FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2888

FusionGeneSummary for ASAH1_WWOX

check button Fusion gene summary
Fusion gene informationFusion gene name: ASAH1_WWOX
Fusion gene ID: 2888
HgeneTgene
Gene symbol

ASAH1

WWOX

Gene ID

427

51741

Gene nameN-acylsphingosine amidohydrolase 1WW domain containing oxidoreductase
SynonymsAC|ACDase|ASAH|PHP|PHP32|SMAPMED16S432E|EIEE28|FOR|FRA16D|HHCMA56|PRO0128|SCAR12|SDR41C1|WOX1
Cytomap

8p22

16q23.1-q23.2

Type of geneprotein-codingprotein-coding
Descriptionacid ceramidaseN-acylsphingosine amidohydrolase (acid ceramidase) 1acid CDaseacylsphingosine deacylaseputative 32 kDa heart proteinWW domain-containing oxidoreductaseWW domain-containing protein WWOXfragile site FRA16D oxidoreductaseshort chain dehydrogenase/reductase family 41C member 1
Modification date2018052920180523
UniProtAcc

Q13510

Q9NZC7

Ensembl transtripts involved in fusion geneENST00000262097, ENST00000381733, 
ENST00000417108, ENST00000520781, 
ENST00000314146, ENST00000520051, 
ENST00000566780, ENST00000406884, 
ENST00000539474, ENST00000402655, 
ENST00000408984, ENST00000355860, 
ENST00000565791, ENST00000569818, 
Fusion gene scores* DoF score6 X 7 X 3=12614 X 7 X 7=686
# samples 716
** MAII scorelog2(7/126*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(16/686*10)=-2.10013667128545
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ASAH1 [Title/Abstract] AND WWOX [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneWWOX

GO:0030178

negative regulation of Wnt signaling pathway

19465938

TgeneWWOX

GO:0071560

cellular response to transforming growth factor beta stimulus

19366691


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-56-6545-01AASAH1chr8

17927301

-WWOXchr16

79245505

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000262097ENST00000566780ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000262097ENST00000406884ASAH1chr8

17927301

-WWOXchr16

79245505

+
In-frameENST00000262097ENST00000539474ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000262097ENST00000402655ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000262097ENST00000408984ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000262097ENST00000355860ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000262097ENST00000565791ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000262097ENST00000569818ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000381733ENST00000566780ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000381733ENST00000406884ASAH1chr8

17927301

-WWOXchr16

79245505

+
In-frameENST00000381733ENST00000539474ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000381733ENST00000402655ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000381733ENST00000408984ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000381733ENST00000355860ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000381733ENST00000565791ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000381733ENST00000569818ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000417108ENST00000566780ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000417108ENST00000406884ASAH1chr8

17927301

-WWOXchr16

79245505

+
In-frameENST00000417108ENST00000539474ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000417108ENST00000402655ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000417108ENST00000408984ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000417108ENST00000355860ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000417108ENST00000565791ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000417108ENST00000569818ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000520781ENST00000566780ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000520781ENST00000406884ASAH1chr8

17927301

-WWOXchr16

79245505

+
In-frameENST00000520781ENST00000539474ASAH1chr8

17927301

-WWOXchr16

79245505

+
Frame-shitENST00000520781ENST00000402655ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000520781ENST00000408984ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000520781ENST00000355860ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000520781ENST00000565791ASAH1chr8

17927301

-WWOXchr16

79245505

+
5CDS-intronENST00000520781ENST00000569818ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-3CDSENST00000314146ENST00000566780ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-3CDSENST00000314146ENST00000406884ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-3CDSENST00000314146ENST00000539474ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-3CDSENST00000314146ENST00000402655ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-intronENST00000314146ENST00000408984ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-intronENST00000314146ENST00000355860ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-intronENST00000314146ENST00000565791ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-intronENST00000314146ENST00000569818ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-3CDSENST00000520051ENST00000566780ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-3CDSENST00000520051ENST00000406884ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-3CDSENST00000520051ENST00000539474ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-3CDSENST00000520051ENST00000402655ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-intronENST00000520051ENST00000408984ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-intronENST00000520051ENST00000355860ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-intronENST00000520051ENST00000565791ASAH1chr8

17927301

-WWOXchr16

79245505

+
intron-intronENST00000520051ENST00000569818ASAH1chr8

17927301

-WWOXchr16

79245505

+

Top

FusionProtFeatures for ASAH1_WWOX


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ASAH1

Q13510

WWOX

Q9NZC7

Hydrolyzes the sphingolipid ceramide into sphingosineand free fatty acid. {ECO:0000269|PubMed:7744740}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ASAH1_WWOX


