCACCAGGGGGTCATCCAAGGCACAAG
CCTGGGCTTCCCCAAGCCCCTCAGGGCCCCTCTCCTAGGCCCCCAACCCGATACGAGCCCCAGAGGGTCAACAGCGGCCTCAGTTCTGAC
CCCCACTTTGAGGAGCCGGGGCCAATGGTGAGAGGGGTGGGTGGGACTCCTCGGGACTCTGCCGGGGTTAGTCCCTTTCCCCCTAAACGT
CGGGAGCGGCCTCCCAGAAAACCAGAGCTGCTACAGGAGGAATCTTTGCCACCTCCTCATAGCTCTGGATTCTTGGGCTCTAAGCCTGAG
GGCCCAGGCCCTCAGGCAGAGTCCAGAGATACAGGCACAGAGGCCCTGACCCCTCACATCTGGAACCGTTTACATACTGCCACTAGCCGA
AAGAGTTACCGGCCCAGCTCCATGGAGCCTTGGATGGAGCCCCTGAGTCCTTTTGAGGATGTGGCTGGCACAGAAATGAGTCAGTCTGAC
AGTGGGGTGGACCTGAGTGGGGATTCTCAGGTGTCATCAGGTCCCTGCAGCCAGCGAAGTTCCCCTGATGGAGGACTCAAGGGGGCAGCA
GAGGGACCCCCCAAGAGGCCTGGAGGCTCCTCACCCCTGAATGCTGTTCCTTGTGAGGGTCCACCTGGCTCTGAACCTCCTAGGAGACCA
CCACCTGCCCCCCACGATGGGGACAGAAAGGAGCTGCCCCGGGAGCAGCCTCTGCCCCCTGGCCCCATTGGCACAGAACGATCACAGCGT
ACAGACCGAGGCACAGAGCCTGGCCCCATTCGGCCATCCCATCGACCTGGTCCCCCAGTCCAGTTTGGCACTAGTGACAAGGGTAATGTT
GGTGCTCCTGGAGCCAAAGGTGCTCGCGGCAGCGCTGGTCCCCCTGGTGCTACTGGTTTCCCTGGTGCTGCTGGCCGAGTCGGTCCTCCT
GGCCCCTCTGGAAATGCTGGACCCCCTGGCCCTCCTGGTCCTGCTGGCAAAGAAGGCGGCAAAGGTCCCCGTGGTGAGACTGGCCCTGCT
GGACGTCCTGGTGAAGTTGGTCCCCCTGGTCCCCCTGGCCCTGCTGGCGAGAAAGGATCCCCTGGTGCTGATGGTCCTGCTGGTGCTCCT
GGTACTCCCGGGCCTCAAGGTATTGCTGGACAGCGTGGTGTGGTCGGCCTGCCTGGTCAGAGAGGAGAGAGAGGCTTCCCTGGTCTTCCT
GGCCCCTCTGGTGAACCTGGCAAACAAGGTCCCTCTGGAGCAAGTGGTGAACGTGGTCCCCCTGGTCCCATGGGCCCCCCTGGATTGGCT
GGACCCCCTGGTGAATCTGGACGTGAGGGGGCTCCTGGTGCCGAAGGTTCCCCTGGACGAGACGGTTCTCCTGGCGCCAAGGGTGACCGT
GGTGAGACCGGCCCCGCTGGACCCCCTGGTGCTCCTGGTGCTCCTGGTGCCCCTGGCCCCGTTGGCCCTGCTGGCAAGAGTGGTGATCGT
GGTGAGACTGGTCCTGCTGGTCCCACCGGTCCTGTCGGCCCTGTTGGCGCCCGTGGCCCCGCCGGACCCCAAGGCCCCCGTGGTGACAAG
GGTGAGACAGGCGAACAGGGCGACAGAGGCATAAAGGGTCACCGTGGCTTCTCTGGCCTCCAGGGTCCCCCTGGCCCTCCTGGCTCTCCT
GGTGAACAAGGTCCCTCTGGAGCCTCTGGTCCTGCTGGTCCCCGAGGTCCCCCTGGCTCTGCTGGTGCTCCTGGCAAAGATGGACTCAAC
GGTCTCCCTGGCCCCATTGGGCCCCCTGGTCCTCGCGGTCGCACTGGTGATGCTGGTCCTGTTGGTCCCCCCGGCCCTCCTGGACCTCCT
GGTCCCCCTGGTCCTCCCAGCGCTGGTTTCGACTTCAGCTTCCTGCCCCAGCCACCTCAAGAGAAGGCTCACGATGGTGGCCGCTACTAC
CGGGCTGATGATGCCAATGTGGTTCGTGACCGTGACCTCGAGGTGGACACCACCCTCAAGAGCCTGAGCCAGCAGATCGAGAACATCCGG
AGCCCAGAGGGCAGCCGCAAGAACCCCGCCCGCACCTGCCGTGACCTCAAGATGTGCCACTCTGACTGGAAGAGTGGAGAGTACTGGATT
GACCCCAACCAAGGCTGCAACCTGGATGCCATCAAAGTCTTCTGCAACATGGAGACTGGTGAGACCTGCGTGTACCCCACTCAGCCCAGT
GTGGCCCAGAAGAACTGGTACATCAGCAAGAACCCCAAGGACAAGAGGCATGTCTGGTTCGGCGAGAGCATGACCGATGGATTCCAGTTC
GAGTATGGCGGCCAGGGCTCCGACCCTGCCGATGTGGCCATCCAGCTGACCTTCCTGCGCCTGATGTCCACCGAGGCCTCCCAGAACATC
ACCTACCACTGCAAGAACAGCGTGGCCTACATGGACCAGCAGACTGGCAACCTCAAGAAGGCCCTGCTCCTCCAGGGCTCCAACGAGATC
GAGATCCGCGCCGAGGGCAACAGCCGCTTCACCTACAGCGTCACTGTCGATGGCTGCACGAGTCACACCGGAGCCTGGGGCAAGACAGTG
ATTGAATACAAAACCACCAAGACCTCCCGCCTGCCCATCATCGATGTGGCCCCCTTGGACGTTGGTGCCCCAGACCAGGAATTCGGCTTC

>In-frame_PRRC2A_ENST00000376033_chr6_31602951_+_COL1A1_ENST00000225964_chr17_48267269_-_7137nt
ATGTCCGATCGCTCGGGGCCGACTGCCAAGGGAAAGGATGGAAAGAAGTATTCCTCGCTCAACCTGTTTGATACGTATAAGGGCAAGTCC
TTAGAGATCCAGAAACCCGCTGTTGCCCCTCGCCATGGCCTGCAGAGTCTCGGGAAAGTTGCCATTGCCCGGCGTATGCCACCTCCAGCC
AACCTTCCAAGCCTGAAAGCCGAGAACAAAGGCAATGACCCCAATGTCTCACTAGTGCCAAAAGACGGAACAGGATGGGCAAGCAAACAG
GAGCAGTCCGACCCCAAGAGTTCCGATGCCTCAACCGCTCAGCCGCCGGAATCGCAGCCACTGCCGGCTTCACAGACGCCTGCCTCCAAC
CAGCCGAAACGACCCCCAGCAGCCCCCGAGAACACTCCTTTGGTTCCAAGCGGGGTAAAGTCCTGGGCACAAGCCAGCGTCACCCATGGA
GCACATGGAGATGGTGGAAGGGCATCAAGCCTACTGTCACGATTCTCTCGAGAGGAATTTCCGACCCTGCAGGCGGCTGGCGACCAGGAC
AAGGCTGCCAAGGAAAGGGAGTCTGCCGAACAGTCGTCTGGGCCCGGACCAAGCCTCCGCCCCCAAAATTCTACAACTTGGAGGGACGGA
GGTGGGCGTGGCCCTGATGAGCTGGAGGGCCCGGACTCCAAACTTCATCATGGTCATGATCCCCGGGGTGGGCTACAGCCTTCAGGCCCA
CCCCAGTTCCCTCCCTACCGCGGAATGATGCCGCCTTTCATGTATCCCCCATATCTCCCGTTCCCTCCGCCCTATGGACCCCAGGGGCCT
TACCGATACCCCACTCCTGATGGGCCCAGCCGTTTTCCCCGTGTGGCGGGCCCCCGAGGCTCAGGGCCACCAATGCGCTTAGTAGAGCCT
GTGGGTCGTCCCTCTATTCTCAAAGAGGATAATCTCAAAGAGTTTGATCAGTTGGATCAGGAGAATGATGATGGTTGGGCAGGGGCCCAT
GAAGAGGTTGACTACACTGAAAAGCTCAAGTTCAGCGATGAGGAAGATGGGCGAGACTCTGATGAGGAGGGTGCTGAGGGCCACAGGGAT
TCCCAATCAGCTTCTGGTGAGGAACGGCCCCCTGAAGCAGATGGCAAAAAGGGCAACTCCCCCAACAGCGAACCGCCCACTCCTAAGACG
GCCTGGGCAGAAACCTCTCGGCCTCCAGAGACAGAGCCGGGACCTCCTGCCCCAAAGCCTCCCCTACCCCCACCTCACCGGGGCCCCGCC
