FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28851

FusionGeneSummary for PRPF18_CACNB2

check button Fusion gene summary
Fusion gene informationFusion gene name: PRPF18_CACNB2
Fusion gene ID: 28851
HgeneTgene
Gene symbol

PRPF18

CACNB2

Gene ID

8559

783

Gene namepre-mRNA processing factor 18calcium voltage-gated channel auxiliary subunit beta 2
SynonymsPRP18|hPrp18CACNLB2|CAVB2|MYSB
Cytomap

10p13

10p12.33-p12.31

Type of geneprotein-codingprotein-coding
Descriptionpre-mRNA-splicing factor 18PRP18 homologPRP18 pre-mRNA processing factor 18 homologPRP18 pre-mRNA processing factor 18 homolog(PRPF18)voltage-dependent L-type calcium channel subunit beta-2CAB2calcium channel voltage-dependent subunit beta 2calcium channel, voltage-dependent, beta 2 subunitlambert-Eaton myasthenic syndrome antigen Bmyasthenic (Lambert-Eaton) syndrome antigen B
Modification date2018052320180523
UniProtAcc

Q99633

Q08289

Ensembl transtripts involved in fusion geneENST00000378572, ENST00000324631, 
ENST00000377328, ENST00000352115, 
ENST00000282343, ENST00000377331, 
ENST00000396576, ENST00000377319, 
ENST00000377329, ENST00000377315, 
ENST00000467034, 
Fusion gene scores* DoF score4 X 4 X 3=485 X 5 X 3=75
# samples 45
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PRPF18 [Title/Abstract] AND CACNB2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCACNB2

GO:0051928

positive regulation of calcium ion transport

1309651

TgeneCACNB2

GO:0070509

calcium ion import

1309651


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A12L-01APRPF18chr10

13647744

+CACNB2chr10

18439812

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000378572ENST00000324631PRPF18chr10

13647744

+CACNB2chr10

18439812

+
In-frameENST00000378572ENST00000377328PRPF18chr10

13647744

+CACNB2chr10

18439812

+
In-frameENST00000378572ENST00000352115PRPF18chr10

13647744

+CACNB2chr10

18439812

+
In-frameENST00000378572ENST00000282343PRPF18chr10

13647744

+CACNB2chr10

18439812

+
In-frameENST00000378572ENST00000377331PRPF18chr10

13647744

+CACNB2chr10

18439812

+
5CDS-intronENST00000378572ENST00000396576PRPF18chr10

13647744

+CACNB2chr10

18439812

+
5CDS-intronENST00000378572ENST00000377319PRPF18chr10

13647744

+CACNB2chr10

18439812

+
5CDS-intronENST00000378572ENST00000377329PRPF18chr10

13647744

+CACNB2chr10

18439812

+
5CDS-intronENST00000378572ENST00000377315PRPF18chr10

13647744

+CACNB2chr10

18439812

+
5CDS-3UTRENST00000378572ENST00000467034PRPF18chr10

13647744

+CACNB2chr10

18439812

+

Top

FusionProtFeatures for PRPF18_CACNB2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PRPF18

Q99633

CACNB2

Q08289

Participates in the second step of pre-mRNA splicing.{ECO:0000269|PubMed:9000057}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCACNB2chr10:13647744chr10:18439812ENST00000282343+014114_18312633DomainSH3
TgeneCACNB2chr10:13647744chr10:18439812ENST00000324631+014114_18340661DomainSH3
TgeneCACNB2chr10:13647744chr10:18439812ENST00000352115+014114_18340637DomainSH3
TgeneCACNB2chr10:13647744chr10:18439812ENST00000377315+013114_183-73613DomainSH3
TgeneCACNB2chr10:13647744chr10:18439812ENST00000377319+013114_183-3568DomainSH3
TgeneCACNB2chr10:13647744chr10:18439812ENST00000377329+013114_183-64607DomainSH3
TgeneCACNB2chr10:13647744chr10:18439812ENST00000377331+014114_18312609DomainSH3
TgeneCACNB2chr10:13647744chr10:18439812ENST00000396576+013114_183-167606DomainSH3

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PRPF18_CACNB2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000324631_chr10_18439812_+_742aa
MDILKSEILRKRQLVEDRNLLVENKKTFKRSELAKKEEEATFERCGYKIQPKEEDQKPLTSSNPVLELELAEEKLPMTLSRQEVIRRLRE
RGEPIRLFGETDTDAFQRLRKIEILTPEVNKSTGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREA
ERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQR
AKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPTDVVP
SMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQ
LVVLDADTINHPAQLSKTSLAPIIVTVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADTLEA
YWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGL
SRQETFDSETQESRDSAYVEPKEDTSHDHVDHTASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDG

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000377328_chr10_18439812_+_492aa
MDILKSEILRKRQLVEDRNLLVENKKTFKRSELAKKEEEATFERCGYKIQPKEEDQKPLTSSNPVLELELAEEKLPMTLSRQEVIRRLRE
RGEPIRLFGETDTDAFQRLRKIEILTPEVNKSTGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREA
ERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDV
ILDENQLEDACEHLADTLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQ
HRSSSSAPHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDTSHDHVDHTASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHN

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000352115_chr10_18439812_+_718aa
MDILKSEILRKRQLVEDRNLLVENKKTFKRSELAKKEEEATFERCGYKIQPKEEDQKPLTSSNPVLELELAEEKLPMTLSRQEVIRRLRE
RGEPIRLFGETDTDAFQRLRKIEILTPEVNKSTGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREA
ERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQR
AKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSGAKSADEQDQWKTAGLFWRFTTEHTPPTDVVPSMRPVVLVGPSLKGYEVTDMMQKA
LFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPII
VTVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADTLEAYWKATHPPSSSLPNPLLSRTLATS
SLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKED

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000282343_chr10_18439812_+_742aa
MDILKSEILRKRQLVEDRNLLVENKKTFKRSELAKKEEEATFERCGYKIQPKEEDQKPLTSSNPVLELELAEEKLPMTLSRQEVIRRLRE
RGEPIRLFGETDTDAFQRLRKIEILTPEVNKSTGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREA
ERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQR
AKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPTDVVP
SMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQ
LVVLDADTINHPAQLSKTSLAPIIVTVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADTLEA
YWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGL
SRQETFDSETQESRDSAYVEPKEDTSHDHVDHTASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDG

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000377331_chr10_18439812_+_718aa
MDILKSEILRKRQLVEDRNLLVENKKTFKRSELAKKEEEATFERCGYKIQPKEEDQKPLTSSNPVLELELAEEKLPMTLSRQEVIRRLRE
RGEPIRLFGETDTDAFQRLRKIEILTPEVNKSTGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREA
ERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQR
AKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSGAKSADEQDQWKTAGLFWRFTTEHTPPTDVVPSMRPVVLVGPSLKGYEVTDMMQKA
LFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPII
VTVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADTLEAYWKATHPPSSSLPNPLLSRTLATS
SLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKED


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000324631_chr10_18439812_+_2226nt
ATGGACATTCTGAAATCAGAGATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGT
AGTGAGCTCGCCAAAAAAGAAGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACT
TCATCGAATCCAGTGTTAGAACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAA
AGAGGAGAACCAATCAGACTATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAAC
AAGTCATATGGAAAAGGAGCCAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTT
CGCCAGGGTTCGGCAGACTCCTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCG
GAGCGGCAGGCCCAGGCACAGTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCAT
GAAGATGATGTTCCAGTGCCTGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAACAATGACTGGTGG
ATAGGGCGATTGGTAAAAGAAGGCTGTGAAATCGGATTCATTCCAAGCCCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGA
GCCAAGCAAGGGAAATTCTACTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCCAGAAAATCAACA
CCTCCATCATCTGCTATAGACATAGATGCTACTGGCTTAGATGCAGAAGAAAATGATATTCCAGCAAACCACCGCTCCCCTAAACCCAGT
GCAAACAGTGTAACGTCACCCCACTCCAAAGAGAAAAGAATGCCCTTCTTTAAGAAGACAGAGCACACTCCTCCGTATGATGTGGTACCT
TCCATGCGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAGGTCACAGATATGATGCAAAAAGCGCTGTTTGATTTTTTAAAA
CACAGATTTGAAGGGCGGATATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAATCCCAGTAAGCAC
GCAATAATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAGAGTGAAATCGAAAGGATTTTTGAACTTGCAAGAACATTGCAG
TTGGTGGTCCTTGACGCGGATACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATATGTAAAGATTTCT
TCTCCTAAGGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTG
GCTCAGTGTCCTCCAGAGCTGTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGACTATCTGGAGGCC
TACTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCC
ACCCTAGCCTCTAATTCACAGGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAAGCTGAAGAAGAA
CCTAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCAGCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTC
TCCAGGCAAGAGACATTTGACTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCCCATGACCACGTG
GACCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCACGGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCC
CGGGACGTGGATCGAGAGCAGGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGTGAAAAGGATGGA

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000377328_chr10_18439812_+_1476nt
ATGGACATTCTGAAATCAGAGATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGT
AGTGAGCTCGCCAAAAAAGAAGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACT
TCATCGAATCCAGTGTTAGAACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAA
AGAGGAGAACCAATCAGACTATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAAC
AAGTCATATGGAAAAGGAGCCAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTT
CGCCAGGGTTCGGCAGACTCCTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCG
GAGCGGCAGGCCCAGGCACAGTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCAT
GAAGATGATGTTCCAGTGCCTGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAGTTTTACAAAGGTTAATAAAA
TCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAGCTGTTCGATGTG
ATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGACTATCTGGAGGCCTACTGGAAGGCCACCCATCCTCCCAGCAGT
AGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCACAGGGTTCTCAA
GGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAAGCTGAAGAAGAACCTAGTGTGGAACCAGTCAAGAAATCCCAG
CACCGCTCTTCCTCCTCAGCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTTGACTCGGAAACC
CAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCCCATGACCACGTGGACCACTATGCCTCACACCGTGACCACAAC
CACAGAGACGAGACCCACGGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAGCAGGACCACAAC
GAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGTGAAAAGGATGGAGAAGTGATATCAAAAAAACGGAATGAGGCT