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ASAH1_ENST00000262097_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_153aa
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTTPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPVLKVIVNSLKNMINTFVPS

>In-frame_ASAH1_ENST00000381733_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_169aa
MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTTPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPVLK

>In-frame_ASAH1_ENST00000417108_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_88aa

>In-frame_ASAH1_ENST00000520781_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_153aa
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTTPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPVLKVIVNSLKNMINTFVPS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ASAH1_ENST00000262097_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_460nt
ATGCCGGGCCGGAGTTGCGTCGCCTTAGTCCTCCTGGCTGCCGCCGTCAGCTGTGCCGTCGCGCAGCACGCGCCGCCGTGGACAGAGGAC
TGCAGAAAATCAACCTATCCTCCTTCAGGACCAACGTACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAA
AGATGGCATGAATTGATGCTTGACAAGGCACCAGTGCTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGT
GGAAAAATTATGCAGGTGGTGGATGAAAAATTGCAACAGGGAGCTGCCACCACCGTGTACTGTGCTGCTGTCCCAGAACTGGAGGGTCTG
GGAGGGATGTACTTCAACAACTGCTGCCGCTGCATGCCCTCACCAGAAGCTCAGAGCGAAGAGACGGCCCGGACCCTGTGGGCGCTCAGC

>In-frame_ASAH1_ENST00000381733_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_508nt
ATGAACTGCTGCATCGGGCTGGGAGAGAAAGCTCGCGGGTCCCACCGGGCCTCCTACCCAAGTCTCAGCGCGCTTTTCACCGAGGCCTCA
ATTCTGGGATTTGGCAGCTTTGCTGTGAAAGCCCAATGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACGTACAGA
GGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTGCTAAAG
GTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCAACAGGGA
GCTGCCACCACCGTGTACTGTGCTGCTGTCCCAGAACTGGAGGGTCTGGGAGGGATGTACTTCAACAACTGCTGCCGCTGCATGCCCTCA

>In-frame_ASAH1_ENST00000417108_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_265nt
ATGCTTGACAAGGCACCAGTGCTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAG
GTGGTGGATGAAAAATTGCAACAGGGAGCTGCCACCACCGTGTACTGTGCTGCTGTCCCAGAACTGGAGGGTCTGGGAGGGATGTACTTC