GGGAACTGGGGCCCCCCTGGGGACTACCCAGATCGTGGGGGTCCTCCCTGCAAGCCCCCAGCACCTGAAGATGAGGATGAGGCATGGCGG
CAGCGACGAAAGCAGTCGTCATCTGAGATTTCCCTGGCAGTGGAGCGGGCCCGGCGACGGCGAGAAGAAGAGGAGCGGCGCATGCAAGAA
GAGCGCCGGGCAGCCTGTGCTGAGAAGCTCAAGCGACTCGATGAAAAGTTTGGGGCACCTGACAAGCGGCTCAAAGCAGAGCCTGCTGCC
CCACCTGCTGCCCCTTCTACCCCAGCTCCACCACCTGCAGTCCCTAAAGAACTCCCTGCACCTCCAGCTCCACCTCCAGCATCAGCCCCA
ACACCAGAGACAGAACCTGAAGAGCCAGCACAGGCCCCTCCTGCCCAATCTACTCCTACTCCAGGTGTGGCTGCGGCTCCCACTCTGGTG
AGTGGTGGTGGCAGTACCAGTAGCACCAGCAGTGGCAGCTTCGAAGCCAGCCCAGTGGAACCACAACTGCCCTCAAAAGAGGGTCCTGAA
CCACCAGAAGAGGTTCCTCCTCCTACCACACCCCCAGTTCCAAAGGTGGAACCCAAGGGTGATGGGATTGGTCCCACCCGCCAGCCCCCT
AGTCAGGGCTTGGGCTACCCCAAATATCAGAAGTCGTTGCCTCCTCGTTTCCAGCGGCAGCAGCAGGAGCAGCTCCTGAAGCAGCAGCAG
CAGCACCAGTGGCAGCAGCATCAACAGGGCTCTGCCCCTCCTACCCCAGTGCCCCCATCACCACCACAGCCTGTGACCCTGGGGGCTGTG
CCAGCTCCACAGGCTCCACCCCCGCCCCCCAAGGCCCTGTACCCAGGTGCTCTGGGCCGGCCCCCACCCATGCCCCCAATGAACTTTGAT
CCCCGATGGATGATGATTCCTCCTTATGTGGACCCCCGGCTCCTCCAGGGTCGTCCCCCTCTAGACTTCTACCCTCCTGGTGTGCATCCC
TCTGGCCTAGTTCCCCGAGAGCGTTCAGACAGTGGGGGCTCAAGCTCAGAGCCATTTGACCGTCATGCACCTGCTATGTTACGGGAACGG
GGCACTCCACCGGTGGATCCAAAGTTGGCCTGGGTAGGAGATGTCTTCACCGCCACACCCGCTGAACCCCGCCCACTTACCTCACCTCTG
CGCCAGGCTGCGGATGAGGATGACAAGGGGATGAGGAGCGAGACTCCTCCAGTACCTCCCCCACCACCCTATCTGGCCAGTTATCCAGGC
TTTCCTGAGAATGGAGCCCCTGGGCCCCCAATCTCTCGCTTTCCTCTGGAGGAACCAGGGCCCCGTCCACTCCCCTGGCCCCCAGGCAGT
GATGAAGTGGCCAAGATACAAACTCCACCACCCAAGAAGGAGCCCCCTAAGGAGGAGACTGCACAGCTGACGGGGCCAGAAGCAGGCCGA
AAGCCTGCCCGCGGAGTCGGGAGTGGAGGCCAGGGCCCCCCACCACCACGCAGAGAGAGTCGCACAGAGACCCGCTGGGGCCCTCGTCCA
GGGAGCAGTCGTCGTGGAATCCCTCCAGAGGAGCCAGGGGCCCCACCCCGCCGGGCTGGGCCTATAAAGAAACCTCCACCACCTACAAAA
GTAGAAGAGCTGCCTCCCAAGCCCCTCGAACAGGGGGATGAAACCCCCAAACCCCCAAAGCCAGACCCACTCAAGATAACCAAGGGGAAG
CTAGGGGGCCCCAAGGAGACCCCACCCAATGGAAATCTTTCCCCTGCCCCAAGGCTTCGGAGGGACTATTCGTATGAAAGAGTGGGTCCT
ACCTCTTGCCGGGGTCGGGGCCGAGGCGAGTATTTTGCCAGAGGGAGGGGTTTTCGGGGGACCTATGGGGGACGAGGGCGGGGAGCCCGA
AGCCGGGAATTCCGCAGTTACCGAGAGTTTCGAGGAGATGATGGGCGTGGAGGTGGGACAGGGGGACCAAACCACCCTCCTGCTCCCCGA
GGCCGCACTGCCAGCGAGACACGGAGCGAGGGTTCAGAGTATGAGGAAATCCCCAAGCGGCGCCGGCAGCGGGGCTCAGAAACAGGCAGC
GAGACCCATGAGAGTGATCTGGCTCCTTCAGACAAGGAGGCTCCCACACCCAAGGAGGGAACACTCACCCAGGTCCCTCTCGCTCCCCCA
CCACCAGGAGCCCCACCTTCACCAGCCCCAGCCCGCTTCACTGCCCGGGGTGGGCGAGTCTTCACTCCCAGAGGGGTGCCATCTCGCCGG
GGCCGAGGAGGAGGGAGGCCCCCTCCTCAAGTTTGCCCAGGCTGGAGCCCTCCAGCCAAGTCTCTGGCTCCCAAGAAACCTCCCACAGGC
CCTTTGCCACCAAGTAAGGAGCCTTTGAAAGAGAAGTTGATCCCAGGGCCTCTGTCCCCTGTGGCGCGCGGAGGCAGCAATGGAGGTAGC
AATGTGGGCATGGAAGATGGGGAGCGACCCCGAAGGAGGCGACATGGGAGGGCTCAGCAGCAGGATAAACCGCCTCGTTTCCGGAGGCTG
AAGCAGGAACGGGAGAATGCCGCAAGGGGGTCTGAGGGCAAGCCCTCCCTAACCCTTCCAGCCTCCGCTCCTGGACCTGAGGAGGCCCTC
ACAACAGTCACAGTGGCCCCAGCACCTCGCCGGGCAGCTGCCAAGTCTCCTGATCTGTCAAACCAGAACTCAGACCAAGCCAATGAGGAA
TGGGAGACTGCATCAGAGAGCAGTGACTTCACCAGTGAGCGCCGAGGGGACAAAGAGGCACCCCCACCAGTACTGCTGACACCCAAGGCT
GTGGGAACTCCTGGGGGAGGTGGAGGTGGAGCCGTACCAGGTATTTCAGCCATGTCCCGCGGAGATCTGAGCCAGAGAGCCAAGGATTTG
AGTAAACGGAGCTTCTCAAGTCAGCGGCCAGGCATGGAACGGCAGAATCGGCGCCCTGGCCCAGGGGGCAAGGCTGGCAGCAGTGGCAGC
AGCAGTGGAGGAGGCGGTGGGGGTCCTGGAGGAAGGACCGGGCCAGGACGAGGCGACAAGAGGAGCTGGCCCTCTCCCAAGAACCGAAGT
CGTCCTCCAGAGGAGCGTCCCCCGGGGCTTCCCCTGCCTCCCCCACCTCCCAGCAGTTCTGCTGTCTTCCGCCTGGACCAAGTTATCCAC
AGCAACCCTGCTGGCATCCAACAGGCTCTGGCCCAGCTTAGTAGCCGTCAAGGGAGTGTAACTGCACCAGGGGGTCATCCAAGGCACAAG
CCTGGGCTTCCCCAAGCCCCTCAGGGCCCCTCTCCTAGGCCCCCAACCCGATACGAGCCCCAGAGGGTCAACAGCGGCCTCAGTTCTGAC
CCCCACTTTGAGGAGCCGGGGCCAATGGTGAGAGGGGTGGGTGGGACTCCTCGGGACTCTGCCGGGGTTAGTCCCTTTCCCCCTAAACGT
CGGGAGCGGCCTCCCAGAAAACCAGAGCTGCTACAGGAGGAATCTTTGCCACCTCCTCATAGCTCTGGATTCTTGGGCTCTAAGCCTGAG
GGCCCAGGCCCTCAGGCAGAGTCCAGAGATACAGGCACAGAGGCCCTGACCCCTCACATCTGGAACCGTTTACATACTGCCACTAGCCGA
AAGAGTTACCGGCCCAGCTCCATGGAGCCTTGGATGGAGCCCCTGAGTCCTTTTGAGGATGTGGCTGGCACAGAAATGAGTCAGTCTGAC
AGTGGGGTGGACCTGAGTGGGGATTCTCAGGTGTCATCAGGTCCCTGCAGCCAGCGAAGTTCCCCTGATGGAGGACTCAAGGGGGCAGCA
GAGGGACCCCCCAAGAGGCCTGGAGGCTCCTCACCCCTGAATGCTGTTCCTTGTGAGGGTCCACCTGGCTCTGAACCTCCTAGGAGACCA
CCACCTGCCCCCCACGATGGGGACAGAAAGGAGCTGCCCCGGGAGCAGCCTCTGCCCCCTGGCCCCATTGGCACAGAACGATCACAGCGT
ACAGACCGAGGCACAGAGCCTGGCCCCATTCGGCCATCCCATCGACCTGGTCCCCCAGTCCAGTTTGGCACTAGTGACAAGGGTAATGTT