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000352115_chr10_18439812_+_2154nt
ATGGACATTCTGAAATCAGAGATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGT
AGTGAGCTCGCCAAAAAAGAAGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACT
TCATCGAATCCAGTGTTAGAACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAA
AGAGGAGAACCAATCAGACTATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAAC
AAGTCATATGGAAAAGGAGCCAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTT
CGCCAGGGTTCGGCAGACTCCTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCG
GAGCGGCAGGCCCAGGCACAGTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCAT
GAAGATGATGTTCCAGTGCCTGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAACAATGACTGGTGG
ATAGGGCGATTGGTAAAAGAAGGCTGTGAAATCGGATTCATTCCAAGCCCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGA
GCCAAGCAAGGGAAATTCTACTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCCAGAAAATCAACA
CCTCCATCATCTGGTGCAAAATCTGCAGATGAACAAGACCAGTGGAAAACTGCAGGCTTGTTTTGGCGGTTTACTACAGAGCACACTCCT
CCGTATGATGTGGTACCTTCCATGCGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAGGTCACAGATATGATGCAAAAAGCG
CTGTTTGATTTTTTAAAACACAGATTTGAAGGGCGGATATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTA
AACAATCCCAGTAAGCACGCAATAATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAGAGTGAAATCGAAAGGATTTTTGAA
CTTGCAAGAACATTGCAGTTGGTGGTCCTTGACGCGGATACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATA
GTATATGTAAAGATTTCTTCTCCTAAGGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTCCAGATG
GTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAGCTGTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTT
GCCGACTATCTGGAGGCCTACTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCCACTTCA
AGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCACAGGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCT
TCCCAAGCTGAAGAAGAACCTAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCAGCCCCACACCACAACCATCGCAGT
GGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTTGACTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGAT
TATTCCCATGACCACGTGGACCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCACGGGAGCAGTGACCACAGACACAGG
GAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAGCAGGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGC

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000282343_chr10_18439812_+_2226nt
ATGGACATTCTGAAATCAGAGATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGT
AGTGAGCTCGCCAAAAAAGAAGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACT
TCATCGAATCCAGTGTTAGAACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAA
AGAGGAGAACCAATCAGACTATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAAC
AAGTCATATGGAAAAGGAGCCAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTT
CGCCAGGGTTCGGCAGACTCCTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCG
GAGCGGCAGGCCCAGGCACAGTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCAT
GAAGATGATGTTCCAGTGCCTGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAACAATGACTGGTGG
ATAGGGCGATTGGTAAAAGAAGGCTGTGAAATCGGATTCATTCCAAGCCCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGA
GCCAAGCAAGGGAAATTCTACTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCCAGAAAATCAACA
CCTCCATCATCTGCTATAGACATAGATGCTACTGGCTTAGATGCAGAAGAAAATGATATTCCAGCAAACCACCGCTCCCCTAAACCCAGT
GCAAACAGTGTAACGTCACCCCACTCCAAAGAGAAAAGAATGCCCTTCTTTAAGAAGACAGAGCACACTCCTCCGTATGATGTGGTACCT
TCCATGCGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAGGTCACAGATATGATGCAAAAAGCGCTGTTTGATTTTTTAAAA
CACAGATTTGAAGGGCGGATATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAATCCCAGTAAGCAC
GCAATAATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAGAGTGAAATCGAAAGGATTTTTGAACTTGCAAGAACATTGCAG
TTGGTGGTCCTTGACGCGGATACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATATGTAAAGATTTCT
TCTCCTAAGGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTG
GCTCAGTGTCCTCCAGAGCTGTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGACTATCTGGAGGCC
TACTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCC
ACCCTAGCCTCTAATTCACAGGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAAGCTGAAGAAGAA
CCTAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCAGCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTC
TCCAGGCAAGAGACATTTGACTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCCCATGACCACGTG
GACCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCACGGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCC
CGGGACGTGGATCGAGAGCAGGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGTGAAAAGGATGGA

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000377331_chr10_18439812_+_2154nt
ATGGACATTCTGAAATCAGAGATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGT
AGTGAGCTCGCCAAAAAAGAAGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACT
TCATCGAATCCAGTGTTAGAACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAA
AGAGGAGAACCAATCAGACTATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAAC
AAGTCATATGGAAAAGGAGCCAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTT
CGCCAGGGTTCGGCAGACTCCTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCG
GAGCGGCAGGCCCAGGCACAGTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCAT
GAAGATGATGTTCCAGTGCCTGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAACAATGACTGGTGG
ATAGGGCGATTGGTAAAAGAAGGCTGTGAAATCGGATTCATTCCAAGCCCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGA
GCCAAGCAAGGGAAATTCTACTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCCAGAAAATCAACA
CCTCCATCATCTGGTGCAAAATCTGCAGATGAACAAGACCAGTGGAAAACTGCAGGCTTGTTTTGGCGGTTTACTACAGAGCACACTCCT
CCGTATGATGTGGTACCTTCCATGCGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAGGTCACAGATATGATGCAAAAAGCG
CTGTTTGATTTTTTAAAACACAGATTTGAAGGGCGGATATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTA
AACAATCCCAGTAAGCACGCAATAATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAGAGTGAAATCGAAAGGATTTTTGAA
CTTGCAAGAACATTGCAGTTGGTGGTCCTTGACGCGGATACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATA
GTATATGTAAAGATTTCTTCTCCTAAGGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTCCAGATG
GTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAGCTGTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTT
GCCGACTATCTGGAGGCCTACTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCCACTTCA
AGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCACAGGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCT
TCCCAAGCTGAAGAAGAACCTAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCAGCCCCACACCACAACCATCGCAGT
GGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTTGACTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGAT
TATTCCCATGACCACGTGGACCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCACGGGAGCAGTGACCACAGACACAGG
GAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAGCAGGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000324631_chr10_18439812_+_3789nt
CTCTCTCATCCCAGCTTCCGCCGGAAGCGGCTCCTGTCAGTTGTTCTCAGGTGTTTGGGCTTGTTGTTCCGTATACTCAGTGGGTTCGCG
GCCGCCGGCCCAGTGAGGCTGGGTTCGAGGAGCTGGAGCGGGAAACTGGAGCTTAAATTCTGGCGGCGAGATGGACATTCTGAAATCAGA
GATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGTAGTGAGCTCGCCAAAAAAGA
AGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACTTCATCGAATCCAGTGTTAGA
ACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAAAGAGGAGAACCAATCAGACT
ATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAACAAGTCATATGGAAAAGGAGC
CAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTTCGCCAGGGTTCGGCAGACTC
CTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCGGAGCGGCAGGCCCAGGCACA
GTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCATGAAGATGATGTTCCAGTGCC
TGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAACAATGACTGGTGGATAGGGCGATTGGTAAAAGA
AGGCTGTGAAATCGGATTCATTCCAAGCCCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGAGCCAAGCAAGGGAAATTCTA
CTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCCAGAAAATCAACACCTCCATCATCTGCTATAGA
CATAGATGCTACTGGCTTAGATGCAGAAGAAAATGATATTCCAGCAAACCACCGCTCCCCTAAACCCAGTGCAAACAGTGTAACGTCACC
CCACTCCAAAGAGAAAAGAATGCCCTTCTTTAAGAAGACAGAGCACACTCCTCCGTATGATGTGGTACCTTCCATGCGACCAGTGGTCCT
AGTGGGCCCTTCTCTGAAGGGCTACGAGGTCACAGATATGATGCAAAAAGCGCTGTTTGATTTTTTAAAACACAGATTTGAAGGGCGGAT
ATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAATCCCAGTAAGCACGCAATAATAGAAAGATCCAA
CACAAGGTCAAGCTTAGCGGAAGTTCAGAGTGAAATCGAAAGGATTTTTGAACTTGCAAGAACATTGCAGTTGGTGGTCCTTGACGCGGA
TACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATATGTAAAGATTTCTTCTCCTAAGGTTTTACAAAG
GTTAATAAAATCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAGCT
GTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGACTATCTGGAGGCCTACTGGAAGGCCACCCATCC
TCCCAGCAGTAGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCACA
GGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAAGCTGAAGAAGAACCTAGTGTGGAACCAGTCAA
GAAATCCCAGCACCGCTCTTCCTCCTCAGCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTTGA
CTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCCCATGACCACGTGGACCACTATGCCTCACACCG
TGACCACAACCACAGAGACGAGACCCACGGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAGCA
GGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGTGAAAAGGATGGAGAAGTGATATCAAAAAAACG
GAATGAGGCTGGGGAGTGGAACAGGGATGTTTACATCCGCCAATGAGTTTTGCCCGTTTGTGTTTTTTTTTTTTTTTTTTTGAAGTCTTG
TATAACTAACAGCATCCCCAAAACAAAGTCTTTGGGGTCTACACTGCAATCATATGTGATCTGTCTTGTAATATTTTGTATTATTGCTGT
TGCTTGAATAGCAATAGCATGGATAGAGTATTGAGATACTTTTTCTTTTGTAAGTGCTACATAAATTGGCCTGGTATGGCTGCAGTCCTC
CGGTTGCATACTGGACTCTTCAAAAACTGTTTTGGGTAGCTGCCACTTGAACAAAATCTGTTGCCACCCAGGTGATGTTAGTGTTTTAAG
AAATGTAGTTGATGTATCCAACAAGCCAGAATCAGCACAGATAAAAAGTGGAATTTCTTGTTTCTCCAGATTTTTAATACGTTAATACGC
AGGCATCTGATTTGCATATTCATTCATGGACCACTGTTTCTTGCTTGTACCTCTGGCTGACTAAATTTGGGGACAGATTCAGTCTTGCCT
TACACAAAGGGGATCATAAAGTTAGAATCTATTTTCTATGTACTAGTACTGTGTACTGTATAGACAGTTTGTAAATGTTATTTCTGCAAA
CAAACACCTTCTTATTATATATATAATATATATATATATCAGTTTGATCACACTATTTTAGAGTCTTAATGCCAAGTCAGCAGATTTGCT
TTATGAATTACAGGGACTAGAAATGCCCACATTCAGGAAATTTGTAATAACATTGTCTAGACACCTATCCTCATTCTAGTAGAAAGTGTG
TACATACTGTAAATATGTGTGATTGCTTGACTTGAAAAGGTTTGAATTCTGAATGTTATACCATCCTTGTAAGTAAGTTTGTAATTTCCA
CCATAAATTATGGTAAATATAAAACTCCAGAGGTTGTTCTACTCCATACAGTTCACACTGATTGTGACACATTCTTAGTAGCTAGTGTCT
GTTCTAGTCACTGCACTGGAGTCTACGAGCCGGAACTCGCTATATGCACGTGTGTGTGTCCGTATGTAAGAAAGTGTGCACCGAGTGACT
GAATGGTTGAGATGAATTGGAATGCTGAAGACTAACGAAGAAACTAGAGACTGATATCGAGCATTCTGCCCACCTCGCTCTGTATTTAAT
TAATTGTGCTATATGTTGCTTTAACAACCCATTGAGCAGTCAGGGAATGTGAGTAAGCTTGCTGCCAAAGGTAACTAGGAAAGCATTCAT
CTGCTGCCTCCTTGTTTTTGCTCCTAGAGAGTGAAAATACAGGCAATTTTACTGTGAGTGTTTCACTGGAAATGTACAATCTTTGTGTGT
TAGAGTATTTGTTTTAGTAAGAAATGTTTACACAGCTTGTGGAATTATTTCGTGGGAAAATAAATTTTTATAACTTCTCCCACTTCAATT