>In-frame_ASAH1_ENST00000520781_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_460nt
ATGCCGGGCCGGAGTTGCGTCGCCTTAGTCCTCCTGGCTGCCGCCGTCAGCTGTGCCGTCGCGCAGCACGCGCCGCCGTGGACAGAGGAC
TGCAGAAAATCAACCTATCCTCCTTCAGGACCAACGTACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAA
AGATGGCATGAATTGATGCTTGACAAGGCACCAGTGCTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGT
GGAAAAATTATGCAGGTGGTGGATGAAAAATTGCAACAGGGAGCTGCCACCACCGTGTACTGTGCTGCTGTCCCAGAACTGGAGGGTCTG
GGAGGGATGTACTTCAACAACTGCTGCCGCTGCATGCCCTCACCAGAAGCTCAGAGCGAAGAGACGGCCCGGACCCTGTGGGCGCTCAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ASAH1_ENST00000262097_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_1675nt
GGCTCGGTCCGACTATTGCCCGCGGTGGGGGAGGGGGATGGATCACGCCACGCGCCAAAGGCGATCGCGACTCTCCTTCTGCAGGTAGCC
TGGAAGGCTCTCTCTCTTTCTCTACGCCACCCTTTTCGTGGCACTGAAAAGCCCCGTCCTCTCCTCCCAGTCCCGCCTCCTCCGAGCGTT
CCCCCTACTGCCTGGAATGGTGCGGTCCCAGGTCGCGGGTCACGCGGCGGAGGGGGCGTGGCCTGCCCCCGGCCCAGCCGGCTCTTCTTT
GCCTCTGCTGGAGTCCGGGGAGTGGCGTTGGCTGCTAGAGCGATGCCGGGCCGGAGTTGCGTCGCCTTAGTCCTCCTGGCTGCCGCCGTC
AGCTGTGCCGTCGCGCAGCACGCGCCGCCGTGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACGTACAGAGGTGCA
GTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTGCTAAAGGTTATA
GTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCAACAGGGAGCTGCC
ACCACCGTGTACTGTGCTGCTGTCCCAGAACTGGAGGGTCTGGGAGGGATGTACTTCAACAACTGCTGCCGCTGCATGCCCTCACCAGAA
GCTCAGAGCGAAGAGACGGCCCGGACCCTGTGGGCGCTCAGCGAGAGGCTGATCCAAGAACGGCTTGGCAGCCAGTCCGGCTAAGTGGAG
CTCAGAGCGGATGGGCACACACACCCGCCCTGTGTGTGTCCCCTCACGCAAGTGCCAGGGCTGGGCCCCTTCCAAATGTCCCTCCAACAC
AGATCCGCAAGAGTAAAGGAAATAAGAGCAGTCACAACAGAGTGAAAAATCTTAAGTACCAATGGGAAGCAGGGAATTCCTGGGGTAAAG
TATCACTTTTCTGGGGCTGGGCTAGGCATAGGTCTCTTTGCTTTCTGGTGGTGGCCTGTTTGAAAGTAAAAACCTGCTTGGTGTGTAGGT
TCCGTATCTCCCTGGAGAAGCACCAGCAATTCTCTTTCTTTTACTGTTATAGAATAGCCTGAGGTCCCCTCGTCCCATCCAGCTACCACC
ACGGCCACCACTGCAGCCGGGGGCTGGCCTTCTCCTACTTAGGGAAGAAAAAGCAAGTGTTCACTGCTCCTTGCTGCATTGATCCAGGAG
ATAATTGTTTCATTCATCCTGACCAAGACTGAGCCAGCTTAGCAACTGCTGGGGAGACAAATCTCAGAACCTTGTCCCAGCCAGTGAGGA
TGACAGTGACACCCAGAGGGAGTAGAATACGCAGAACTACCAGGTGGCAAAGTACTTGTCATAGACTCCTTTGCTAATGCTATGCAAAAA
ATTCTTTAGAGATTATAACAAATTTTTCAAATCATTCCTTAGATACCTTGAAAGGCAGGAAGGGAAGCGTATATACTTAAGAATACACAG
GATATTTTGGGGGGCAGAGAATAAAACGTTAGTTAATCCCTTTGTCTGTCAATCACAGTCTCAGTTCTCTTGCTTTCACATTGTACTTAA

>In-frame_ASAH1_ENST00000381733_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_1578nt
GGACTTTGAAATCCAACCCGGTCACCTACCCGCGCGACTGTGTCCACGGATGGCACGAAAGCCAAGCGAGTCCCCCTGCCGAGCTACTCG
CGTCCGCCTCCTCCCAAGCTGAGCTCTGCTCCGCCCACCTGAGTCCTTCGCCAGTTAGGAGGAAACACAGCCGCTTAATGAACTGCTGCA
TCGGGCTGGGAGAGAAAGCTCGCGGGTCCCACCGGGCCTCCTACCCAAGTCTCAGCGCGCTTTTCACCGAGGCCTCAATTCTGGGATTTG
GCAGCTTTGCTGTGAAAGCCCAATGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACGTACAGAGGTGCAGTTCCAT
GGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTGCTAAAGGTTATAGTGAATT
CTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCAACAGGGAGCTGCCACCACCG
TGTACTGTGCTGCTGTCCCAGAACTGGAGGGTCTGGGAGGGATGTACTTCAACAACTGCTGCCGCTGCATGCCCTCACCAGAAGCTCAGA
GCGAAGAGACGGCCCGGACCCTGTGGGCGCTCAGCGAGAGGCTGATCCAAGAACGGCTTGGCAGCCAGTCCGGCTAAGTGGAGCTCAGAG
CGGATGGGCACACACACCCGCCCTGTGTGTGTCCCCTCACGCAAGTGCCAGGGCTGGGCCCCTTCCAAATGTCCCTCCAACACAGATCCG
CAAGAGTAAAGGAAATAAGAGCAGTCACAACAGAGTGAAAAATCTTAAGTACCAATGGGAAGCAGGGAATTCCTGGGGTAAAGTATCACT
TTTCTGGGGCTGGGCTAGGCATAGGTCTCTTTGCTTTCTGGTGGTGGCCTGTTTGAAAGTAAAAACCTGCTTGGTGTGTAGGTTCCGTAT
CTCCCTGGAGAAGCACCAGCAATTCTCTTTCTTTTACTGTTATAGAATAGCCTGAGGTCCCCTCGTCCCATCCAGCTACCACCACGGCCA
CCACTGCAGCCGGGGGCTGGCCTTCTCCTACTTAGGGAAGAAAAAGCAAGTGTTCACTGCTCCTTGCTGCATTGATCCAGGAGATAATTG
TTTCATTCATCCTGACCAAGACTGAGCCAGCTTAGCAACTGCTGGGGAGACAAATCTCAGAACCTTGTCCCAGCCAGTGAGGATGACAGT
GACACCCAGAGGGAGTAGAATACGCAGAACTACCAGGTGGCAAAGTACTTGTCATAGACTCCTTTGCTAATGCTATGCAAAAAATTCTTT
AGAGATTATAACAAATTTTTCAAATCATTCCTTAGATACCTTGAAAGGCAGGAAGGGAAGCGTATATACTTAAGAATACACAGGATATTT
TGGGGGGCAGAGAATAAAACGTTAGTTAATCCCTTTGTCTGTCAATCACAGTCTCAGTTCTCTTGCTTTCACATTGTACTTAAACCTCCT