GGTGCTCCTGGAGCCAAAGGTGCTCGCGGCAGCGCTGGTCCCCCTGGTGCTACTGGTTTCCCTGGTGCTGCTGGCCGAGTCGGTCCTCCT
GGCCCCTCTGGAAATGCTGGACCCCCTGGCCCTCCTGGTCCTGCTGGCAAAGAAGGCGGCAAAGGTCCCCGTGGTGAGACTGGCCCTGCT
GGACGTCCTGGTGAAGTTGGTCCCCCTGGTCCCCCTGGCCCTGCTGGCGAGAAAGGATCCCCTGGTGCTGATGGTCCTGCTGGTGCTCCT
GGTACTCCCGGGCCTCAAGGTATTGCTGGACAGCGTGGTGTGGTCGGCCTGCCTGGTCAGAGAGGAGAGAGAGGCTTCCCTGGTCTTCCT
GGCCCCTCTGGTGAACCTGGCAAACAAGGTCCCTCTGGAGCAAGTGGTGAACGTGGTCCCCCTGGTCCCATGGGCCCCCCTGGATTGGCT
GGACCCCCTGGTGAATCTGGACGTGAGGGGGCTCCTGGTGCCGAAGGTTCCCCTGGACGAGACGGTTCTCCTGGCGCCAAGGGTGACCGT
GGTGAGACCGGCCCCGCTGGACCCCCTGGTGCTCCTGGTGCTCCTGGTGCCCCTGGCCCCGTTGGCCCTGCTGGCAAGAGTGGTGATCGT
GGTGAGACTGGTCCTGCTGGTCCCACCGGTCCTGTCGGCCCTGTTGGCGCCCGTGGCCCCGCCGGACCCCAAGGCCCCCGTGGTGACAAG
GGTGAGACAGGCGAACAGGGCGACAGAGGCATAAAGGGTCACCGTGGCTTCTCTGGCCTCCAGGGTCCCCCTGGCCCTCCTGGCTCTCCT
GGTGAACAAGGTCCCTCTGGAGCCTCTGGTCCTGCTGGTCCCCGAGGTCCCCCTGGCTCTGCTGGTGCTCCTGGCAAAGATGGACTCAAC
GGTCTCCCTGGCCCCATTGGGCCCCCTGGTCCTCGCGGTCGCACTGGTGATGCTGGTCCTGTTGGTCCCCCCGGCCCTCCTGGACCTCCT
GGTCCCCCTGGTCCTCCCAGCGCTGGTTTCGACTTCAGCTTCCTGCCCCAGCCACCTCAAGAGAAGGCTCACGATGGTGGCCGCTACTAC
CGGGCTGATGATGCCAATGTGGTTCGTGACCGTGACCTCGAGGTGGACACCACCCTCAAGAGCCTGAGCCAGCAGATCGAGAACATCCGG
AGCCCAGAGGGCAGCCGCAAGAACCCCGCCCGCACCTGCCGTGACCTCAAGATGTGCCACTCTGACTGGAAGAGTGGAGAGTACTGGATT
GACCCCAACCAAGGCTGCAACCTGGATGCCATCAAAGTCTTCTGCAACATGGAGACTGGTGAGACCTGCGTGTACCCCACTCAGCCCAGT
GTGGCCCAGAAGAACTGGTACATCAGCAAGAACCCCAAGGACAAGAGGCATGTCTGGTTCGGCGAGAGCATGACCGATGGATTCCAGTTC
GAGTATGGCGGCCAGGGCTCCGACCCTGCCGATGTGGCCATCCAGCTGACCTTCCTGCGCCTGATGTCCACCGAGGCCTCCCAGAACATC
ACCTACCACTGCAAGAACAGCGTGGCCTACATGGACCAGCAGACTGGCAACCTCAAGAAGGCCCTGCTCCTCCAGGGCTCCAACGAGATC
GAGATCCGCGCCGAGGGCAACAGCCGCTTCACCTACAGCGTCACTGTCGATGGCTGCACGAGTCACACCGGAGCCTGGGGCAAGACAGTG
ATTGAATACAAAACCACCAAGACCTCCCGCCTGCCCATCATCGATGTGGCCCCCTTGGACGTTGGTGCCCCAGACCAGGAATTCGGCTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PRRC2A_ENST00000376007_chr6_31602951_+_COL1A1_ENST00000225964_chr17_48267269_-_9726nt
GACGACGTTCGCGGCGGGGAACTCGGAGTAGCTTCGCCTCTGACGTTTCCCCACGACGCACCCCGAAATCCCCCTGAGCTCCGGCGGTCG
CGGGCTGCCCTCGCCGCCTGGTCTGGCTTTATGCTAAGTTTGAGGGAAGAGTCGAGCTGCTCTGCTCTCTATTGATTGTGTTTCTGGAGG
GCGTCCTGTTGAATTCCCACTTCATTGTGTACATCCCCTTCCGTTCCCCCCAAAAATCTGTGCCACAGGGTTACTTTTTGAAAGCGGGAG
GAATCGAGAAGCACGATCTTTTGGAAAACTTGGTGAACGCCTAGCTCTGGCACGTTTTGGGGGAGGTGCCTGCAGGACCCAACATACTCA
ATGAGCTTCCAGCGCAATGTCCGATCGCTCGGGGCCGACTGCCAAGGGAAAGGATGGAAAGAAGTATTCCTCGCTCAACCTGTTTGATAC
GTATAAGGGCAAGTCCTTAGAGATCCAGAAACCCGCTGTTGCCCCTCGCCATGGCCTGCAGAGTCTCGGGAAAGTTGCCATTGCCCGGCG
TATGCCACCTCCAGCCAACCTTCCAAGCCTGAAAGCCGAGAACAAAGGCAATGACCCCAATGTCTCACTAGTGCCAAAAGACGGAACAGG
ATGGGCAAGCAAACAGGAGCAGTCCGACCCCAAGAGTTCCGATGCCTCAACCGCTCAGCCGCCGGAATCGCAGCCACTGCCGGCTTCACA
GACGCCTGCCTCCAACCAGCCGAAACGACCCCCAGCAGCCCCCGAGAACACTCCTTTGGTTCCAAGCGGGGTAAAGTCCTGGGCACAAGC
CAGCGTCACCCATGGAGCACATGGAGATGGTGGAAGGGCATCAAGCCTACTGTCACGATTCTCTCGAGAGGAATTTCCGACCCTGCAGGC
GGCTGGCGACCAGGACAAGGCTGCCAAGGAAAGGGAGTCTGCCGAACAGTCGTCTGGGCCCGGACCAAGCCTCCGCCCCCAAAATTCTAC
AACTTGGAGGGACGGAGGTGGGCGTGGCCCTGATGAGCTGGAGGGCCCGGACTCCAAACTTCATCATGGTCATGATCCCCGGGGTGGGCT
ACAGCCTTCAGGCCCACCCCAGTTCCCTCCCTACCGCGGAATGATGCCGCCTTTCATGTATCCCCCATATCTCCCGTTCCCTCCGCCCTA
TGGACCCCAGGGGCCTTACCGATACCCCACTCCTGATGGGCCCAGCCGTTTTCCCCGTGTGGCGGGCCCCCGAGGCTCAGGGCCACCAAT
GCGCTTAGTAGAGCCTGTGGGTCGTCCCTCTATTCTCAAAGAGGATAATCTCAAAGAGTTTGATCAGTTGGATCAGGAGAATGATGATGG
TTGGGCAGGGGCCCATGAAGAGGTTGACTACACTGAAAAGCTCAAGTTCAGCGATGAGGAAGATGGGCGAGACTCTGATGAGGAGGGTGC
TGAGGGCCACAGGGATTCCCAATCAGCTTCTGGTGAGGAACGGCCCCCTGAAGCAGATGGCAAAAAGGGCAACTCCCCCAACAGCGAACC
GCCCACTCCTAAGACGGCCTGGGCAGAAACCTCTCGGCCTCCAGAGACAGAGCCGGGACCTCCTGCCCCAAAGCCTCCCCTACCCCCACC
TCACCGGGGCCCCGCCGGGAACTGGGGCCCCCCTGGGGACTACCCAGATCGTGGGGGTCCTCCCTGCAAGCCCCCAGCACCTGAAGATGA
GGATGAGGCATGGCGGCAGCGACGAAAGCAGTCGTCATCTGAGATTTCCCTGGCAGTGGAGCGGGCCCGGCGACGGCGAGAAGAAGAGGA
GCGGCGCATGCAAGAAGAGCGCCGGGCAGCCTGTGCTGAGAAGCTCAAGCGACTCGATGAAAAGTTTGGGGCACCTGACAAGCGGCTCAA
AGCAGAGCCTGCTGCCCCACCTGCTGCCCCTTCTACCCCAGCTCCACCACCTGCAGTCCCTAAAGAACTCCCTGCACCTCCAGCTCCACC
TCCAGCATCAGCCCCAACACCAGAGACAGAACCTGAAGAGCCAGCACAGGCCCCTCCTGCCCAATCTACTCCTACTCCAGGTGTGGCTGC