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000377328_chr10_18439812_+_1636nt
CTCTCTCATCCCAGCTTCCGCCGGAAGCGGCTCCTGTCAGTTGTTCTCAGGTGTTTGGGCTTGTTGTTCCGTATACTCAGTGGGTTCGCG
GCCGCCGGCCCAGTGAGGCTGGGTTCGAGGAGCTGGAGCGGGAAACTGGAGCTTAAATTCTGGCGGCGAGATGGACATTCTGAAATCAGA
GATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGTAGTGAGCTCGCCAAAAAAGA
AGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACTTCATCGAATCCAGTGTTAGA
ACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAAAGAGGAGAACCAATCAGACT
ATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAACAAGTCATATGGAAAAGGAGC
CAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTTCGCCAGGGTTCGGCAGACTC
CTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCGGAGCGGCAGGCCCAGGCACA
GTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCATGAAGATGATGTTCCAGTGCC
TGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAAGC
TAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAGCTGTTCGATGTGATCTTGGATGAGAACCAGCT
TGAGGATGCCTGTGAGCACCTTGCCGACTATCTGGAGGCCTACTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTCCT
TAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCACAGGGTTCTCAAGGTGATCAGAGGACTGATCG
CTCCGCTCCTATCCGTTCTGCTTCCCAAGCTGAAGAAGAACCTAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCAGC
CCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTTGACTCGGAAACCCAGGAGAGTCGAGACTCTGC
CTACGTAGAGCCAAAGGAAGATTATTCCCATGACCACGTGGACCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCACGG
GAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAGCAGGACCACAACGAGTGCAACAAGCAGCGCAG
CCGTCATAAATCCAAGGATCGCTACTGTGAAAAGGATGGAGAAGTGATATCAAAAAAACGGAATGAGGCTGGGGAGTGGAACAGGGATGT

