FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28447

FusionGeneSummary for PPP2R4_PAX5

check button Fusion gene summary
Fusion gene informationFusion gene name: PPP2R4_PAX5
Fusion gene ID: 28447
HgeneTgene
Gene symbol

PPP2R4

PAX5

Gene ID

5524

5079

Gene nameprotein phosphatase 2 phosphatase activatorpaired box 5
SynonymsPP2A|PPP2R4|PR53ALL3|BSAP
Cytomap

9q34.11

9p13.2

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein phosphatase 2A activatorPP2A phosphatase activatorPP2A subunit B' isoform PR53phosphotyrosyl phosphatase activatorprotein phosphatase 2 regulatory subunit 4protein phosphatase 2A activator, regulatory subunit 4protein phosphpaired box protein Pax-5B-cell lineage specific activatorpaired box homeotic gene 5paired domain gene 5transcription factor PAX 5
Modification date2018052320180520
UniProtAcc

Q02548

Ensembl transtripts involved in fusion geneENST00000358994, ENST00000393370, 
ENST00000337738, ENST00000348141, 
ENST00000452489, ENST00000357197, 
ENST00000347048, ENST00000355007, 
ENST00000423100, ENST00000524946, 
ENST00000436883, ENST00000414510, 
ENST00000432124, ENST00000435305, 
ENST00000419582, ENST00000432651, 
ENST00000435132, ENST00000434095, 
ENST00000358127, ENST00000523241, 
ENST00000520154, ENST00000377852, 
ENST00000377853, ENST00000522003, 
ENST00000520281, ENST00000414447, 
ENST00000523145, ENST00000446742, 
ENST00000377847, 
Fusion gene scores* DoF score5 X 4 X 5=1007 X 5 X 5=175
# samples 57
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/175*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PPP2R4 [Title/Abstract] AND PAX5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePPP2R4

GO:0032515

negative regulation of phosphoprotein phosphatase activity

16916641

HgenePPP2R4

GO:0032516

positive regulation of phosphoprotein phosphatase activity

16916641

HgenePPP2R4

GO:0035307

positive regulation of protein dephosphorylation

16916641

HgenePPP2R4

GO:0035308

negative regulation of protein dephosphorylation

16916641

HgenePPP2R4

GO:0043065

positive regulation of apoptotic process

17333320

HgenePPP2R4

GO:0043666

regulation of phosphoprotein phosphatase activity

16916641


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-IE-A3OV-01APPP2R4chr9

131911224

+PAX5chr9

37034103

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000358994ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000358994ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
In-frameENST00000393370ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000393370ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
Frame-shitENST00000337738ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000337738ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
In-frameENST00000348141ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000348141ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000452489ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000452489ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
Frame-shitENST00000357197ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000357197ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
In-frameENST00000347048ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000347048ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
In-frameENST00000355007ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
5CDS-intronENST00000355007ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000423100ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000423100ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000524946ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000524946ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000436883ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000436883ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000414510ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000414510ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000432124ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432124ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000435305ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435305ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000419582ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000419582ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000432651ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000432651ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000435132ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000435132ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-3CDSENST00000434095ENST00000358127PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000523241PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000520154PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000377852PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000377853PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000522003PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000520281PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000414447PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000523145PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000446742PPP2R4chr9

131911224

+PAX5chr9

37034103

-
intron-intronENST00000434095ENST00000377847PPP2R4chr9

131911224

+PAX5chr9

37034103

-

Top

FusionProtFeatures for PPP2R4_PAX5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPP2R4

PAX5

Q02548

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PPP2R4_PAX5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPP2R4_ENST00000393370_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_818aa
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDE
TPPVDQPSRFGNKAYRTWTAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAI
VFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAE
HSNQLWNISAVPSWSKVNQGLIRMTKAECLEKFPVIQHFKFGSLLPIHPVTSG_EGPSRRATQATVPVPAFPTPAVAPPHPLPLFVPFDE
RLFTGVGWRDGLEGAQSIRLQGPSWEK_PKCSQFSEFPCARLARREGLGPGHSATLSCFWPLLPSLPSSLVLRAGAVLQHRREGRRDTCC
FHCFSLPGVDAFLRVGAAPCRGGSVSQAMPGWPSMVGLEAEAGRQLWAGVGWVGSGGGEALAVLAGAPPRLLFTLPPGPEAPCVQASPWL
FSSLALGSAGFPDCSHISPAP_G_PSQWKLPFG_VLGSWEGPDDGVRHVFPELSLAGRGWQKLREGLGAHCIWRAWIPLGSLRPGHFCYL
CAAVSLTLGPWALLLCSPG_WVGPEGGSPTPCPPTSLNCPLLL_GEVRDSLPSPGFGTQNGPSGGWAGPLRATAEVSPRAVPGPGSYRLV
PQACPSPLPPPVSGSTHPSGRGSTEKHSTGAQPGIR_WSGQRLGQESQRSVTVSQKRPSVHLSPRARQPFLAPPSPTGLPAPCTLIAVQI

>In-frame_PPP2R4_ENST00000348141_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_824aa
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQVPFGTVAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTL
DRWIDETPPVDQPSRFGNKAYRTWTAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRV
DDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMK
TGPFAEHSNQLWNISAVPSWSKVNQGLIRMTKAECLEKFPVIQHFKFGSLLPIHPVTSG_EGPSRRATQATVPVPAFPTPAVAPPHPLPL
FVPFDERLFTGVGWRDGLEGAQSIRLQGPSWEK_PKCSQFSEFPCARLARREGLGPGHSATLSCFWPLLPSLPSSLVLRAGAVLQHRREG
RRDTCCFHCFSLPGVDAFLRVGAAPCRGGSVSQAMPGWPSMVGLEAEAGRQLWAGVGWVGSGGGEALAVLAGAPPRLLFTLPPGPEAPCV
QASPWLFSSLALGSAGFPDCSHISPAP_G_PSQWKLPFG_VLGSWEGPDDGVRHVFPELSLAGRGWQKLREGLGAHCIWRAWIPLGSLRP
GHFCYLCAAVSLTLGPWALLLCSPG_WVGPEGGSPTPCPPTSLNCPLLL_GEVRDSLPSPGFGTQNGPSGGWAGPLRATAEVSPRAVPGP
GSYRLVPQACPSPLPPPVSGSTHPSGRGSTEKHSTGAQPGIR_WSGQRLGQESQRSVTVSQKRPSVHLSPRARQPFLAPPSPTGLPAPCT

>In-frame_PPP2R4_ENST00000347048_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_599aa
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMTKAECLEKFPVIQHF
KFGSLLPIHPVTSG_EGPSRRATQATVPVPAFPTPAVAPPHPLPLFVPFDERLFTGVGWRDGLEGAQSIRLQGPSWEK_PKCSQFSEFPC
ARLARREGLGPGHSATLSCFWPLLPSLPSSLVLRAGAVLQHRREGRRDTCCFHCFSLPGVDAFLRVGAAPCRGGSVSQAMPGWPSMVGLE
AEAGRQLWAGVGWVGSGGGEALAVLAGAPPRLLFTLPPGPEAPCVQASPWLFSSLALGSAGFPDCSHISPAP_G_PSQWKLPFG_VLGSW
EGPDDGVRHVFPELSLAGRGWQKLREGLGAHCIWRAWIPLGSLRPGHFCYLCAAVSLTLGPWALLLCSPG_WVGPEGGSPTPCPPTSLNC
PLLL_GEVRDSLPSPGFGTQNGPSGGWAGPLRATAEVSPRAVPGPGSYRLVPQACPSPLPPPVSGSTHPSGRGSTEKHSTGAQPGIR_WS