GGCTCCCACTCTGGTGAGTGGTGGTGGCAGTACCAGTAGCACCAGCAGTGGCAGCTTCGAAGCCAGCCCAGTGGAACCACAACTGCCCTC
AAAAGAGGGTCCTGAACCACCAGAAGAGGTTCCTCCTCCTACCACACCCCCAGTTCCAAAGGTGGAACCCAAGGGTGATGGGATTGGTCC
CACCCGCCAGCCCCCTAGTCAGGGCTTGGGCTACCCCAAATATCAGAAGTCGTTGCCTCCTCGTTTCCAGCGGCAGCAGCAGGAGCAGCT
CCTGAAGCAGCAGCAGCAGCACCAGTGGCAGCAGCATCAACAGGGCTCTGCCCCTCCTACCCCAGTGCCCCCATCACCACCACAGCCTGT
GACCCTGGGGGCTGTGCCAGCTCCACAGGCTCCACCCCCGCCCCCCAAGGCCCTGTACCCAGGTGCTCTGGGCCGGCCCCCACCCATGCC
CCCAATGAACTTTGATCCCCGATGGATGATGATTCCTCCTTATGTGGACCCCCGGCTCCTCCAGGGTCGTCCCCCTCTAGACTTCTACCC
TCCTGGTGTGCATCCCTCTGGCCTAGTTCCCCGAGAGCGTTCAGACAGTGGGGGCTCAAGCTCAGAGCCATTTGACCGTCATGCACCTGC
TATGTTACGGGAACGGGGCACTCCACCGGTGGATCCAAAGTTGGCCTGGGTAGGAGATGTCTTCACCGCCACACCCGCTGAACCCCGCCC
ACTTACCTCACCTCTGCGCCAGGCTGCGGATGAGGATGACAAGGGGATGAGGAGCGAGACTCCTCCAGTACCTCCCCCACCACCCTATCT
GGCCAGTTATCCAGGCTTTCCTGAGAATGGAGCCCCTGGGCCCCCAATCTCTCGCTTTCCTCTGGAGGAACCAGGGCCCCGTCCACTCCC
CTGGCCCCCAGGCAGTGATGAAGTGGCCAAGATACAAACTCCACCACCCAAGAAGGAGCCCCCTAAGGAGGAGACTGCACAGCTGACGGG
GCCAGAAGCAGGCCGAAAGCCTGCCCGCGGAGTCGGGAGTGGAGGCCAGGGCCCCCCACCACCACGCAGAGAGAGTCGCACAGAGACCCG
CTGGGGCCCTCGTCCAGGGAGCAGTCGTCGTGGAATCCCTCCAGAGGAGCCAGGGGCCCCACCCCGCCGGGCTGGGCCTATAAAGAAACC
TCCACCACCTACAAAAGTAGAAGAGCTGCCTCCCAAGCCCCTCGAACAGGGGGATGAAACCCCCAAACCCCCAAAGCCAGACCCACTCAA
GATAACCAAGGGGAAGCTAGGGGGCCCCAAGGAGACCCCACCCAATGGAAATCTTTCCCCTGCCCCAAGGCTTCGGAGGGACTATTCGTA
TGAAAGAGTGGGTCCTACCTCTTGCCGGGGTCGGGGCCGAGGCGAGTATTTTGCCAGAGGGAGGGGTTTTCGGGGGACCTATGGGGGACG
AGGGCGGGGAGCCCGAAGCCGGGAATTCCGCAGTTACCGAGAGTTTCGAGGAGATGATGGGCGTGGAGGTGGGACAGGGGGACCAAACCA
CCCTCCTGCTCCCCGAGGCCGCACTGCCAGCGAGACACGGAGCGAGGGTTCAGAGTATGAGGAAATCCCCAAGCGGCGCCGGCAGCGGGG
CTCAGAAACAGGCAGCGAGACCCATGAGAGTGATCTGGCTCCTTCAGACAAGGAGGCTCCCACACCCAAGGAGGGAACACTCACCCAGGT
CCCTCTCGCTCCCCCACCACCAGGAGCCCCACCTTCACCAGCCCCAGCCCGCTTCACTGCCCGGGGTGGGCGAGTCTTCACTCCCAGAGG
GGTGCCATCTCGCCGGGGCCGAGGAGGAGGGAGGCCCCCTCCTCAAGTTTGCCCAGGCTGGAGCCCTCCAGCCAAGTCTCTGGCTCCCAA
GAAACCTCCCACAGGCCCTTTGCCACCAAGTAAGGAGCCTTTGAAAGAGAAGTTGATCCCAGGGCCTCTGTCCCCTGTGGCGCGCGGAGG
CAGCAATGGAGGTAGCAATGTGGGCATGGAAGATGGGGAGCGACCCCGAAGGAGGCGACATGGGAGGGCTCAGCAGCAGGATAAACCGCC
TCGTTTCCGGAGGCTGAAGCAGGAACGGGAGAATGCCGCAAGGGGGTCTGAGGGCAAGCCCTCCCTAACCCTTCCAGCCTCCGCTCCTGG
ACCTGAGGAGGCCCTCACAACAGTCACAGTGGCCCCAGCACCTCGCCGGGCAGCTGCCAAGTCTCCTGATCTGTCAAACCAGAACTCAGA
CCAAGCCAATGAGGAATGGGAGACTGCATCAGAGAGCAGTGACTTCACCAGTGAGCGCCGAGGGGACAAAGAGGCACCCCCACCAGTACT
GCTGACACCCAAGGCTGTGGGAACTCCTGGGGGAGGTGGAGGTGGAGCCGTACCAGGTATTTCAGCCATGTCCCGCGGAGATCTGAGCCA
GAGAGCCAAGGATTTGAGTAAACGGAGCTTCTCAAGTCAGCGGCCAGGCATGGAACGGCAGAATCGGCGCCCTGGCCCAGGGGGCAAGGC
TGGCAGCAGTGGCAGCAGCAGTGGAGGAGGCGGTGGGGGTCCTGGAGGAAGGACCGGGCCAGGACGAGGCGACAAGAGGAGCTGGCCCTC
TCCCAAGAACCGAAGTCGTCCTCCAGAGGAGCGTCCCCCGGGGCTTCCCCTGCCTCCCCCACCTCCCAGCAGTTCTGCTGTCTTCCGCCT
GGACCAAGTTATCCACAGCAACCCTGCTGGCATCCAACAGGCTCTGGCCCAGCTTAGTAGCCGTCAAGGGAGTGTAACTGCACCAGGGGG
TCATCCAAGGCACAAGCCTGGGCTTCCCCAAGCCCCTCAGGGCCCCTCTCCTAGGCCCCCAACCCGATACGAGCCCCAGAGGGTCAACAG
CGGCCTCAGTTCTGACCCCCACTTTGAGGAGCCGGGGCCAATGGTGAGAGGGGTGGGTGGGACTCCTCGGGACTCTGCCGGGGTTAGTCC
CTTTCCCCCTAAACGTCGGGAGCGGCCTCCCAGAAAACCAGAGCTGCTACAGGAGGAATCTTTGCCACCTCCTCATAGCTCTGGATTCTT
GGGCTCTAAGCCTGAGGGCCCAGGCCCTCAGGCAGAGTCCAGAGATACAGGCACAGAGGCCCTGACCCCTCACATCTGGAACCGTTTACA
TACTGCCACTAGCCGAAAGAGTTACCGGCCCAGCTCCATGGAGCCTTGGATGGAGCCCCTGAGTCCTTTTGAGGATGTGGCTGGCACAGA
AATGAGTCAGTCTGACAGTGGGGTGGACCTGAGTGGGGATTCTCAGGTGTCATCAGGTCCCTGCAGCCAGCGAAGTTCCCCTGATGGAGG
ACTCAAGGGGGCAGCAGAGGGACCCCCCAAGAGGCCTGGAGGCTCCTCACCCCTGAATGCTGTTCCTTGTGAGGGTCCACCTGGCTCTGA
ACCTCCTAGGAGACCACCACCTGCCCCCCACGATGGGGACAGAAAGGAGCTGCCCCGGGAGCAGCCTCTGCCCCCTGGCCCCATTGGCAC
AGAACGATCACAGCGTACAGACCGAGGCACAGAGCCTGGCCCCATTCGGCCATCCCATCGACCTGGTCCCCCAGTCCAGTTTGGCACTAG
TGACAAGGGTAATGTTGGTGCTCCTGGAGCCAAAGGTGCTCGCGGCAGCGCTGGTCCCCCTGGTGCTACTGGTTTCCCTGGTGCTGCTGG
CCGAGTCGGTCCTCCTGGCCCCTCTGGAAATGCTGGACCCCCTGGCCCTCCTGGTCCTGCTGGCAAAGAAGGCGGCAAAGGTCCCCGTGG
TGAGACTGGCCCTGCTGGACGTCCTGGTGAAGTTGGTCCCCCTGGTCCCCCTGGCCCTGCTGGCGAGAAAGGATCCCCTGGTGCTGATGG
TCCTGCTGGTGCTCCTGGTACTCCCGGGCCTCAAGGTATTGCTGGACAGCGTGGTGTGGTCGGCCTGCCTGGTCAGAGAGGAGAGAGAGG
CTTCCCTGGTCTTCCTGGCCCCTCTGGTGAACCTGGCAAACAAGGTCCCTCTGGAGCAAGTGGTGAACGTGGTCCCCCTGGTCCCATGGG