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000352115_chr10_18439812_+_2314nt
CTCTCTCATCCCAGCTTCCGCCGGAAGCGGCTCCTGTCAGTTGTTCTCAGGTGTTTGGGCTTGTTGTTCCGTATACTCAGTGGGTTCGCG
GCCGCCGGCCCAGTGAGGCTGGGTTCGAGGAGCTGGAGCGGGAAACTGGAGCTTAAATTCTGGCGGCGAGATGGACATTCTGAAATCAGA
GATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGTAGTGAGCTCGCCAAAAAAGA
AGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACTTCATCGAATCCAGTGTTAGA
ACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAAAGAGGAGAACCAATCAGACT
ATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAACAAGTCATATGGAAAAGGAGC
CAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTTCGCCAGGGTTCGGCAGACTC
CTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCGGAGCGGCAGGCCCAGGCACA
GTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCATGAAGATGATGTTCCAGTGCC
TGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAACAATGACTGGTGGATAGGGCGATTGGTAAAAGA
AGGCTGTGAAATCGGATTCATTCCAAGCCCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGAGCCAAGCAAGGGAAATTCTA
CTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCCAGAAAATCAACACCTCCATCATCTGGTGCAAA
ATCTGCAGATGAACAAGACCAGTGGAAAACTGCAGGCTTGTTTTGGCGGTTTACTACAGAGCACACTCCTCCGTATGATGTGGTACCTTC
CATGCGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAGGTCACAGATATGATGCAAAAAGCGCTGTTTGATTTTTTAAAACA
CAGATTTGAAGGGCGGATATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAATCCCAGTAAGCACGC
AATAATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAGAGTGAAATCGAAAGGATTTTTGAACTTGCAAGAACATTGCAGTT
GGTGGTCCTTGACGCGGATACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATATGTAAAGATTTCTTC
TCCTAAGGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTGGC
TCAGTGTCCTCCAGAGCTGTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGACTATCTGGAGGCCTA
CTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCCAC
CCTAGCCTCTAATTCACAGGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAAGCTGAAGAAGAACC
TAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCAGCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTCTC
CAGGCAAGAGACATTTGACTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCCCATGACCACGTGGA
CCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCACGGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCCCG
GGACGTGGATCGAGAGCAGGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGTGAAAAGGATGGAGA

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000282343_chr10_18439812_+_3789nt
CTCTCTCATCCCAGCTTCCGCCGGAAGCGGCTCCTGTCAGTTGTTCTCAGGTGTTTGGGCTTGTTGTTCCGTATACTCAGTGGGTTCGCG
GCCGCCGGCCCAGTGAGGCTGGGTTCGAGGAGCTGGAGCGGGAAACTGGAGCTTAAATTCTGGCGGCGAGATGGACATTCTGAAATCAGA
GATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGTAGTGAGCTCGCCAAAAAAGA
AGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACTTCATCGAATCCAGTGTTAGA
ACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAAAGAGGAGAACCAATCAGACT
ATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAACAAGTCATATGGAAAAGGAGC
CAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTTCGCCAGGGTTCGGCAGACTC
CTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCGGAGCGGCAGGCCCAGGCACA
GTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCATGAAGATGATGTTCCAGTGCC
TGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAACAATGACTGGTGGATAGGGCGATTGGTAAAAGA
AGGCTGTGAAATCGGATTCATTCCAAGCCCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGAGCCAAGCAAGGGAAATTCTA
CTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCCAGAAAATCAACACCTCCATCATCTGCTATAGA
CATAGATGCTACTGGCTTAGATGCAGAAGAAAATGATATTCCAGCAAACCACCGCTCCCCTAAACCCAGTGCAAACAGTGTAACGTCACC
CCACTCCAAAGAGAAAAGAATGCCCTTCTTTAAGAAGACAGAGCACACTCCTCCGTATGATGTGGTACCTTCCATGCGACCAGTGGTCCT
AGTGGGCCCTTCTCTGAAGGGCTACGAGGTCACAGATATGATGCAAAAAGCGCTGTTTGATTTTTTAAAACACAGATTTGAAGGGCGGAT
ATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAATCCCAGTAAGCACGCAATAATAGAAAGATCCAA
CACAAGGTCAAGCTTAGCGGAAGTTCAGAGTGAAATCGAAAGGATTTTTGAACTTGCAAGAACATTGCAGTTGGTGGTCCTTGACGCGGA
TACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATATGTAAAGATTTCTTCTCCTAAGGTTTTACAAAG
GTTAATAAAATCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTGGCTCAGTGTCCTCCAGAGCT
GTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGACTATCTGGAGGCCTACTGGAAGGCCACCCATCC
TCCCAGCAGTAGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCCACCCTAGCCTCTAATTCACA
GGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAAGCTGAAGAAGAACCTAGTGTGGAACCAGTCAA
GAAATCCCAGCACCGCTCTTCCTCCTCAGCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTCTCCAGGCAAGAGACATTTGA
CTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCCCATGACCACGTGGACCACTATGCCTCACACCG
TGACCACAACCACAGAGACGAGACCCACGGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCCCGGGACGTGGATCGAGAGCA
GGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGTGAAAAGGATGGAGAAGTGATATCAAAAAAACG
GAATGAGGCTGGGGAGTGGAACAGGGATGTTTACATCCGCCAATGAGTTTTGCCCGTTTGTGTTTTTTTTTTTTTTTTTTTGAAGTCTTG
TATAACTAACAGCATCCCCAAAACAAAGTCTTTGGGGTCTACACTGCAATCATATGTGATCTGTCTTGTAATATTTTGTATTATTGCTGT
TGCTTGAATAGCAATAGCATGGATAGAGTATTGAGATACTTTTTCTTTTGTAAGTGCTACATAAATTGGCCTGGTATGGCTGCAGTCCTC
CGGTTGCATACTGGACTCTTCAAAAACTGTTTTGGGTAGCTGCCACTTGAACAAAATCTGTTGCCACCCAGGTGATGTTAGTGTTTTAAG
AAATGTAGTTGATGTATCCAACAAGCCAGAATCAGCACAGATAAAAAGTGGAATTTCTTGTTTCTCCAGATTTTTAATACGTTAATACGC
AGGCATCTGATTTGCATATTCATTCATGGACCACTGTTTCTTGCTTGTACCTCTGGCTGACTAAATTTGGGGACAGATTCAGTCTTGCCT
TACACAAAGGGGATCATAAAGTTAGAATCTATTTTCTATGTACTAGTACTGTGTACTGTATAGACAGTTTGTAAATGTTATTTCTGCAAA
CAAACACCTTCTTATTATATATATAATATATATATATATCAGTTTGATCACACTATTTTAGAGTCTTAATGCCAAGTCAGCAGATTTGCT
TTATGAATTACAGGGACTAGAAATGCCCACATTCAGGAAATTTGTAATAACATTGTCTAGACACCTATCCTCATTCTAGTAGAAAGTGTG
TACATACTGTAAATATGTGTGATTGCTTGACTTGAAAAGGTTTGAATTCTGAATGTTATACCATCCTTGTAAGTAAGTTTGTAATTTCCA
CCATAAATTATGGTAAATATAAAACTCCAGAGGTTGTTCTACTCCATACAGTTCACACTGATTGTGACACATTCTTAGTAGCTAGTGTCT
GTTCTAGTCACTGCACTGGAGTCTACGAGCCGGAACTCGCTATATGCACGTGTGTGTGTCCGTATGTAAGAAAGTGTGCACCGAGTGACT
GAATGGTTGAGATGAATTGGAATGCTGAAGACTAACGAAGAAACTAGAGACTGATATCGAGCATTCTGCCCACCTCGCTCTGTATTTAAT
TAATTGTGCTATATGTTGCTTTAACAACCCATTGAGCAGTCAGGGAATGTGAGTAAGCTTGCTGCCAAAGGTAACTAGGAAAGCATTCAT
CTGCTGCCTCCTTGTTTTTGCTCCTAGAGAGTGAAAATACAGGCAATTTTACTGTGAGTGTTTCACTGGAAATGTACAATCTTTGTGTGT
TAGAGTATTTGTTTTAGTAAGAAATGTTTACACAGCTTGTGGAATTATTTCGTGGGAAAATAAATTTTTATAACTTCTCCCACTTCAATT