>In-frame_PPP2R4_ENST00000355007_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_776aa
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEEAENLVATVVPTHLAAAV
PEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIW
GSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMTKAECLEKFPVIQHFKFG
SLLPIHPVTSG_EGPSRRATQATVPVPAFPTPAVAPPHPLPLFVPFDERLFTGVGWRDGLEGAQSIRLQGPSWEK_PKCSQFSEFPCARL
ARREGLGPGHSATLSCFWPLLPSLPSSLVLRAGAVLQHRREGRRDTCCFHCFSLPGVDAFLRVGAAPCRGGSVSQAMPGWPSMVGLEAEA
GRQLWAGVGWVGSGGGEALAVLAGAPPRLLFTLPPGPEAPCVQASPWLFSSLALGSAGFPDCSHISPAP_G_PSQWKLPFG_VLGSWEGP
DDGVRHVFPELSLAGRGWQKLREGLGAHCIWRAWIPLGSLRPGHFCYLCAAVSLTLGPWALLLCSPG_WVGPEGGSPTPCPPTSLNCPLL
L_GEVRDSLPSPGFGTQNGPSGGWAGPLRATAEVSPRAVPGPGSYRLVPQACPSPLPPPVSGSTHPSGRGSTEKHSTGAQPGIR_WSGQR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPP2R4_ENST00000393370_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_2454nt
ATGGCTGAGGGCGAGCGGCAGCCGCCGCCAGATTCTTCAGAGGAGGCCCCTCCAGCCACTCAGAACTTCATCATTCCAAAAAAGGAGATC
CACACAGTTCCAGACATGGGCAAATGGAAGCGTTCTCAGGCATACGCTGACTACATCGGATTCATCCTTACCCTCAACGAAGGTGTGAAG
GGGAAGAAGCTGACCTTCGAGTACAGAGTCTCCGAGGCCATTGAGAAACTAGTCGCTCTTCTCAACACGCTGGACAGGTGGATTGATGAG
ACTCCTCCAGTGGACCAGCCCTCTCGGTTTGGGAATAAGGCATACAGGACCTGGTATGCCAAACTTGATGAGGAAGCAGAAAACTTGGTG
GCCACAGTGGTCCCTACCCATCTGGCAGCTGCTGTGCCTGAGGTGGCTGTTTACCTAAAGGAGTCAGTGGGGAACTCCACGCGCATTGAC
TACGGCACAGGGCATGAGGCAGCCTTCGCTGCTTTCCTCTGCTGTCTCTGCAAGATTGGGGTGCTCCGGGTGGATGACCAAATAGCTATT
GTCTTCAAGGTGTTCAATCGGTACCTTGAGGTTATGCGGAAACTCCAGAAAACATACAGGATGGAGCCAGCCGGCAGCCAGGGAGTGTGG
GGTCTGGATGACTTCCAGTTTCTGCCCTTCATCTGGGGCAGTTCGCAGCTGATAGACCACCCATACCTGGAGCCCAGACACTTTGTGGAT
GAGAAGGCCGTGAATGAGAACCACAAGGACTACATGTTCCTGGAGTGTATCCTGTTTATTACCGAGATGAAGACTGGCCCATTTGCAGAG
CACTCCAACCAGCTGTGGAACATCAGCGCCGTCCCTTCCTGGTCCAAAGTGAACCAGGGTCTCATCCGCATGTATAAGGCCGAGTGCCTG
GAGAAGTTCCCTGTGATCCAGCACTTCAAGTTCGGGAGCCTGCTGCCCATCCATCCTGTCACGTCGGGCTAGGAGGGGCCAAGCCGAAGA
GCCACCCAGGCCACAGTTCCTGTGCCTGCCTTCCCCACCCCAGCAGTGGCCCCTCCCCATCCCCTCCCTCTGTTCGTCCCGTTTGATGAG
AGGCTGTTTACTGGGGTGGGGTGGCGAGATGGGCTTGAGGGGGCTCAGAGCATAAGGCTTCAGGGCCCAAGTTGGGAGAAGTGACCAAAG
TGTAGCCAGTTTTCTGAGTTCCCGTGTGCTAGACTGGCCAGAAGAGAGGGTCTGGGGCCTGGTCACTCGGCCACTCTCTCCTGTTTCTGG
CCTCTTCTCCCTTCACTCCCGTCCAGTCTGGTTTTGAGAGCAGGGGCTGTTCTGCAGCACCGCAGGGAAGGGAGGAGAGATACCTGCTGC
TTCCATTGCTTTTCCCTTCCTGGAGTCGATGCCTTTCTAAGGGTTGGAGCTGCTCCTTGCAGGGGCGGGTCAGTTTCCCAGGCCATGCCG
GGGTGGCCATCTATGGTAGGGCTGGAAGCTGAGGCTGGCCGCCAGCTGTGGGCTGGGGTGGGGTGGGTGGGGTCGGGTGGTGGAGAGGCC
TTAGCTGTCCTGGCTGGTGCCCCTCCCAGGCTCCTTTTCACCCTGCCCCCTGGGCCTGAGGCCCCCTGTGTCCAAGCCTCCCCCTGGCTC
TTCAGTTCTCTAGCCCTTGGCTCTGCTGGGTTTCCTGACTGTAGCCACATCTCTCCCGCTCCCTAAGGGTAACCTAGCCAATGGAAGCTG
CCCTTTGGGTAGGTGCTGGGCTCCTGGGAGGGCCCAGATGATGGGGTGAGGCATGTCTTTCCAGAACTTTCCCTGGCAGGGAGGGGATGG
CAGAAACTCAGGGAGGGGCTTGGGGCCCATTGTATCTGGAGAGCCTGGATTCCTCTTGGCAGTCTTAGGCCCGGCCACTTCTGCTACCTT
TGCGCTGCTGTGAGCCTCACCCTGGGCCCCTGGGCCCTGCTTCTCTGCTCCCCTGGGTGATGGGTGGGCCCAGAAGGTGGCAGTCCCACA
CCTTGTCCTCCCACCTCCCTGAACTGTCCATTGCTTTTATAGGGTGAGGTAAGAGACAGCCTCCCAAGCCCAGGCTTTGGCACTCAGAAT
GGGCCCAGTGGGGGCTGGGCAGGCCCATTGAGGGCCACCGCCGAGGTTTCTCCTAGGGCTGTTCCTGGGCCTGGCTCTTACAGGCTCGTC
CCCCAGGCCTGCCCTTCTCCACTGCCCCCTCCTGTGTCTGGGTCCACACACCCTTCAGGAAGGGGGAGCACTGAGAAGCACAGCACAGGG
GCTCAGCCTGGGATCCGGTGATGGTCTGGGCAGAGGCTGGGTCAGGAGTCCCAAAGGTCAGTGACAGTTTCTCAGAAGAGGCCCAGCGTC
CACCTCTCTCCCAGGGCCAGACAGCCCTTCCTGGCTCCCCCATCCCCCTATGGGCTCCCAGCCCCTTGCACCCTCATTGCTGTTCAGATT