CCCCCCTGGATTGGCTGGACCCCCTGGTGAATCTGGACGTGAGGGGGCTCCTGGTGCCGAAGGTTCCCCTGGACGAGACGGTTCTCCTGG
CGCCAAGGGTGACCGTGGTGAGACCGGCCCCGCTGGACCCCCTGGTGCTCCTGGTGCTCCTGGTGCCCCTGGCCCCGTTGGCCCTGCTGG
CAAGAGTGGTGATCGTGGTGAGACTGGTCCTGCTGGTCCCACCGGTCCTGTCGGCCCTGTTGGCGCCCGTGGCCCCGCCGGACCCCAAGG
CCCCCGTGGTGACAAGGGTGAGACAGGCGAACAGGGCGACAGAGGCATAAAGGGTCACCGTGGCTTCTCTGGCCTCCAGGGTCCCCCTGG
CCCTCCTGGCTCTCCTGGTGAACAAGGTCCCTCTGGAGCCTCTGGTCCTGCTGGTCCCCGAGGTCCCCCTGGCTCTGCTGGTGCTCCTGG
CAAAGATGGACTCAACGGTCTCCCTGGCCCCATTGGGCCCCCTGGTCCTCGCGGTCGCACTGGTGATGCTGGTCCTGTTGGTCCCCCCGG
CCCTCCTGGACCTCCTGGTCCCCCTGGTCCTCCCAGCGCTGGTTTCGACTTCAGCTTCCTGCCCCAGCCACCTCAAGAGAAGGCTCACGA
TGGTGGCCGCTACTACCGGGCTGATGATGCCAATGTGGTTCGTGACCGTGACCTCGAGGTGGACACCACCCTCAAGAGCCTGAGCCAGCA
GATCGAGAACATCCGGAGCCCAGAGGGCAGCCGCAAGAACCCCGCCCGCACCTGCCGTGACCTCAAGATGTGCCACTCTGACTGGAAGAG
TGGAGAGTACTGGATTGACCCCAACCAAGGCTGCAACCTGGATGCCATCAAAGTCTTCTGCAACATGGAGACTGGTGAGACCTGCGTGTA
CCCCACTCAGCCCAGTGTGGCCCAGAAGAACTGGTACATCAGCAAGAACCCCAAGGACAAGAGGCATGTCTGGTTCGGCGAGAGCATGAC
CGATGGATTCCAGTTCGAGTATGGCGGCCAGGGCTCCGACCCTGCCGATGTGGCCATCCAGCTGACCTTCCTGCGCCTGATGTCCACCGA
GGCCTCCCAGAACATCACCTACCACTGCAAGAACAGCGTGGCCTACATGGACCAGCAGACTGGCAACCTCAAGAAGGCCCTGCTCCTCCA
GGGCTCCAACGAGATCGAGATCCGCGCCGAGGGCAACAGCCGCTTCACCTACAGCGTCACTGTCGATGGCTGCACGAGTCACACCGGAGC
CTGGGGCAAGACAGTGATTGAATACAAAACCACCAAGACCTCCCGCCTGCCCATCATCGATGTGGCCCCCTTGGACGTTGGTGCCCCAGA
CCAGGAATTCGGCTTCGACGTTGGCCCTGTCTGCTTCCTGTAAACTCCCTCCATCCCAACCTGGCTCCCTCCCACCCAACCAACTTTCCC
CCCAACCCGGAAACAGACAAGCAACCCAAACTGAACCCCCTCAAAAGCCAAAAAATGGGAGACAATTTCACATGGACTTTGGAAAATATT
TTTTTCCTTTGCATTCATCTCTCAAACTTAGTTTTTATCTTTGACCAACCGAACATGACCAAAAACCAAAAGTGCATTCAACCTTACCAA
AAAAAAAAAAAAAAAAAGAATAAATAAATAACTTTTTAAAAAAGGAAGCTTGGTCCACTTGCTTGAAGACCCATGCGGGGGTAAGTCCCT
TTCTGCCCGTTGGGCTTATGAAACCCCAATGCTGCCCTTTCTGCTCCTTTCTCCACACCCCCCTTGGGGCCTCCCCTCCACTCCTTCCCA
AATCTGTCTCCCCAGAAGACACAGGAAACAATGTATTGTCTGCCCAGCAATCAAAGGCAATGCTCAAACACCCAAGTGGCCCCCACCCTC
AGCCCGCTCCTGCCCGCCCAGCACCCCCAGGCCCTGGGGGACCTGGGGTTCTCAGACTGCCAAAGAAGCCTTGCCATCTGGCGCTCCCAT
GGCTCTTGCAACATCTCCCCTTCGTTTTTGAGGGGGTCATGCCGGGGGAGCCACCAGCCCCTCACTGGGTTCGGAGGAGAGTCAGGAAGG
GCCACGACAAAGCAGAAACATCGGATTTGGGGAACGCGTGTCAATCCCTTGTGCCGCAGGGCTGGGCGGGAGAGACTGTTCTGTTCCTTG
TGTAACTGTGTTGCTGAAAGACTACCTCGTTCTTGTCTTGATGTGTCACCGGGGCAACTGCCTGGGGGCGGGGATGGGGGCAGGGTGGAA
GCGGCTCCCCATTTTATACCAAAGGTGCTACATCTATGTGATGGGTGGGGTGGGGAGGGAATCACTGGTGCTATAGAAATTGAGATGCCC
CCCCAGGCCAGCAAATGTTCCTTTTTGTTCAAAGTCTATTTTTATTCCTTGATATTTTTCTTTTTTTTTTTTTTTTTTTGTGGATGGGGA
CTTGTGAATTTTTCTAAAGGTGCTATTTAACATGGGAGGAGAGCGTGTGCGGCTCCAGCCCAGCCCGCTGCTCACTTTCCACCCTCTCTC
CACCTGCCTCTGGCTTCTCAGGCCTCTGCTCTCCGACCTCTCTCCTCTGAAACCCTCCTCCACAGCTGCAGCCCATCCTCCCGGCTCCCT
CCTAGTCTGTCCTGCGTCCTCTGTCCCCGGGTTTCAGAGACAACTTCCCAAAGCACAAAGCAGTTTTTCCCCCTAGGGGTGGGAGGAAGC
AAAAGACTCTGTACCTATTTTGTATGTGTATAATAATTTGAGATGTTTTTAATTATTTTGATTGCTGGAATAAAGCATGTGGAAATGACC
CAAACATAATCCGCAGTGGCCTCCTAATTTCCTTCTTTGGAGTTGGGGGAGGGGTAGACATGGGGAAGGGGCTTTGGGGTGATGGGCTTG
CCTTCCATTCCTGCCCTTTCCCTCCCCACTATTCTCTTCTAGATCCCTCCATAACCCCACTCCCCTTTCTCTCACCCTTCTTATACCGCA
AACCTTTCTACTTCCTCTTTCATTTTCTATTCTTGCAATTTCCTTGCACCTTTTCCAAATCCTCTTCTCCCCTGCAATACCATACAGGCA
ATCCACGTGCACAACACACACACACACTCTTCACATCTGGGGTTGTCCAAACCTCATACCCACTCCCCTTCAAGCCCATCCACTCTCCAC
CCCCTGGATGCCCTGCACTTGGTGGCGGTGGGATGCTCATGGATACTGGGAGGGTGAGGGGAGTGGAACCCGTGAGGAGGACCTGGGGGC
CTCTCCTTGAACTGACATGAAGGGTCATCTGGCCTCTGCTCCCTTCTCACCCACGCTGACCTCCTGCCGAAGGAGCAACGCAACAGGAGA
GGGGTCTGCTGAGCCTGGCGAGGGTCTGGGAGGGACCAGGAGGAAGGCGTGCTCCCTGCTCGCTGTCCTGGCCCTGGGGGAGTGAGGGAG
ACAGACACCTGGGAGAGCTGTGGGGAAGGCACTCGCACCGTGCTCTTGGGAAGGAAGGAGACCTGGCCCTGCTCACCACGGACTGGGTGC
CTCGACCTCCTGAATCCCCAGAACACAACCCCCCTGGGCTGGGGTGGTCTGGGGAACCATCGTGCCCCCGCCTCCCGCCTACTCCTTTTT

>In-frame_PRRC2A_ENST00000376033_chr6_31602951_+_COL1A1_ENST00000225964_chr17_48267269_-_9763nt
GACGACGTTCGCGGCGGGGAACTCGGAGTAGCTTCGCCTCTGACGTTTCCCCACGACGCACCCCGAAATCCCCCTGAGCTCCGGCGGTCG
CGGGCTGCCCTCGCCGCCTGGTCTGGCTTTATGCTAAGTTTGAGGGAAGAGTCGAGCTGCTCTGCTCTCTATTGATTGTGTTTCTGGAGG
GCGTCCTGTTGAATTCCCACTTCATTGTGTACATCCCCTTCCGTTCCCCCCAAAAATCTGTGCCACAGGGTTACTTTTTGAAAGCGGGAG