>In-frame_ASAH1_ENST00000417108_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_1399nt
GCTGGAGTCCGGGGAGTGGCGTTGGCTGCTAGAGCGATGCCGGGCCGGAGTTGCGTCGCCTTAGTCCTCCTGGCTGCCGCCGTCAGCTGT
GCCGTCGCGCAGCACGCGCCGCCGTGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACGTACAGAGGTGCAGTTCCA
TGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTGCTAAAGGTTATAGTGAAT
TCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCAACAGGGAGCTGCCACCACC
GTGTACTGTGCTGCTGTCCCAGAACTGGAGGGTCTGGGAGGGATGTACTTCAACAACTGCTGCCGCTGCATGCCCTCACCAGAAGCTCAG
AGCGAAGAGACGGCCCGGACCCTGTGGGCGCTCAGCGAGAGGCTGATCCAAGAACGGCTTGGCAGCCAGTCCGGCTAAGTGGAGCTCAGA
GCGGATGGGCACACACACCCGCCCTGTGTGTGTCCCCTCACGCAAGTGCCAGGGCTGGGCCCCTTCCAAATGTCCCTCCAACACAGATCC
GCAAGAGTAAAGGAAATAAGAGCAGTCACAACAGAGTGAAAAATCTTAAGTACCAATGGGAAGCAGGGAATTCCTGGGGTAAAGTATCAC
TTTTCTGGGGCTGGGCTAGGCATAGGTCTCTTTGCTTTCTGGTGGTGGCCTGTTTGAAAGTAAAAACCTGCTTGGTGTGTAGGTTCCGTA
TCTCCCTGGAGAAGCACCAGCAATTCTCTTTCTTTTACTGTTATAGAATAGCCTGAGGTCCCCTCGTCCCATCCAGCTACCACCACGGCC
ACCACTGCAGCCGGGGGCTGGCCTTCTCCTACTTAGGGAAGAAAAAGCAAGTGTTCACTGCTCCTTGCTGCATTGATCCAGGAGATAATT
GTTTCATTCATCCTGACCAAGACTGAGCCAGCTTAGCAACTGCTGGGGAGACAAATCTCAGAACCTTGTCCCAGCCAGTGAGGATGACAG
TGACACCCAGAGGGAGTAGAATACGCAGAACTACCAGGTGGCAAAGTACTTGTCATAGACTCCTTTGCTAATGCTATGCAAAAAATTCTT
TAGAGATTATAACAAATTTTTCAAATCATTCCTTAGATACCTTGAAAGGCAGGAAGGGAAGCGTATATACTTAAGAATACACAGGATATT
TTGGGGGGCAGAGAATAAAACGTTAGTTAATCCCTTTGTCTGTCAATCACAGTCTCAGTTCTCTTGCTTTCACATTGTACTTAAACCTCC