>In-frame_PPP2R4_ENST00000348141_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_2472nt
ATGGCTGAGGGCGAGCGGCAGCCGCCGCCAGATTCTTCAGAGGAGGCCCCTCCAGCCACTCAGAACTTCATCATTCCAAAAAAGGAGATC
CACACAGTTCCAGACATGGGCAAATGGAAGCGTTCTCAGGTACCATTTGGAACTGTGGCATACGCTGACTACATCGGATTCATCCTTACC
CTCAACGAAGGTGTGAAGGGGAAGAAGCTGACCTTCGAGTACAGAGTCTCCGAGGCCATTGAGAAACTAGTCGCTCTTCTCAACACGCTG
GACAGGTGGATTGATGAGACTCCTCCAGTGGACCAGCCCTCTCGGTTTGGGAATAAGGCATACAGGACCTGGTATGCCAAACTTGATGAG
GAAGCAGAAAACTTGGTGGCCACAGTGGTCCCTACCCATCTGGCAGCTGCTGTGCCTGAGGTGGCTGTTTACCTAAAGGAGTCAGTGGGG
AACTCCACGCGCATTGACTACGGCACAGGGCATGAGGCAGCCTTCGCTGCTTTCCTCTGCTGTCTCTGCAAGATTGGGGTGCTCCGGGTG
GATGACCAAATAGCTATTGTCTTCAAGGTGTTCAATCGGTACCTTGAGGTTATGCGGAAACTCCAGAAAACATACAGGATGGAGCCAGCC
GGCAGCCAGGGAGTGTGGGGTCTGGATGACTTCCAGTTTCTGCCCTTCATCTGGGGCAGTTCGCAGCTGATAGACCACCCATACCTGGAG
CCCAGACACTTTGTGGATGAGAAGGCCGTGAATGAGAACCACAAGGACTACATGTTCCTGGAGTGTATCCTGTTTATTACCGAGATGAAG
ACTGGCCCATTTGCAGAGCACTCCAACCAGCTGTGGAACATCAGCGCCGTCCCTTCCTGGTCCAAAGTGAACCAGGGTCTCATCCGCATG
TATAAGGCCGAGTGCCTGGAGAAGTTCCCTGTGATCCAGCACTTCAAGTTCGGGAGCCTGCTGCCCATCCATCCTGTCACGTCGGGCTAG
GAGGGGCCAAGCCGAAGAGCCACCCAGGCCACAGTTCCTGTGCCTGCCTTCCCCACCCCAGCAGTGGCCCCTCCCCATCCCCTCCCTCTG
TTCGTCCCGTTTGATGAGAGGCTGTTTACTGGGGTGGGGTGGCGAGATGGGCTTGAGGGGGCTCAGAGCATAAGGCTTCAGGGCCCAAGT
TGGGAGAAGTGACCAAAGTGTAGCCAGTTTTCTGAGTTCCCGTGTGCTAGACTGGCCAGAAGAGAGGGTCTGGGGCCTGGTCACTCGGCC
ACTCTCTCCTGTTTCTGGCCTCTTCTCCCTTCACTCCCGTCCAGTCTGGTTTTGAGAGCAGGGGCTGTTCTGCAGCACCGCAGGGAAGGG
AGGAGAGATACCTGCTGCTTCCATTGCTTTTCCCTTCCTGGAGTCGATGCCTTTCTAAGGGTTGGAGCTGCTCCTTGCAGGGGCGGGTCA
GTTTCCCAGGCCATGCCGGGGTGGCCATCTATGGTAGGGCTGGAAGCTGAGGCTGGCCGCCAGCTGTGGGCTGGGGTGGGGTGGGTGGGG
TCGGGTGGTGGAGAGGCCTTAGCTGTCCTGGCTGGTGCCCCTCCCAGGCTCCTTTTCACCCTGCCCCCTGGGCCTGAGGCCCCCTGTGTC
CAAGCCTCCCCCTGGCTCTTCAGTTCTCTAGCCCTTGGCTCTGCTGGGTTTCCTGACTGTAGCCACATCTCTCCCGCTCCCTAAGGGTAA
CCTAGCCAATGGAAGCTGCCCTTTGGGTAGGTGCTGGGCTCCTGGGAGGGCCCAGATGATGGGGTGAGGCATGTCTTTCCAGAACTTTCC
CTGGCAGGGAGGGGATGGCAGAAACTCAGGGAGGGGCTTGGGGCCCATTGTATCTGGAGAGCCTGGATTCCTCTTGGCAGTCTTAGGCCC
GGCCACTTCTGCTACCTTTGCGCTGCTGTGAGCCTCACCCTGGGCCCCTGGGCCCTGCTTCTCTGCTCCCCTGGGTGATGGGTGGGCCCA
GAAGGTGGCAGTCCCACACCTTGTCCTCCCACCTCCCTGAACTGTCCATTGCTTTTATAGGGTGAGGTAAGAGACAGCCTCCCAAGCCCA
GGCTTTGGCACTCAGAATGGGCCCAGTGGGGGCTGGGCAGGCCCATTGAGGGCCACCGCCGAGGTTTCTCCTAGGGCTGTTCCTGGGCCT
GGCTCTTACAGGCTCGTCCCCCAGGCCTGCCCTTCTCCACTGCCCCCTCCTGTGTCTGGGTCCACACACCCTTCAGGAAGGGGGAGCACT
GAGAAGCACAGCACAGGGGCTCAGCCTGGGATCCGGTGATGGTCTGGGCAGAGGCTGGGTCAGGAGTCCCAAAGGTCAGTGACAGTTTCT
CAGAAGAGGCCCAGCGTCCACCTCTCTCCCAGGGCCAGACAGCCCTTCCTGGCTCCCCCATCCCCCTATGGGCTCCCAGCCCCTTGCACC

>In-frame_PPP2R4_ENST00000347048_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_1797nt
ATGGCTGAGGGCGAGCGGCAGCCGCCGCCAGATTCTTCAGAGGAGGCCCCTCCAGCCACTCAGAACTTCATCATTCCAAAAAAGGAGATC
CACACAGTTCCAGACATGGGCAAATGGAAGCGTTCTCAGATGAAGACTGGCCCATTTGCAGAGCACTCCAACCAGCTGTGGAACATCAGC
GCCGTCCCTTCCTGGTCCAAAGTGAACCAGGGTCTCATCCGCATGTATAAGGCCGAGTGCCTGGAGAAGTTCCCTGTGATCCAGCACTTC
AAGTTCGGGAGCCTGCTGCCCATCCATCCTGTCACGTCGGGCTAGGAGGGGCCAAGCCGAAGAGCCACCCAGGCCACAGTTCCTGTGCCT
GCCTTCCCCACCCCAGCAGTGGCCCCTCCCCATCCCCTCCCTCTGTTCGTCCCGTTTGATGAGAGGCTGTTTACTGGGGTGGGGTGGCGA
GATGGGCTTGAGGGGGCTCAGAGCATAAGGCTTCAGGGCCCAAGTTGGGAGAAGTGACCAAAGTGTAGCCAGTTTTCTGAGTTCCCGTGT
GCTAGACTGGCCAGAAGAGAGGGTCTGGGGCCTGGTCACTCGGCCACTCTCTCCTGTTTCTGGCCTCTTCTCCCTTCACTCCCGTCCAGT
CTGGTTTTGAGAGCAGGGGCTGTTCTGCAGCACCGCAGGGAAGGGAGGAGAGATACCTGCTGCTTCCATTGCTTTTCCCTTCCTGGAGTC
GATGCCTTTCTAAGGGTTGGAGCTGCTCCTTGCAGGGGCGGGTCAGTTTCCCAGGCCATGCCGGGGTGGCCATCTATGGTAGGGCTGGAA
GCTGAGGCTGGCCGCCAGCTGTGGGCTGGGGTGGGGTGGGTGGGGTCGGGTGGTGGAGAGGCCTTAGCTGTCCTGGCTGGTGCCCCTCCC
AGGCTCCTTTTCACCCTGCCCCCTGGGCCTGAGGCCCCCTGTGTCCAAGCCTCCCCCTGGCTCTTCAGTTCTCTAGCCCTTGGCTCTGCT
GGGTTTCCTGACTGTAGCCACATCTCTCCCGCTCCCTAAGGGTAACCTAGCCAATGGAAGCTGCCCTTTGGGTAGGTGCTGGGCTCCTGG
GAGGGCCCAGATGATGGGGTGAGGCATGTCTTTCCAGAACTTTCCCTGGCAGGGAGGGGATGGCAGAAACTCAGGGAGGGGCTTGGGGCC
CATTGTATCTGGAGAGCCTGGATTCCTCTTGGCAGTCTTAGGCCCGGCCACTTCTGCTACCTTTGCGCTGCTGTGAGCCTCACCCTGGGC
CCCTGGGCCCTGCTTCTCTGCTCCCCTGGGTGATGGGTGGGCCCAGAAGGTGGCAGTCCCACACCTTGTCCTCCCACCTCCCTGAACTGT
CCATTGCTTTTATAGGGTGAGGTAAGAGACAGCCTCCCAAGCCCAGGCTTTGGCACTCAGAATGGGCCCAGTGGGGGCTGGGCAGGCCCA
TTGAGGGCCACCGCCGAGGTTTCTCCTAGGGCTGTTCCTGGGCCTGGCTCTTACAGGCTCGTCCCCCAGGCCTGCCCTTCTCCACTGCCC
CCTCCTGTGTCTGGGTCCACACACCCTTCAGGAAGGGGGAGCACTGAGAAGCACAGCACAGGGGCTCAGCCTGGGATCCGGTGATGGTCT
GGGCAGAGGCTGGGTCAGGAGTCCCAAAGGTCAGTGACAGTTTCTCAGAAGAGGCCCAGCGTCCACCTCTCTCCCAGGGCCAGACAGCCC