GAATCGAGAAGCACGATCTTTTGGAAAACTTGGTGAACGCCTAGGGACAGAGACTGAGACACTTGCTGTCTGGCCCACAGGCTCTGGCAC
GTTTTGGGGGAGGTGCCTGCAGGACCCAACATACTCAATGAGCTTCCAGCGCAATGTCCGATCGCTCGGGGCCGACTGCCAAGGGAAAGG
ATGGAAAGAAGTATTCCTCGCTCAACCTGTTTGATACGTATAAGGGCAAGTCCTTAGAGATCCAGAAACCCGCTGTTGCCCCTCGCCATG
GCCTGCAGAGTCTCGGGAAAGTTGCCATTGCCCGGCGTATGCCACCTCCAGCCAACCTTCCAAGCCTGAAAGCCGAGAACAAAGGCAATG
ACCCCAATGTCTCACTAGTGCCAAAAGACGGAACAGGATGGGCAAGCAAACAGGAGCAGTCCGACCCCAAGAGTTCCGATGCCTCAACCG
CTCAGCCGCCGGAATCGCAGCCACTGCCGGCTTCACAGACGCCTGCCTCCAACCAGCCGAAACGACCCCCAGCAGCCCCCGAGAACACTC
CTTTGGTTCCAAGCGGGGTAAAGTCCTGGGCACAAGCCAGCGTCACCCATGGAGCACATGGAGATGGTGGAAGGGCATCAAGCCTACTGT
CACGATTCTCTCGAGAGGAATTTCCGACCCTGCAGGCGGCTGGCGACCAGGACAAGGCTGCCAAGGAAAGGGAGTCTGCCGAACAGTCGT
CTGGGCCCGGACCAAGCCTCCGCCCCCAAAATTCTACAACTTGGAGGGACGGAGGTGGGCGTGGCCCTGATGAGCTGGAGGGCCCGGACT
CCAAACTTCATCATGGTCATGATCCCCGGGGTGGGCTACAGCCTTCAGGCCCACCCCAGTTCCCTCCCTACCGCGGAATGATGCCGCCTT
TCATGTATCCCCCATATCTCCCGTTCCCTCCGCCCTATGGACCCCAGGGGCCTTACCGATACCCCACTCCTGATGGGCCCAGCCGTTTTC
CCCGTGTGGCGGGCCCCCGAGGCTCAGGGCCACCAATGCGCTTAGTAGAGCCTGTGGGTCGTCCCTCTATTCTCAAAGAGGATAATCTCA
AAGAGTTTGATCAGTTGGATCAGGAGAATGATGATGGTTGGGCAGGGGCCCATGAAGAGGTTGACTACACTGAAAAGCTCAAGTTCAGCG
ATGAGGAAGATGGGCGAGACTCTGATGAGGAGGGTGCTGAGGGCCACAGGGATTCCCAATCAGCTTCTGGTGAGGAACGGCCCCCTGAAG
CAGATGGCAAAAAGGGCAACTCCCCCAACAGCGAACCGCCCACTCCTAAGACGGCCTGGGCAGAAACCTCTCGGCCTCCAGAGACAGAGC
CGGGACCTCCTGCCCCAAAGCCTCCCCTACCCCCACCTCACCGGGGCCCCGCCGGGAACTGGGGCCCCCCTGGGGACTACCCAGATCGTG
GGGGTCCTCCCTGCAAGCCCCCAGCACCTGAAGATGAGGATGAGGCATGGCGGCAGCGACGAAAGCAGTCGTCATCTGAGATTTCCCTGG
CAGTGGAGCGGGCCCGGCGACGGCGAGAAGAAGAGGAGCGGCGCATGCAAGAAGAGCGCCGGGCAGCCTGTGCTGAGAAGCTCAAGCGAC
TCGATGAAAAGTTTGGGGCACCTGACAAGCGGCTCAAAGCAGAGCCTGCTGCCCCACCTGCTGCCCCTTCTACCCCAGCTCCACCACCTG
CAGTCCCTAAAGAACTCCCTGCACCTCCAGCTCCACCTCCAGCATCAGCCCCAACACCAGAGACAGAACCTGAAGAGCCAGCACAGGCCC
CTCCTGCCCAATCTACTCCTACTCCAGGTGTGGCTGCGGCTCCCACTCTGGTGAGTGGTGGTGGCAGTACCAGTAGCACCAGCAGTGGCA
GCTTCGAAGCCAGCCCAGTGGAACCACAACTGCCCTCAAAAGAGGGTCCTGAACCACCAGAAGAGGTTCCTCCTCCTACCACACCCCCAG
TTCCAAAGGTGGAACCCAAGGGTGATGGGATTGGTCCCACCCGCCAGCCCCCTAGTCAGGGCTTGGGCTACCCCAAATATCAGAAGTCGT
TGCCTCCTCGTTTCCAGCGGCAGCAGCAGGAGCAGCTCCTGAAGCAGCAGCAGCAGCACCAGTGGCAGCAGCATCAACAGGGCTCTGCCC
CTCCTACCCCAGTGCCCCCATCACCACCACAGCCTGTGACCCTGGGGGCTGTGCCAGCTCCACAGGCTCCACCCCCGCCCCCCAAGGCCC
TGTACCCAGGTGCTCTGGGCCGGCCCCCACCCATGCCCCCAATGAACTTTGATCCCCGATGGATGATGATTCCTCCTTATGTGGACCCCC
GGCTCCTCCAGGGTCGTCCCCCTCTAGACTTCTACCCTCCTGGTGTGCATCCCTCTGGCCTAGTTCCCCGAGAGCGTTCAGACAGTGGGG
GCTCAAGCTCAGAGCCATTTGACCGTCATGCACCTGCTATGTTACGGGAACGGGGCACTCCACCGGTGGATCCAAAGTTGGCCTGGGTAG
GAGATGTCTTCACCGCCACACCCGCTGAACCCCGCCCACTTACCTCACCTCTGCGCCAGGCTGCGGATGAGGATGACAAGGGGATGAGGA
GCGAGACTCCTCCAGTACCTCCCCCACCACCCTATCTGGCCAGTTATCCAGGCTTTCCTGAGAATGGAGCCCCTGGGCCCCCAATCTCTC
GCTTTCCTCTGGAGGAACCAGGGCCCCGTCCACTCCCCTGGCCCCCAGGCAGTGATGAAGTGGCCAAGATACAAACTCCACCACCCAAGA
AGGAGCCCCCTAAGGAGGAGACTGCACAGCTGACGGGGCCAGAAGCAGGCCGAAAGCCTGCCCGCGGAGTCGGGAGTGGAGGCCAGGGCC
CCCCACCACCACGCAGAGAGAGTCGCACAGAGACCCGCTGGGGCCCTCGTCCAGGGAGCAGTCGTCGTGGAATCCCTCCAGAGGAGCCAG
GGGCCCCACCCCGCCGGGCTGGGCCTATAAAGAAACCTCCACCACCTACAAAAGTAGAAGAGCTGCCTCCCAAGCCCCTCGAACAGGGGG
ATGAAACCCCCAAACCCCCAAAGCCAGACCCACTCAAGATAACCAAGGGGAAGCTAGGGGGCCCCAAGGAGACCCCACCCAATGGAAATC
TTTCCCCTGCCCCAAGGCTTCGGAGGGACTATTCGTATGAAAGAGTGGGTCCTACCTCTTGCCGGGGTCGGGGCCGAGGCGAGTATTTTG
CCAGAGGGAGGGGTTTTCGGGGGACCTATGGGGGACGAGGGCGGGGAGCCCGAAGCCGGGAATTCCGCAGTTACCGAGAGTTTCGAGGAG
ATGATGGGCGTGGAGGTGGGACAGGGGGACCAAACCACCCTCCTGCTCCCCGAGGCCGCACTGCCAGCGAGACACGGAGCGAGGGTTCAG
AGTATGAGGAAATCCCCAAGCGGCGCCGGCAGCGGGGCTCAGAAACAGGCAGCGAGACCCATGAGAGTGATCTGGCTCCTTCAGACAAGG
AGGCTCCCACACCCAAGGAGGGAACACTCACCCAGGTCCCTCTCGCTCCCCCACCACCAGGAGCCCCACCTTCACCAGCCCCAGCCCGCT
TCACTGCCCGGGGTGGGCGAGTCTTCACTCCCAGAGGGGTGCCATCTCGCCGGGGCCGAGGAGGAGGGAGGCCCCCTCCTCAAGTTTGCC
CAGGCTGGAGCCCTCCAGCCAAGTCTCTGGCTCCCAAGAAACCTCCCACAGGCCCTTTGCCACCAAGTAAGGAGCCTTTGAAAGAGAAGT
TGATCCCAGGGCCTCTGTCCCCTGTGGCGCGCGGAGGCAGCAATGGAGGTAGCAATGTGGGCATGGAAGATGGGGAGCGACCCCGAAGGA
GGCGACATGGGAGGGCTCAGCAGCAGGATAAACCGCCTCGTTTCCGGAGGCTGAAGCAGGAACGGGAGAATGCCGCAAGGGGGTCTGAGG
GCAAGCCCTCCCTAACCCTTCCAGCCTCCGCTCCTGGACCTGAGGAGGCCCTCACAACAGTCACAGTGGCCCCAGCACCTCGCCGGGCAG