>In-frame_ASAH1_ENST00000520781_chr8_17927301_-_WWOX_ENST00000539474_chr16_79245505_+_1675nt
GGCTCGGTCCGACTATTGCCCGCGGTGGGGGAGGGGGATGGATCACGCCACGCGCCAAAGGCGATCGCGACTCTCCTTCTGCAGGTAGCC
TGGAAGGCTCTCTCTCTTTCTCTACGCCACCCTTTTCGTGGCACTGAAAAGCCCCGTCCTCTCCTCCCAGTCCCGCCTCCTCCGAGCGTT
CCCCCTACTGCCTGGAATGGTGCGGTCCCAGGTCGCGGGTCACGCGGCGGAGGGGGCGTGGCCTGCCCCCGGCCCAGCCGGCTCTTCTTT
GCCTCTGCTGGAGTCCGGGGAGTGGCGTTGGCTGCTAGAGCGATGCCGGGCCGGAGTTGCGTCGCCTTAGTCCTCCTGGCTGCCGCCGTC
AGCTGTGCCGTCGCGCAGCACGCGCCGCCGTGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACGTACAGAGGTGCA
GTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTGCTAAAGGTTATA
GTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCAACAGGGAGCTGCC
ACCACCGTGTACTGTGCTGCTGTCCCAGAACTGGAGGGTCTGGGAGGGATGTACTTCAACAACTGCTGCCGCTGCATGCCCTCACCAGAA
GCTCAGAGCGAAGAGACGGCCCGGACCCTGTGGGCGCTCAGCGAGAGGCTGATCCAAGAACGGCTTGGCAGCCAGTCCGGCTAAGTGGAG
CTCAGAGCGGATGGGCACACACACCCGCCCTGTGTGTGTCCCCTCACGCAAGTGCCAGGGCTGGGCCCCTTCCAAATGTCCCTCCAACAC
AGATCCGCAAGAGTAAAGGAAATAAGAGCAGTCACAACAGAGTGAAAAATCTTAAGTACCAATGGGAAGCAGGGAATTCCTGGGGTAAAG
TATCACTTTTCTGGGGCTGGGCTAGGCATAGGTCTCTTTGCTTTCTGGTGGTGGCCTGTTTGAAAGTAAAAACCTGCTTGGTGTGTAGGT
TCCGTATCTCCCTGGAGAAGCACCAGCAATTCTCTTTCTTTTACTGTTATAGAATAGCCTGAGGTCCCCTCGTCCCATCCAGCTACCACC
ACGGCCACCACTGCAGCCGGGGGCTGGCCTTCTCCTACTTAGGGAAGAAAAAGCAAGTGTTCACTGCTCCTTGCTGCATTGATCCAGGAG
ATAATTGTTTCATTCATCCTGACCAAGACTGAGCCAGCTTAGCAACTGCTGGGGAGACAAATCTCAGAACCTTGTCCCAGCCAGTGAGGA
TGACAGTGACACCCAGAGGGAGTAGAATACGCAGAACTACCAGGTGGCAAAGTACTTGTCATAGACTCCTTTGCTAATGCTATGCAAAAA
ATTCTTTAGAGATTATAACAAATTTTTCAAATCATTCCTTAGATACCTTGAAAGGCAGGAAGGGAAGCGTATATACTTAAGAATACACAG
GATATTTTGGGGGGCAGAGAATAAAACGTTAGTTAATCCCTTTGTCTGTCAATCACAGTCTCAGTTCTCTTGCTTTCACATTGTACTTAA