>In-frame_PRPF18_ENST00000378572_chr10_13647744_+_CACNB2_ENST00000377331_chr10_18439812_+_2314nt
CTCTCTCATCCCAGCTTCCGCCGGAAGCGGCTCCTGTCAGTTGTTCTCAGGTGTTTGGGCTTGTTGTTCCGTATACTCAGTGGGTTCGCG
GCCGCCGGCCCAGTGAGGCTGGGTTCGAGGAGCTGGAGCGGGAAACTGGAGCTTAAATTCTGGCGGCGAGATGGACATTCTGAAATCAGA
GATCCTTCGGAAGCGGCAGCTGGTGGAGGACAGGAACCTGCTGGTGGAAAATAAAAAATATTTCAAGCGTAGTGAGCTCGCCAAAAAAGA
AGAGGAAGCATATTTTGAAAGATGTGGCTACAAGATACAGCCAAAAGAGGAGGACCAGAAACCATTAACTTCATCGAATCCAGTGTTAGA
ACTTGAACTGGCAGAGGAAAAATTACCTATGACGCTTTCTAGGCAAGAGGTCATCAGAAGATTGAGAGAAAGAGGAGAACCAATCAGACT
ATTTGGAGAGACTGATTATGATGCTTTTCAACGTTTAAGGAAAATAGAGATCCTCACACCAGAAGTTAACAAGTCATATGGAAAAGGAGC
CAGAAGGAAAAACAGATTTAAAGGATCTGATGGAAGCACGTCATCTGATACTACCTCAAATAGTTTTGTTCGCCAGGGTTCGGCAGACTC
CTACACTAGCCGTCCATCCGATTCCGATGTATCTCTGGAGGAGGACCGGGAGGCAGTGCGCAGAGAAGCGGAGCGGCAGGCCCAGGCACA
GTTGGAAAAAGCAAAGACAAAGCCCGTTGCATTTGCGGTTCGGACAAATGTCAGCTACAGTGCGGCCCATGAAGATGATGTTCCAGTGCC
TGGCATGGCCATCTCATTCGAAGCAAAAGATTTTCTGCATGTTAAGGAAAAATTTAACAATGACTGGTGGATAGGGCGATTGGTAAAAGA
AGGCTGTGAAATCGGATTCATTCCAAGCCCAGTCAAACTAGAAAACATGAGGCTGCAGCATGAACAGAGAGCCAAGCAAGGGAAATTCTA
CTCCAGTAAATCAGGAGGAAATTCATCATCCAGTTTGGGTGACATAGTACCTAGTTCCAGAAAATCAACACCTCCATCATCTGGTGCAAA
ATCTGCAGATGAACAAGACCAGTGGAAAACTGCAGGCTTGTTTTGGCGGTTTACTACAGAGCACACTCCTCCGTATGATGTGGTACCTTC
CATGCGACCAGTGGTCCTAGTGGGCCCTTCTCTGAAGGGCTACGAGGTCACAGATATGATGCAAAAAGCGCTGTTTGATTTTTTAAAACA
CAGATTTGAAGGGCGGATATCCATCACAAGGGTCACCGCTGACATCTCGCTTGCCAAACGCTCGGTATTAAACAATCCCAGTAAGCACGC
AATAATAGAAAGATCCAACACAAGGTCAAGCTTAGCGGAAGTTCAGAGTGAAATCGAAAGGATTTTTGAACTTGCAAGAACATTGCAGTT
GGTGGTCCTTGACGCGGATACAATTAATCATCCAGCTCAACTCAGTAAAACCTCCTTGGCCCCTATTATAGTATATGTAAAGATTTCTTC
TCCTAAGGTTTTACAAAGGTTAATAAAATCTCGAGGGAAATCTCAAGCTAAACACCTCAACGTCCAGATGGTAGCAGCTGATAAACTGGC
TCAGTGTCCTCCAGAGCTGTTCGATGTGATCTTGGATGAGAACCAGCTTGAGGATGCCTGTGAGCACCTTGCCGACTATCTGGAGGCCTA
CTGGAAGGCCACCCATCCTCCCAGCAGTAGCCTCCCCAACCCTCTCCTTAGCCGTACATTAGCCACTTCAAGTCTGCCTCTTAGCCCCAC
CCTAGCCTCTAATTCACAGGGTTCTCAAGGTGATCAGAGGACTGATCGCTCCGCTCCTATCCGTTCTGCTTCCCAAGCTGAAGAAGAACC
TAGTGTGGAACCAGTCAAGAAATCCCAGCACCGCTCTTCCTCCTCAGCCCCACACCACAACCATCGCAGTGGGACAAGTCGCGGCCTCTC
CAGGCAAGAGACATTTGACTCGGAAACCCAGGAGAGTCGAGACTCTGCCTACGTAGAGCCAAAGGAAGATTATTCCCATGACCACGTGGA
CCACTATGCCTCACACCGTGACCACAACCACAGAGACGAGACCCACGGGAGCAGTGACCACAGACACAGGGAGTCCCGGCACCGTTCCCG
GGACGTGGATCGAGAGCAGGACCACAACGAGTGCAACAAGCAGCGCAGCCGTCATAAATCCAAGGATCGCTACTGTGAAAAGGATGGAGA


Top

FusionGenePPI for PRPF18_CACNB2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PRPF18LSM4, GTF2B, YWHAZ, RHOUCACNB2CACNB1, CACNB3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PRPF18_CACNB2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneCACNB2Q08289DB00381AmlodipineVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved
TgeneCACNB2Q08289DB00401NisoldipineVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved
TgeneCACNB2Q08289DB00661VerapamilVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved
TgeneCACNB2Q08289DB01115NifedipineVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved
TgeneCACNB2Q08289DB04855DronedaroneVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved
TgeneCACNB2Q08289DB00270IsradipineVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved|investigational
TgeneCACNB2Q08289DB00393NimodipineVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved|investigational
TgeneCACNB2Q08289DB00622NicardipineVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved|investigational
TgeneCACNB2Q08289DB01023FelodipineVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved|investigational
TgeneCACNB2Q08289DB01054NitrendipineVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved|investigational
TgeneCACNB2Q08289DB06712NilvadipineVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved|investigational
TgeneCACNB2Q08289DB00653Magnesium sulfateVoltage-dependent L-type calcium channel subunit beta-2small moleculeapproved|investigational|vet_approved

Top

RelatedDiseases for PRPF18_CACNB2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCACNB2C0005586Bipolar Disorder1PSYGENET
TgeneCACNB2C0036341Schizophrenia1PSYGENET
TgeneCACNB2C2678477Brugada Syndrome 41CTD_human;UNIPROT