CTGCCAAGTCTCCTGATCTGTCAAACCAGAACTCAGACCAAGCCAATGAGGAATGGGAGACTGCATCAGAGAGCAGTGACTTCACCAGTG
AGCGCCGAGGGGACAAAGAGGCACCCCCACCAGTACTGCTGACACCCAAGGCTGTGGGAACTCCTGGGGGAGGTGGAGGTGGAGCCGTAC
CAGGTATTTCAGCCATGTCCCGCGGAGATCTGAGCCAGAGAGCCAAGGATTTGAGTAAACGGAGCTTCTCAAGTCAGCGGCCAGGCATGG
AACGGCAGAATCGGCGCCCTGGCCCAGGGGGCAAGGCTGGCAGCAGTGGCAGCAGCAGTGGAGGAGGCGGTGGGGGTCCTGGAGGAAGGA
CCGGGCCAGGACGAGGCGACAAGAGGAGCTGGCCCTCTCCCAAGAACCGAAGTCGTCCTCCAGAGGAGCGTCCCCCGGGGCTTCCCCTGC
CTCCCCCACCTCCCAGCAGTTCTGCTGTCTTCCGCCTGGACCAAGTTATCCACAGCAACCCTGCTGGCATCCAACAGGCTCTGGCCCAGC
TTAGTAGCCGTCAAGGGAGTGTAACTGCACCAGGGGGTCATCCAAGGCACAAGCCTGGGCTTCCCCAAGCCCCTCAGGGCCCCTCTCCTA
GGCCCCCAACCCGATACGAGCCCCAGAGGGTCAACAGCGGCCTCAGTTCTGACCCCCACTTTGAGGAGCCGGGGCCAATGGTGAGAGGGG
TGGGTGGGACTCCTCGGGACTCTGCCGGGGTTAGTCCCTTTCCCCCTAAACGTCGGGAGCGGCCTCCCAGAAAACCAGAGCTGCTACAGG
AGGAATCTTTGCCACCTCCTCATAGCTCTGGATTCTTGGGCTCTAAGCCTGAGGGCCCAGGCCCTCAGGCAGAGTCCAGAGATACAGGCA
CAGAGGCCCTGACCCCTCACATCTGGAACCGTTTACATACTGCCACTAGCCGAAAGAGTTACCGGCCCAGCTCCATGGAGCCTTGGATGG
AGCCCCTGAGTCCTTTTGAGGATGTGGCTGGCACAGAAATGAGTCAGTCTGACAGTGGGGTGGACCTGAGTGGGGATTCTCAGGTGTCAT
CAGGTCCCTGCAGCCAGCGAAGTTCCCCTGATGGAGGACTCAAGGGGGCAGCAGAGGGACCCCCCAAGAGGCCTGGAGGCTCCTCACCCC
TGAATGCTGTTCCTTGTGAGGGTCCACCTGGCTCTGAACCTCCTAGGAGACCACCACCTGCCCCCCACGATGGGGACAGAAAGGAGCTGC
CCCGGGAGCAGCCTCTGCCCCCTGGCCCCATTGGCACAGAACGATCACAGCGTACAGACCGAGGCACAGAGCCTGGCCCCATTCGGCCAT
CCCATCGACCTGGTCCCCCAGTCCAGTTTGGCACTAGTGACAAGGGTAATGTTGGTGCTCCTGGAGCCAAAGGTGCTCGCGGCAGCGCTG
GTCCCCCTGGTGCTACTGGTTTCCCTGGTGCTGCTGGCCGAGTCGGTCCTCCTGGCCCCTCTGGAAATGCTGGACCCCCTGGCCCTCCTG
GTCCTGCTGGCAAAGAAGGCGGCAAAGGTCCCCGTGGTGAGACTGGCCCTGCTGGACGTCCTGGTGAAGTTGGTCCCCCTGGTCCCCCTG
GCCCTGCTGGCGAGAAAGGATCCCCTGGTGCTGATGGTCCTGCTGGTGCTCCTGGTACTCCCGGGCCTCAAGGTATTGCTGGACAGCGTG
GTGTGGTCGGCCTGCCTGGTCAGAGAGGAGAGAGAGGCTTCCCTGGTCTTCCTGGCCCCTCTGGTGAACCTGGCAAACAAGGTCCCTCTG
GAGCAAGTGGTGAACGTGGTCCCCCTGGTCCCATGGGCCCCCCTGGATTGGCTGGACCCCCTGGTGAATCTGGACGTGAGGGGGCTCCTG
GTGCCGAAGGTTCCCCTGGACGAGACGGTTCTCCTGGCGCCAAGGGTGACCGTGGTGAGACCGGCCCCGCTGGACCCCCTGGTGCTCCTG
GTGCTCCTGGTGCCCCTGGCCCCGTTGGCCCTGCTGGCAAGAGTGGTGATCGTGGTGAGACTGGTCCTGCTGGTCCCACCGGTCCTGTCG
GCCCTGTTGGCGCCCGTGGCCCCGCCGGACCCCAAGGCCCCCGTGGTGACAAGGGTGAGACAGGCGAACAGGGCGACAGAGGCATAAAGG
GTCACCGTGGCTTCTCTGGCCTCCAGGGTCCCCCTGGCCCTCCTGGCTCTCCTGGTGAACAAGGTCCCTCTGGAGCCTCTGGTCCTGCTG
GTCCCCGAGGTCCCCCTGGCTCTGCTGGTGCTCCTGGCAAAGATGGACTCAACGGTCTCCCTGGCCCCATTGGGCCCCCTGGTCCTCGCG
GTCGCACTGGTGATGCTGGTCCTGTTGGTCCCCCCGGCCCTCCTGGACCTCCTGGTCCCCCTGGTCCTCCCAGCGCTGGTTTCGACTTCA
GCTTCCTGCCCCAGCCACCTCAAGAGAAGGCTCACGATGGTGGCCGCTACTACCGGGCTGATGATGCCAATGTGGTTCGTGACCGTGACC
TCGAGGTGGACACCACCCTCAAGAGCCTGAGCCAGCAGATCGAGAACATCCGGAGCCCAGAGGGCAGCCGCAAGAACCCCGCCCGCACCT
GCCGTGACCTCAAGATGTGCCACTCTGACTGGAAGAGTGGAGAGTACTGGATTGACCCCAACCAAGGCTGCAACCTGGATGCCATCAAAG
TCTTCTGCAACATGGAGACTGGTGAGACCTGCGTGTACCCCACTCAGCCCAGTGTGGCCCAGAAGAACTGGTACATCAGCAAGAACCCCA
AGGACAAGAGGCATGTCTGGTTCGGCGAGAGCATGACCGATGGATTCCAGTTCGAGTATGGCGGCCAGGGCTCCGACCCTGCCGATGTGG
CCATCCAGCTGACCTTCCTGCGCCTGATGTCCACCGAGGCCTCCCAGAACATCACCTACCACTGCAAGAACAGCGTGGCCTACATGGACC
AGCAGACTGGCAACCTCAAGAAGGCCCTGCTCCTCCAGGGCTCCAACGAGATCGAGATCCGCGCCGAGGGCAACAGCCGCTTCACCTACA
GCGTCACTGTCGATGGCTGCACGAGTCACACCGGAGCCTGGGGCAAGACAGTGATTGAATACAAAACCACCAAGACCTCCCGCCTGCCCA
TCATCGATGTGGCCCCCTTGGACGTTGGTGCCCCAGACCAGGAATTCGGCTTCGACGTTGGCCCTGTCTGCTTCCTGTAAACTCCCTCCA
TCCCAACCTGGCTCCCTCCCACCCAACCAACTTTCCCCCCAACCCGGAAACAGACAAGCAACCCAAACTGAACCCCCTCAAAAGCCAAAA
AATGGGAGACAATTTCACATGGACTTTGGAAAATATTTTTTTCCTTTGCATTCATCTCTCAAACTTAGTTTTTATCTTTGACCAACCGAA
CATGACCAAAAACCAAAAGTGCATTCAACCTTACCAAAAAAAAAAAAAAAAAAAGAATAAATAAATAACTTTTTAAAAAAGGAAGCTTGG
TCCACTTGCTTGAAGACCCATGCGGGGGTAAGTCCCTTTCTGCCCGTTGGGCTTATGAAACCCCAATGCTGCCCTTTCTGCTCCTTTCTC
CACACCCCCCTTGGGGCCTCCCCTCCACTCCTTCCCAAATCTGTCTCCCCAGAAGACACAGGAAACAATGTATTGTCTGCCCAGCAATCA
AAGGCAATGCTCAAACACCCAAGTGGCCCCCACCCTCAGCCCGCTCCTGCCCGCCCAGCACCCCCAGGCCCTGGGGGACCTGGGGTTCTC
AGACTGCCAAAGAAGCCTTGCCATCTGGCGCTCCCATGGCTCTTGCAACATCTCCCCTTCGTTTTTGAGGGGGTCATGCCGGGGGAGCCA
CCAGCCCCTCACTGGGTTCGGAGGAGAGTCAGGAAGGGCCACGACAAAGCAGAAACATCGGATTTGGGGAACGCGTGTCAATCCCTTGTG
CCGCAGGGCTGGGCGGGAGAGACTGTTCTGTTCCTTGTGTAACTGTGTTGCTGAAAGACTACCTCGTTCTTGTCTTGATGTGTCACCGGG