Top

FusionGenePPI for ASAH1_WWOX


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ASAH1SETDB1, TSC22D1, PSMA3, FBXO6, CAMK1D, SRPK1, GSG1, PNKD, AAGAB, AAMP, NEFH, CAMK2B, HSF2, HSPB2, HERC2, CYP1A2, GLT1D1, ZIC1, ZSCAN12, FTH1, NONO, TBC1D22B, SLCO6A1, AIRE, HTATIP2, RNF6, TRMT2A, ZNF684, ZNF556, HMP19, LYPD1, NCDNWWOXTP53, CPSF6, TNK2, ERBB4, MDM2, TP63, MAPK8, LMNA, POLR2A, POLR2B, SMARCC1, TCERG1, CPSF1, CPSF2, CPSF3, NUDT21, FIP1L1, CPSF7, HNRNPK, RPRD2, PABPC1, SF3A1, SF3B1, SF3B3, SFPQ, SYMPK, WIPF2, WDR33, WBP2, SF3B2, KHSRP, CSTF3, HSPA4, DHX15, KRT4, MIA3, OTUD7B, PRPF8, ACIN1, PATL1, P4HA1, DSP, ANXA1, HSPA1A, PRRC2A, SERPINB3, COIL, PGD, DIAPH3, CSNK2A1, SNRNP200, DAZAP1, RPRD1B, HSPA8, ENAH, PABPC4, IGF2BP1, HSD17B10, HDLBP, DVL2, SF3A3, CCT2, SNRPD2, SMARCA4, CDC5L, YWHAZ, UBAP2, CANX, SNRPD1, JUP, RARA, PRMT5, U2SURP, TGM3, TDRD3, PKLR, NOLC1, YLPM1, WASL, CSTF2, MATR3, TOE1, BCL9, CRNN, HIST2H2AA3, DVL3, P3H1, PRPF3, CSNK2A2, SCAF4, DSG3, RBMX, CYFIP1, USP6NL, DDX6, XRN2, IVL, XAB2, AMOTL1, MPDZ, DDX3Y, HNRNPUL1, DHX9, POLR2E, FBRS, WDR77, SEC23A, ZMAT5, DGCR14, LZTS2, NOSIP, DCAF7, GEMIN5, PRPF40A, EIF4A3, INPPL1, LSM4, DDX17, IGF2BP3, RC3H1, MPP5, POLR2C, FARSA, HNRNPH3, DHX30, RPRD1A, ZG16B, NONO, PREB, PABPC3, LONP2, ATN1, GABARAPL2, HNRNPR, HNRNPCL1, CYFIP2, ELAVL1, ITCH, DRG1, SNRPD3, RPAP3, DROSHA, HNRNPU, SMN2, CAD, CCT7, PTPN14, PPP1CA, HNRNPA3, DDX39B, SCGB2A1, KRT75, DDX21, SPG20, CSDE1, HNRNPF, SRSF10, SEC23IP, ATP2A1, DIAPH1, LCN1, DOCK7, CXorf57, SF3A2, HSPB1, TARDBP, SF3B6, A2ML1, AMOT, THOC6, KIF2A, LUC7L3, MYH7, MYH1, MYH4, MYH16, DDX1, ENO1, TP73, CCT6A, SMARCE1, ANXA2, ACLY, SCAF8, ALDH3A1, PPIB, EDC4, RPL6, USP39, EIF3A, H2AFZ, RPL30, KDM3B, FUS, SERPINB5, DVL1, RAPGEF2, DHX36, HN1L, POLR2G, BAIAP2, WDR91, DCTPP1, IQSEC1, PRDX5, LZTS3, RPS15AP21, SRSF3, ZNF598, LACRT, IGF2BP2, PAICS, KIAA1522, SLC4A1AP, ATXN2, THRAP3, RBM39, CAPZA1, SEC24C, NOP56, SRPK1, DKC1, IK, HADHA, OGT, PRPF31, DIDO1, ATAD3A, PDCD7, HUWE1, ATM, TRIM28, HIF1A, LATS1, FAM189B, TMEM171, FAM189A2, WBP1, TMEM92, LDLRAD4, CLNK, BTRC, NUP133, CDH1, FKBP15, SERPINA5, ARRDC3, NME2, GORASP1, ZBTB33, LYZ, TRIM25, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ASAH1_WWOX


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ASAH1_WWOX


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneASAH1C0268255Farber Lipogranulomatosis8CTD_human;ORPHANET;UNIPROT
HgeneASAH1C0023794Lipoidosis2CTD_human
HgeneASAH1C1834569Jankovic Rivera syndrome2ORPHANET;UNIPROT
HgeneASAH1C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneASAH1C0036341Schizophrenia1PSYGENET
HgeneASAH1C0221765Chronic schizophrenia1PSYGENET
TgeneWWOXC0007137Squamous cell carcinoma1CTD_human
TgeneWWOXC0038356Stomach Neoplasms1CTD_human
TgeneWWOXC0042076Urologic Neoplasms1CTD_human
TgeneWWOXC0279626Squamous cell carcinoma of esophagus1CTD_human
TgeneWWOXC1458155Mammary Neoplasms1CTD_human
TgeneWWOXC3280452SPINOCEREBELLAR ATAXIA, AUTOSOMAL RECESSIVE 121ORPHANET;UNIPROT
TgeneWWOXC3495559Juvenile arthritis1CTD_human
TgeneWWOXC4015519EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 281UNIPROT