GCAACTGCCTGGGGGCGGGGATGGGGGCAGGGTGGAAGCGGCTCCCCATTTTATACCAAAGGTGCTACATCTATGTGATGGGTGGGGTGG
GGAGGGAATCACTGGTGCTATAGAAATTGAGATGCCCCCCCAGGCCAGCAAATGTTCCTTTTTGTTCAAAGTCTATTTTTATTCCTTGAT
ATTTTTCTTTTTTTTTTTTTTTTTTTGTGGATGGGGACTTGTGAATTTTTCTAAAGGTGCTATTTAACATGGGAGGAGAGCGTGTGCGGC
TCCAGCCCAGCCCGCTGCTCACTTTCCACCCTCTCTCCACCTGCCTCTGGCTTCTCAGGCCTCTGCTCTCCGACCTCTCTCCTCTGAAAC
CCTCCTCCACAGCTGCAGCCCATCCTCCCGGCTCCCTCCTAGTCTGTCCTGCGTCCTCTGTCCCCGGGTTTCAGAGACAACTTCCCAAAG
CACAAAGCAGTTTTTCCCCCTAGGGGTGGGAGGAAGCAAAAGACTCTGTACCTATTTTGTATGTGTATAATAATTTGAGATGTTTTTAAT
TATTTTGATTGCTGGAATAAAGCATGTGGAAATGACCCAAACATAATCCGCAGTGGCCTCCTAATTTCCTTCTTTGGAGTTGGGGGAGGG
GTAGACATGGGGAAGGGGCTTTGGGGTGATGGGCTTGCCTTCCATTCCTGCCCTTTCCCTCCCCACTATTCTCTTCTAGATCCCTCCATA
ACCCCACTCCCCTTTCTCTCACCCTTCTTATACCGCAAACCTTTCTACTTCCTCTTTCATTTTCTATTCTTGCAATTTCCTTGCACCTTT
TCCAAATCCTCTTCTCCCCTGCAATACCATACAGGCAATCCACGTGCACAACACACACACACACTCTTCACATCTGGGGTTGTCCAAACC
TCATACCCACTCCCCTTCAAGCCCATCCACTCTCCACCCCCTGGATGCCCTGCACTTGGTGGCGGTGGGATGCTCATGGATACTGGGAGG
GTGAGGGGAGTGGAACCCGTGAGGAGGACCTGGGGGCCTCTCCTTGAACTGACATGAAGGGTCATCTGGCCTCTGCTCCCTTCTCACCCA
CGCTGACCTCCTGCCGAAGGAGCAACGCAACAGGAGAGGGGTCTGCTGAGCCTGGCGAGGGTCTGGGAGGGACCAGGAGGAAGGCGTGCT
CCCTGCTCGCTGTCCTGGCCCTGGGGGAGTGAGGGAGACAGACACCTGGGAGAGCTGTGGGGAAGGCACTCGCACCGTGCTCTTGGGAAG
GAAGGAGACCTGGCCCTGCTCACCACGGACTGGGTGCCTCGACCTCCTGAATCCCCAGAACACAACCCCCCTGGGCTGGGGTGGTCTGGG


Top

FusionGenePPI for PRRC2A_COL1A1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PRRC2AGRB2, FGA, MAD2L2, P4HA2, CCR10, C1QBP, EIF3E, GANAB, HNRNPA1, PSMA3, HNRNPM, MAN2C1, SSR3, DDX20, UBAP2L, IMMT, CPSF1, PRMT2, QARS, IFT88, EIF3F, CALCOCO2, SIRT7, SH3KBP1, CUL3, CAND1, RBFOX1, ATN1, ATXN1, ATXN1L, RERE, EWSR1, GORASP2, JUN, TARDBP, RPA1, RPA2, RPA3, WWOX, LGR4, SHFM1, TP53, TUBGCP3, BMI1, LUC7L, NCK2, RBFOX2, BTRC, FBXW11, NTRK1, IFI16, SRPK2, NPHP1, HIST1H3E, NOP56, EXOSC2, WWP2, CDC14A, SFPQ, CHCHD10, SNRNP70, CAPN13, CLEC3A, DUSP23, TRPC4AP, TMA16, FUOM, CELA1, TEKT3, CYLD, G3BP1COL1A1IGFBP3, TXN, ITGA2, ITGB1, NID1, NID2, SPARC, PRELP, PKD1, VWF, THBS1, MMP2, COL7A1, MATN2, MAG, ELAVL1, ATP13A2, C12orf57, RNH1, BARD1, BRCA1, UBC, CAPN1, COL1A1, COL1A2, PDGFA, PDGFB, GIPC2, UBXN11, DNM3, CD200R1, TMTC4, ERAL1, CAMKMT, TMEM180, OTUB1, EGFR, COLGALT2, P4HA2, PLOD1, LIN9, TIMM44, RASGEF1B, TLE3, YAF2, LPAR1, CYLD, MCPH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PRRC2A_COL1A1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneCOL1A1P02452DB00048Collagenase clostridium histolyticumCollagen alpha-1(I) chainbiotechapproved|investigational
TgeneCOL1A1P02452DB13133Von Willebrand Factor HumanCollagen alpha-1(I) chainbiotechapproved|investigational

Top

RelatedDiseases for PRRC2A_COL1A1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCOL1A1C0268358Osteogenesis imperfecta, dominant perinatal lethal39CTD_human;ORPHANET;UNIPROT
TgeneCOL1A1C0268362Osteogenesis imperfecta type III (disorder)18CTD_human;ORPHANET;UNIPROT
TgeneCOL1A1C0268363Osteogenesis imperfecta type IV (disorder)14CTD_human;ORPHANET;UNIPROT
TgeneCOL1A1C0023931Lobstein's Disease12ORPHANET;UNIPROT
TgeneCOL1A1C0023890Liver Cirrhosis4CTD_human
TgeneCOL1A1C0023893Liver Cirrhosis, Experimental3CTD_human
TgeneCOL1A1C4225429Ehlers-Danlos syndrome classic type2UNIPROT
TgeneCOL1A1C0000786Spontaneous abortion1CTD_human
TgeneCOL1A1C0002949Aneurysm, Dissecting1CTD_human
TgeneCOL1A1C0003504Aortic Valve Insufficiency1CTD_human
TgeneCOL1A1C0004364Autoimmune Diseases1CTD_human
TgeneCOL1A1C0006663Calcinosis1CTD_human
TgeneCOL1A1C0008311Cholangitis1CTD_human
TgeneCOL1A1C0016059Fibrosis1CTD_human
TgeneCOL1A1C0018824Heart valve disease1CTD_human
TgeneCOL1A1C0020497Cortical Congenital Hyperostosis1CTD_human;ORPHANET;UNIPROT
TgeneCOL1A1C0020538Hypertensive disease1CTD_human
TgeneCOL1A1C0022548Keloid1CTD_human
TgeneCOL1A1C0027726Nephrotic Syndrome1CTD_human
TgeneCOL1A1C0029172Oral Submucous Fibrosis1CTD_human
TgeneCOL1A1C0029434Osteogenesis Imperfecta1CTD_human
TgeneCOL1A1C0149721Left Ventricular Hypertrophy1CTD_human
TgeneCOL1A1C1619692Nephrogenic Fibrosing Dermopathy1CTD_human