>In-frame_PPP2R4_ENST00000355007_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_2328nt
ATGGCTGAGGGCGAGCGGCAGCCGCCGCCAGATTCTTCAGAGGAGGCCCCTCCAGCCACTCAGAACTTCATCATTCCAAAAAAGGAGATC
CACACAGTTCCAGACATGGGCAAATGGAAGCGTTCTCAGGCATACGCTGACTACATCGGATTCATCCTTACCCTCAACGAAGGTGTGAAG
GGGAAGAAGCTGACCTTCGAGTACAGAGTCTCCGAGGAAGCAGAAAACTTGGTGGCCACAGTGGTCCCTACCCATCTGGCAGCTGCTGTG
CCTGAGGTGGCTGTTTACCTAAAGGAGTCAGTGGGGAACTCCACGCGCATTGACTACGGCACAGGGCATGAGGCAGCCTTCGCTGCTTTC
CTCTGCTGTCTCTGCAAGATTGGGGTGCTCCGGGTGGATGACCAAATAGCTATTGTCTTCAAGGTGTTCAATCGGTACCTTGAGGTTATG
CGGAAACTCCAGAAAACATACAGGATGGAGCCAGCCGGCAGCCAGGGAGTGTGGGGTCTGGATGACTTCCAGTTTCTGCCCTTCATCTGG
GGCAGTTCGCAGCTGATAGACCACCCATACCTGGAGCCCAGACACTTTGTGGATGAGAAGGCCGTGAATGAGAACCACAAGGACTACATG
TTCCTGGAGTGTATCCTGTTTATTACCGAGATGAAGACTGGCCCATTTGCAGAGCACTCCAACCAGCTGTGGAACATCAGCGCCGTCCCT
TCCTGGTCCAAAGTGAACCAGGGTCTCATCCGCATGTATAAGGCCGAGTGCCTGGAGAAGTTCCCTGTGATCCAGCACTTCAAGTTCGGG
AGCCTGCTGCCCATCCATCCTGTCACGTCGGGCTAGGAGGGGCCAAGCCGAAGAGCCACCCAGGCCACAGTTCCTGTGCCTGCCTTCCCC
ACCCCAGCAGTGGCCCCTCCCCATCCCCTCCCTCTGTTCGTCCCGTTTGATGAGAGGCTGTTTACTGGGGTGGGGTGGCGAGATGGGCTT
GAGGGGGCTCAGAGCATAAGGCTTCAGGGCCCAAGTTGGGAGAAGTGACCAAAGTGTAGCCAGTTTTCTGAGTTCCCGTGTGCTAGACTG
GCCAGAAGAGAGGGTCTGGGGCCTGGTCACTCGGCCACTCTCTCCTGTTTCTGGCCTCTTCTCCCTTCACTCCCGTCCAGTCTGGTTTTG
AGAGCAGGGGCTGTTCTGCAGCACCGCAGGGAAGGGAGGAGAGATACCTGCTGCTTCCATTGCTTTTCCCTTCCTGGAGTCGATGCCTTT
CTAAGGGTTGGAGCTGCTCCTTGCAGGGGCGGGTCAGTTTCCCAGGCCATGCCGGGGTGGCCATCTATGGTAGGGCTGGAAGCTGAGGCT
GGCCGCCAGCTGTGGGCTGGGGTGGGGTGGGTGGGGTCGGGTGGTGGAGAGGCCTTAGCTGTCCTGGCTGGTGCCCCTCCCAGGCTCCTT
TTCACCCTGCCCCCTGGGCCTGAGGCCCCCTGTGTCCAAGCCTCCCCCTGGCTCTTCAGTTCTCTAGCCCTTGGCTCTGCTGGGTTTCCT
GACTGTAGCCACATCTCTCCCGCTCCCTAAGGGTAACCTAGCCAATGGAAGCTGCCCTTTGGGTAGGTGCTGGGCTCCTGGGAGGGCCCA
GATGATGGGGTGAGGCATGTCTTTCCAGAACTTTCCCTGGCAGGGAGGGGATGGCAGAAACTCAGGGAGGGGCTTGGGGCCCATTGTATC
TGGAGAGCCTGGATTCCTCTTGGCAGTCTTAGGCCCGGCCACTTCTGCTACCTTTGCGCTGCTGTGAGCCTCACCCTGGGCCCCTGGGCC
CTGCTTCTCTGCTCCCCTGGGTGATGGGTGGGCCCAGAAGGTGGCAGTCCCACACCTTGTCCTCCCACCTCCCTGAACTGTCCATTGCTT
TTATAGGGTGAGGTAAGAGACAGCCTCCCAAGCCCAGGCTTTGGCACTCAGAATGGGCCCAGTGGGGGCTGGGCAGGCCCATTGAGGGCC
ACCGCCGAGGTTTCTCCTAGGGCTGTTCCTGGGCCTGGCTCTTACAGGCTCGTCCCCCAGGCCTGCCCTTCTCCACTGCCCCCTCCTGTG
TCTGGGTCCACACACCCTTCAGGAAGGGGGAGCACTGAGAAGCACAGCACAGGGGCTCAGCCTGGGATCCGGTGATGGTCTGGGCAGAGG
CTGGGTCAGGAGTCCCAAAGGTCAGTGACAGTTTCTCAGAAGAGGCCCAGCGTCCACCTCTCTCCCAGGGCCAGACAGCCCTTCCTGGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPP2R4_ENST00000393370_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_11273nt
ATGCGCCCCGCGCGCCCCGCACTGACATGGCCGTCGCCCGGTTCCGCGCGTCCGCCGCGCGCCGGCCGTTAATAGGCTTGCTCCCTGAGC
GCCCCGCACCGACATGGCGGCCGTCTTCGCTGTGGTGACTTTAACTCTCGGTTTTCGGTTATAGCCGGCCGGCGCTCACTTGTCTTCAGG
AAGCTCGGAGCCTTTGGTGGAGCCGGGGAGAGGAAGGGTGGGTGCAAGAGTGAAAGGCGAGAGGGGACTGCAAGCATCCGGGTCGGCTCC
TGGCCGGAGCAAGATGGCTGAGGGCGAGCGGCAGCCGCCGCCAGATTCTTCAGAGGAGGCCCCTCCAGCCACTCAGAACTTCATCATTCC
AAAAAAGGAGATCCACACAGTTCCAGACATGGGCAAATGGAAGCGTTCTCAGGCATACGCTGACTACATCGGATTCATCCTTACCCTCAA
CGAAGGTGTGAAGGGGAAGAAGCTGACCTTCGAGTACAGAGTCTCCGAGGCCATTGAGAAACTAGTCGCTCTTCTCAACACGCTGGACAG
GTGGATTGATGAGACTCCTCCAGTGGACCAGCCCTCTCGGTTTGGGAATAAGGCATACAGGACCTGGTATGCCAAACTTGATGAGGAAGC
AGAAAACTTGGTGGCCACAGTGGTCCCTACCCATCTGGCAGCTGCTGTGCCTGAGGTGGCTGTTTACCTAAAGGAGTCAGTGGGGAACTC
CACGCGCATTGACTACGGCACAGGGCATGAGGCAGCCTTCGCTGCTTTCCTCTGCTGTCTCTGCAAGATTGGGGTGCTCCGGGTGGATGA
CCAAATAGCTATTGTCTTCAAGGTGTTCAATCGGTACCTTGAGGTTATGCGGAAACTCCAGAAAACATACAGGATGGAGCCAGCCGGCAG
CCAGGGAGTGTGGGGTCTGGATGACTTCCAGTTTCTGCCCTTCATCTGGGGCAGTTCGCAGCTGATAGACCACCCATACCTGGAGCCCAG
ACACTTTGTGGATGAGAAGGCCGTGAATGAGAACCACAAGGACTACATGTTCCTGGAGTGTATCCTGTTTATTACCGAGATGAAGACTGG
CCCATTTGCAGAGCACTCCAACCAGCTGTGGAACATCAGCGCCGTCCCTTCCTGGTCCAAAGTGAACCAGGGTCTCATCCGCATGTATAA
GGCCGAGTGCCTGGAGAAGTTCCCTGTGATCCAGCACTTCAAGTTCGGGAGCCTGCTGCCCATCCATCCTGTCACGTCGGGCTAGGAGGG
GCCAAGCCGAAGAGCCACCCAGGCCACAGTTCCTGTGCCTGCCTTCCCCACCCCAGCAGTGGCCCCTCCCCATCCCCTCCCTCTGTTCGT
CCCGTTTGATGAGAGGCTGTTTACTGGGGTGGGGTGGCGAGATGGGCTTGAGGGGGCTCAGAGCATAAGGCTTCAGGGCCCAAGTTGGGA
GAAGTGACCAAAGTGTAGCCAGTTTTCTGAGTTCCCGTGTGCTAGACTGGCCAGAAGAGAGGGTCTGGGGCCTGGTCACTCGGCCACTCT
CTCCTGTTTCTGGCCTCTTCTCCCTTCACTCCCGTCCAGTCTGGTTTTGAGAGCAGGGGCTGTTCTGCAGCACCGCAGGGAAGGGAGGAG
AGATACCTGCTGCTTCCATTGCTTTTCCCTTCCTGGAGTCGATGCCTTTCTAAGGGTTGGAGCTGCTCCTTGCAGGGGCGGGTCAGTTTC
CCAGGCCATGCCGGGGTGGCCATCTATGGTAGGGCTGGAAGCTGAGGCTGGCCGCCAGCTGTGGGCTGGGGTGGGGTGGGTGGGGTCGGG
TGGTGGAGAGGCCTTAGCTGTCCTGGCTGGTGCCCCTCCCAGGCTCCTTTTCACCCTGCCCCCTGGGCCTGAGGCCCCCTGTGTCCAAGC
CTCCCCCTGGCTCTTCAGTTCTCTAGCCCTTGGCTCTGCTGGGTTTCCTGACTGTAGCCACATCTCTCCCGCTCCCTAAGGGTAACCTAG
CCAATGGAAGCTGCCCTTTGGGTAGGTGCTGGGCTCCTGGGAGGGCCCAGATGATGGGGTGAGGCATGTCTTTCCAGAACTTTCCCTGGC
AGGGAGGGGATGGCAGAAACTCAGGGAGGGGCTTGGGGCCCATTGTATCTGGAGAGCCTGGATTCCTCTTGGCAGTCTTAGGCCCGGCCA
CTTCTGCTACCTTTGCGCTGCTGTGAGCCTCACCCTGGGCCCCTGGGCCCTGCTTCTCTGCTCCCCTGGGTGATGGGTGGGCCCAGAAGG
TGGCAGTCCCACACCTTGTCCTCCCACCTCCCTGAACTGTCCATTGCTTTTATAGGGTGAGGTAAGAGACAGCCTCCCAAGCCCAGGCTT
TGGCACTCAGAATGGGCCCAGTGGGGGCTGGGCAGGCCCATTGAGGGCCACCGCCGAGGTTTCTCCTAGGGCTGTTCCTGGGCCTGGCTC
TTACAGGCTCGTCCCCCAGGCCTGCCCTTCTCCACTGCCCCCTCCTGTGTCTGGGTCCACACACCCTTCAGGAAGGGGGAGCACTGAGAA
GCACAGCACAGGGGCTCAGCCTGGGATCCGGTGATGGTCTGGGCAGAGGCTGGGTCAGGAGTCCCAAAGGTCAGTGACAGTTTCTCAGAA
GAGGCCCAGCGTCCACCTCTCTCCCAGGGCCAGACAGCCCTTCCTGGCTCCCCCATCCCCCTATGGGCTCCCAGCCCCTTGCACCCTCAT
TGCTGTTCAGATTAAAGCCTCTGTTTTGCACCTGTCAAAAAAAAAGAAAAAAAAAGGCACAAAAAAGTGGAAACTTTTCCCTGTCCATTC
CATCAAGTCCTGAAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCT
TGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGA
CATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAAT
TGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGA
GATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGT
ACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGA
TTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTAT
TCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCA
GCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGA
GTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGT
GCCAGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGG
ACAGGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTC
GTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGC
AGCCGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGC
CCTCCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGA
CTCTGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGG
TCTCTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATA
ACCACCCCAGCCTGGGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTC
CGACTGAGAAGACTGCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGC
CCTGGGTGACCCTGGCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCT
TTAGTATCTTTACGAGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGAT
GTCCTGGTTTCCTGCCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGA
GATTCCTCAGCTACTTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGG
AGATCATCTGATCCCAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTC
AGGTCACTTCGGACACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAG
ACAATAATTAACACAGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCT
CCCCGTCCTCGTGGAGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTG
TTGATCTAAGGGGCCGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGT
GGTCAGAGGAAGCCAGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGAC
CTGGGAGTGATTTTGACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAG
AACAGCCAGGTAGAGCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATAT
CTGTATGTCACCAGGATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCC
ACATGTCTTTGCTGTGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACC
CCACAGCTCTTTCCTTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGA
TGGGGGTGGGCACCTGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAA
GACCTAGCCCAACTTCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCC
ACCGCTAAGTATTTTGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGT
GACTGGTGGGGGTGGGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCT
GAGGAGAGTTGACAGTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGT
CACCCAGGCCAGGGATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGT
AGTTGGGGCCAGAGTCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGG
CATCTCTCTCCCTGCCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCAC
CCTTCTTTTGGAATGATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAAC
CAGCTGCCTGAGGCATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCC
TGTAATGAGCTCCCCCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGAC
TCCTGGGCTGCCAGGCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACC
TCGTGGTCCAGCGGAGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGA
AAACACAAGTCCGGGGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTT
TTGGAAAAGGACATTGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAA
CATCCCTTTCCCAAGGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGC
AAAGAGCATGATGCCTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCA
GGCCCCATTCTCTCTCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCC
CAGACCCACAATCAGGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACA
TTGAAACCTGCGGAGTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGG
GTATCAGAGTCAATTCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGT
CATGTGCTGTCCCCCACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGC
CAGGGCCACCAGGGTGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGT
GTAGCCTTGCCACTCGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATT
CAAGTATGAAAACTTGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCC
CAATGCCTGTCAATTGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGT
GCTTCAGGGTGTCCAGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCT
TGCGCTTTGAAGATGGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGC
TTGGGCACCTTTCACATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCA
GAACGACTGCCCAGCCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAA
ATCTTAAAAACCAACCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAG
CTTCCCGGGAGGGTGGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGAC
CGGCTCCACGGTGGCCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACAC
ACCAGCTCTCCTGGGGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCA
TTATTGGAAAGTTGGACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGC
CCCAAACCTCAGGGTTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTG
TGGCGCCAGGTCCCAAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAAT
GAGCTGCCGGCCAGGAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAG
GATTGAAGGGAACCTCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACG
TAGCCACCATTCAGAAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTA
ATATCTACTGAGGGACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACC
CACCCACCCATCAGCTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCAT
CTCCTCCCCGACTCTGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTA
TGGCCGCTGGTCGCCCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTT
TGGATGATGGATTTTTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCA
TGAATACATTTTAATGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAA
AGCTAAAAAGAAAATAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGT
GCACGAGCATGTAAACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAG
AAACAGCACTGAGTCTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCC
GGGGCTCAGGAAGAGGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGG
CCCCACTTCTCAGCCCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGA
CGCTGCCCTGGTTTTTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGG
AAGACACATGCATTTTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACT
GTATCCGCCAAAGTTTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAAC
CACAATTGAATTGCCTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGT
ATTCTTTTTTTCTAGTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTT
GAATGTAATTACAGCAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGG
GAGAAAACAGGGGTGGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAA
TGGTTGACTGCAACACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAG
TGGCTGTTACTTGTGAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATTTTATTGGTTCCTAAA

>In-frame_PPP2R4_ENST00000348141_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_11273nt
GCACTGACATGGCCGTCGCCCGGTTCCGCGCGTCCGCCGCGCGCCGGCCGTTAATAGGCTTGCTCCCTGAGCGCCCCGCACCGACATGGC
GGCCGTCTTCGCTGTGGTGACTTTAACTCTCGGTTTTCGGTTATAGCCGGCCGGCGCTCACTTGTCTTCAGGAAGCTCGGAGCCTTTGGT
GGAGCCGGGGAGAGGAAGGGTGGGTGCAAGAGTGAAAGGCGAGAGGGGACTGCAAGCATCCGGGTCGGCTCCTGGCCGGAGCAAGATGGC
TGAGGGCGAGCGGCAGCCGCCGCCAGATTCTTCAGAGGAGGCCCCTCCAGCCACTCAGAACTTCATCATTCCAAAAAAGGAGATCCACAC
AGTTCCAGACATGGGCAAATGGAAGCGTTCTCAGGTACCATTTGGAACTGTGGCATACGCTGACTACATCGGATTCATCCTTACCCTCAA
CGAAGGTGTGAAGGGGAAGAAGCTGACCTTCGAGTACAGAGTCTCCGAGGCCATTGAGAAACTAGTCGCTCTTCTCAACACGCTGGACAG
GTGGATTGATGAGACTCCTCCAGTGGACCAGCCCTCTCGGTTTGGGAATAAGGCATACAGGACCTGGTATGCCAAACTTGATGAGGAAGC
AGAAAACTTGGTGGCCACAGTGGTCCCTACCCATCTGGCAGCTGCTGTGCCTGAGGTGGCTGTTTACCTAAAGGAGTCAGTGGGGAACTC
CACGCGCATTGACTACGGCACAGGGCATGAGGCAGCCTTCGCTGCTTTCCTCTGCTGTCTCTGCAAGATTGGGGTGCTCCGGGTGGATGA
CCAAATAGCTATTGTCTTCAAGGTGTTCAATCGGTACCTTGAGGTTATGCGGAAACTCCAGAAAACATACAGGATGGAGCCAGCCGGCAG
CCAGGGAGTGTGGGGTCTGGATGACTTCCAGTTTCTGCCCTTCATCTGGGGCAGTTCGCAGCTGATAGACCACCCATACCTGGAGCCCAG
ACACTTTGTGGATGAGAAGGCCGTGAATGAGAACCACAAGGACTACATGTTCCTGGAGTGTATCCTGTTTATTACCGAGATGAAGACTGG
CCCATTTGCAGAGCACTCCAACCAGCTGTGGAACATCAGCGCCGTCCCTTCCTGGTCCAAAGTGAACCAGGGTCTCATCCGCATGTATAA
GGCCGAGTGCCTGGAGAAGTTCCCTGTGATCCAGCACTTCAAGTTCGGGAGCCTGCTGCCCATCCATCCTGTCACGTCGGGCTAGGAGGG
GCCAAGCCGAAGAGCCACCCAGGCCACAGTTCCTGTGCCTGCCTTCCCCACCCCAGCAGTGGCCCCTCCCCATCCCCTCCCTCTGTTCGT
CCCGTTTGATGAGAGGCTGTTTACTGGGGTGGGGTGGCGAGATGGGCTTGAGGGGGCTCAGAGCATAAGGCTTCAGGGCCCAAGTTGGGA
GAAGTGACCAAAGTGTAGCCAGTTTTCTGAGTTCCCGTGTGCTAGACTGGCCAGAAGAGAGGGTCTGGGGCCTGGTCACTCGGCCACTCT
CTCCTGTTTCTGGCCTCTTCTCCCTTCACTCCCGTCCAGTCTGGTTTTGAGAGCAGGGGCTGTTCTGCAGCACCGCAGGGAAGGGAGGAG
AGATACCTGCTGCTTCCATTGCTTTTCCCTTCCTGGAGTCGATGCCTTTCTAAGGGTTGGAGCTGCTCCTTGCAGGGGCGGGTCAGTTTC
CCAGGCCATGCCGGGGTGGCCATCTATGGTAGGGCTGGAAGCTGAGGCTGGCCGCCAGCTGTGGGCTGGGGTGGGGTGGGTGGGGTCGGG
TGGTGGAGAGGCCTTAGCTGTCCTGGCTGGTGCCCCTCCCAGGCTCCTTTTCACCCTGCCCCCTGGGCCTGAGGCCCCCTGTGTCCAAGC
CTCCCCCTGGCTCTTCAGTTCTCTAGCCCTTGGCTCTGCTGGGTTTCCTGACTGTAGCCACATCTCTCCCGCTCCCTAAGGGTAACCTAG
CCAATGGAAGCTGCCCTTTGGGTAGGTGCTGGGCTCCTGGGAGGGCCCAGATGATGGGGTGAGGCATGTCTTTCCAGAACTTTCCCTGGC
AGGGAGGGGATGGCAGAAACTCAGGGAGGGGCTTGGGGCCCATTGTATCTGGAGAGCCTGGATTCCTCTTGGCAGTCTTAGGCCCGGCCA
CTTCTGCTACCTTTGCGCTGCTGTGAGCCTCACCCTGGGCCCCTGGGCCCTGCTTCTCTGCTCCCCTGGGTGATGGGTGGGCCCAGAAGG
TGGCAGTCCCACACCTTGTCCTCCCACCTCCCTGAACTGTCCATTGCTTTTATAGGGTGAGGTAAGAGACAGCCTCCCAAGCCCAGGCTT
TGGCACTCAGAATGGGCCCAGTGGGGGCTGGGCAGGCCCATTGAGGGCCACCGCCGAGGTTTCTCCTAGGGCTGTTCCTGGGCCTGGCTC
TTACAGGCTCGTCCCCCAGGCCTGCCCTTCTCCACTGCCCCCTCCTGTGTCTGGGTCCACACACCCTTCAGGAAGGGGGAGCACTGAGAA
GCACAGCACAGGGGCTCAGCCTGGGATCCGGTGATGGTCTGGGCAGAGGCTGGGTCAGGAGTCCCAAAGGTCAGTGACAGTTTCTCAGAA
GAGGCCCAGCGTCCACCTCTCTCCCAGGGCCAGACAGCCCTTCCTGGCTCCCCCATCCCCCTATGGGCTCCCAGCCCCTTGCACCCTCAT
TGCTGTTCAGATTAAAGCCTCTGTTTTGCACCTGTCAAAAAAAAAGAAAAAAAAAGGCACAAAAAAGTGGAAACTTTTCCCTGTCCATTC
CATCAAGTCCTGAAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCT
TGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGA
CATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAAT
TGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGA
GATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGT
ACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGA
TTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTAT
TCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCA
GCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGA
GTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGT
GCCAGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGG
ACAGGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTC
GTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGC
AGCCGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGC
CCTCCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGA
CTCTGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGG
TCTCTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATA
ACCACCCCAGCCTGGGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTC
CGACTGAGAAGACTGCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGC
CCTGGGTGACCCTGGCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCT
TTAGTATCTTTACGAGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGAT
GTCCTGGTTTCCTGCCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGA
GATTCCTCAGCTACTTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGG
AGATCATCTGATCCCAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTC
AGGTCACTTCGGACACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAG
ACAATAATTAACACAGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCT
CCCCGTCCTCGTGGAGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTG
TTGATCTAAGGGGCCGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGT
GGTCAGAGGAAGCCAGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGAC
CTGGGAGTGATTTTGACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAG
AACAGCCAGGTAGAGCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATAT
CTGTATGTCACCAGGATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCC
ACATGTCTTTGCTGTGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACC
CCACAGCTCTTTCCTTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGA
TGGGGGTGGGCACCTGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAA
GACCTAGCCCAACTTCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCC
ACCGCTAAGTATTTTGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGT
GACTGGTGGGGGTGGGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCT
GAGGAGAGTTGACAGTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGT
CACCCAGGCCAGGGATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGT
AGTTGGGGCCAGAGTCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGG
CATCTCTCTCCCTGCCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCAC
CCTTCTTTTGGAATGATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAAC
CAGCTGCCTGAGGCATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCC
TGTAATGAGCTCCCCCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGAC
TCCTGGGCTGCCAGGCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACC
TCGTGGTCCAGCGGAGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGA
AAACACAAGTCCGGGGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTT
TTGGAAAAGGACATTGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAA
CATCCCTTTCCCAAGGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGC
AAAGAGCATGATGCCTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCA
GGCCCCATTCTCTCTCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCC
CAGACCCACAATCAGGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACA
TTGAAACCTGCGGAGTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGG
GTATCAGAGTCAATTCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGT
CATGTGCTGTCCCCCACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGC
CAGGGCCACCAGGGTGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGT
GTAGCCTTGCCACTCGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATT
CAAGTATGAAAACTTGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCC
CAATGCCTGTCAATTGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGT
GCTTCAGGGTGTCCAGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCT
TGCGCTTTGAAGATGGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGC
TTGGGCACCTTTCACATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCA
GAACGACTGCCCAGCCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAA
ATCTTAAAAACCAACCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAG
CTTCCCGGGAGGGTGGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGAC
CGGCTCCACGGTGGCCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACAC
ACCAGCTCTCCTGGGGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCA
TTATTGGAAAGTTGGACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGC
CCCAAACCTCAGGGTTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTG
TGGCGCCAGGTCCCAAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAAT
GAGCTGCCGGCCAGGAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAG
GATTGAAGGGAACCTCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACG
TAGCCACCATTCAGAAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTA
ATATCTACTGAGGGACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACC
CACCCACCCATCAGCTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCAT
CTCCTCCCCGACTCTGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTA
TGGCCGCTGGTCGCCCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTT
TGGATGATGGATTTTTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCA
TGAATACATTTTAATGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAA
AGCTAAAAAGAAAATAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGT
GCACGAGCATGTAAACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAG
AAACAGCACTGAGTCTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCC
GGGGCTCAGGAAGAGGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGG
CCCCACTTCTCAGCCCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGA
CGCTGCCCTGGTTTTTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGG
AAGACACATGCATTTTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACT
GTATCCGCCAAAGTTTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAAC
CACAATTGAATTGCCTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGT
ATTCTTTTTTTCTAGTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTT
GAATGTAATTACAGCAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGG
GAGAAAACAGGGGTGGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAA
TGGTTGACTGCAACACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAG
TGGCTGTTACTTGTGAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATTTTATTGGTTCCTAAA

>In-frame_PPP2R4_ENST00000347048_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_10525nt
CCCCGCACCGACATGGCGGCCGTCTTCGCTGTGGTGACTTTAACTCTCGGTTTTCGGTTATAGCCGGCCGGCGCTCACTTGTCTTCAGGA
AGCTCGGAGCCTTTGGTGGAGCCGGGGAGAGGAAGGGTGGGTGCAAGAGTGAAAGGCGAGAGGGGACTGCAAGCATCCGGGTCGGCTCCT
GGCCGGAGCAAGATGGCTGAGGGCGAGCGGCAGCCGCCGCCAGATTCTTCAGAGGAGGCCCCTCCAGCCACTCAGAACTTCATCATTCCA
AAAAAGGAGATCCACACAGTTCCAGACATGGGCAAATGGAAGCGTTCTCAGATGAAGACTGGCCCATTTGCAGAGCACTCCAACCAGCTG
TGGAACATCAGCGCCGTCCCTTCCTGGTCCAAAGTGAACCAGGGTCTCATCCGCATGTATAAGGCCGAGTGCCTGGAGAAGTTCCCTGTG
ATCCAGCACTTCAAGTTCGGGAGCCTGCTGCCCATCCATCCTGTCACGTCGGGCTAGGAGGGGCCAAGCCGAAGAGCCACCCAGGCCACA
GTTCCTGTGCCTGCCTTCCCCACCCCAGCAGTGGCCCCTCCCCATCCCCTCCCTCTGTTCGTCCCGTTTGATGAGAGGCTGTTTACTGGG
GTGGGGTGGCGAGATGGGCTTGAGGGGGCTCAGAGCATAAGGCTTCAGGGCCCAAGTTGGGAGAAGTGACCAAAGTGTAGCCAGTTTTCT
GAGTTCCCGTGTGCTAGACTGGCCAGAAGAGAGGGTCTGGGGCCTGGTCACTCGGCCACTCTCTCCTGTTTCTGGCCTCTTCTCCCTTCA
CTCCCGTCCAGTCTGGTTTTGAGAGCAGGGGCTGTTCTGCAGCACCGCAGGGAAGGGAGGAGAGATACCTGCTGCTTCCATTGCTTTTCC
CTTCCTGGAGTCGATGCCTTTCTAAGGGTTGGAGCTGCTCCTTGCAGGGGCGGGTCAGTTTCCCAGGCCATGCCGGGGTGGCCATCTATG
GTAGGGCTGGAAGCTGAGGCTGGCCGCCAGCTGTGGGCTGGGGTGGGGTGGGTGGGGTCGGGTGGTGGAGAGGCCTTAGCTGTCCTGGCT
GGTGCCCCTCCCAGGCTCCTTTTCACCCTGCCCCCTGGGCCTGAGGCCCCCTGTGTCCAAGCCTCCCCCTGGCTCTTCAGTTCTCTAGCC
CTTGGCTCTGCTGGGTTTCCTGACTGTAGCCACATCTCTCCCGCTCCCTAAGGGTAACCTAGCCAATGGAAGCTGCCCTTTGGGTAGGTG
CTGGGCTCCTGGGAGGGCCCAGATGATGGGGTGAGGCATGTCTTTCCAGAACTTTCCCTGGCAGGGAGGGGATGGCAGAAACTCAGGGAG
GGGCTTGGGGCCCATTGTATCTGGAGAGCCTGGATTCCTCTTGGCAGTCTTAGGCCCGGCCACTTCTGCTACCTTTGCGCTGCTGTGAGC
CTCACCCTGGGCCCCTGGGCCCTGCTTCTCTGCTCCCCTGGGTGATGGGTGGGCCCAGAAGGTGGCAGTCCCACACCTTGTCCTCCCACC
TCCCTGAACTGTCCATTGCTTTTATAGGGTGAGGTAAGAGACAGCCTCCCAAGCCCAGGCTTTGGCACTCAGAATGGGCCCAGTGGGGGC
TGGGCAGGCCCATTGAGGGCCACCGCCGAGGTTTCTCCTAGGGCTGTTCCTGGGCCTGGCTCTTACAGGCTCGTCCCCCAGGCCTGCCCT
TCTCCACTGCCCCCTCCTGTGTCTGGGTCCACACACCCTTCAGGAAGGGGGAGCACTGAGAAGCACAGCACAGGGGCTCAGCCTGGGATC
CGGTGATGGTCTGGGCAGAGGCTGGGTCAGGAGTCCCAAAGGTCAGTGACAGTTTCTCAGAAGAGGCCCAGCGTCCACCTCTCTCCCAGG
GCCAGACAGCCCTTCCTGGCTCCCCCATCCCCCTATGGGCTCCCAGCCCCTTGCACCCTCATTGCTGTTCAGATTAAAGCCTCTGTTTTG
CACCTGTCAAAAAAAAAGAAAAAAAAAGGCACAAAAAAGTGGAAACTTTTCCCTGTCCATTCCATCAAGTCCTGAAAAATCAAAATGGAT
TTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCA
CTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCAT
GGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACA
CCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGG
GTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCA
GCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGC
GGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCAC
TCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAG
AGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGT
GGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTG
ACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACGCTG
ACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAAC
CCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCACTGA
CCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCCCATG
AGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCGTTGG
ACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCCTGCA
AATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACCACCCCAGCCTGGGAAGGAGAGCTTG
CTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTCCGACTGAGAAGACTGCTCCACCCATGAT
GCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGCCCTGGGTGACCCTGGCAGGTGCGCTCAG
AGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCTTTAGTATCTTTACGAGGAGTCTCACTGG
GCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGATGTCCTGGTTTCCTGCCTCCATTTCTCTG
GGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGAGATTCCTCAGCTACTTTTCCGAAGCAGA
ATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGGAGATCATCTGATCCCAGCCAAGGAGGGG
CCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTCAGGTCACTTCGGACACCTGCCATGGACA
CTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAGACAATAATTAACACAGAGGACTTTCCCC
CACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCTCCCCGTCCTCGTGGAGCTTAGCAGGCAG
CTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTGTTGATCTAAGGGGCCGCGATGGTCAGGG
CCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGTGGTCAGAGGAAGCCAGCAGGGAAGATCT
GGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGACCTGGGAGTGATTTTGACATGGGGGTGCC
AGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAGAACAGCCAGGTAGAGCCCTTGTCCAAAC
CTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATATCTGTATGTCACCAGGATGGCAGAGAGCC
AGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCCACATGTCTTTGCTGTGGGACCTCAGACA
AAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACCCCACAGCTCTTTCCTTCCCCTCCTCTCT
CCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGATGGGGGTGGGCACCTGAGGCCCAATAAT
ATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAAGACCTAGCCCAACTTCCCTTGTGGGAAA
CTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCCACCGCTAAGTATTTTGTTCCCTAAGTCC
CCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGTGACTGGTGGGGGTGGGGCTGGGACTCGG
GCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCTGAGGAGAGTTGACAGTAAGAGCAGTGAG
AGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGTCACCCAGGCCAGGGATGGAGCCCAGCGA
GCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGTAGTTGGGGCCAGAGTCCACCTCCAGGAG
CCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGGCATCTCTCTCCCTGCCTCCCTCCATTTA
GCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCACCCTTCTTTTGGAATGATGTGTACCCACA
TCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAACCAGCTGCCTGAGGCATGCAGCATCCTTC
CTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCCTGTAATGAGCTCCCCCCATACCTTTCCT
CCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGACTCCTGGGCTGCCAGGCGGAAGCACAAGC
GCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACCTCGTGGTCCAGCGGAGCTGCCTGGGAGC
TTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGAAAACACAAGTCCGGGGCCTCACCAGCAT
CGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTTTTGGAAAAGGACATTGTGGATTTTATGA
AAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAACATCCCTTTCCCAAGGCACCTTAGTTAA
GGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGCAAAGAGCATGATGCCTACTTTATAGACG
GGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCAGGCCCCATTCTCTCTCCACCGAGTTGTG
CTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCCCAGACCCACAATCAGGCAAGAAAGAACA
GGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACATTGAAACCTGCGGAGTCTTTGACCAAAT
CCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGGGTATCAGAGTCAATTCAAGGCCATGCCA
TAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGTCATGTGCTGTCCCCCACTTCCCTTTCTT
TGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGCCAGGGCCACCAGGGTGTCCACAGCCCCT
GGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGTGTAGCCTTGCCACTCGGGCAGCGCACCA
GACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATTCAAGTATGAAAACTTGTAAAATTTTCTG
TCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCCCAATGCCTGTCAATTGCCCCCTTTCTCA
TTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGTGCTTCAGGGTGTCCAGCAAGGCAGGGGT
AGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCTTGCGCTTTGAAGATGGAGTTGGGTGGAA
GGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGCTTGGGCACCTTTCACATGTGCAGGGAAG
AGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCAGAACGACTGCCCAGCCTTGGCAGCCAGT
GGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAAATCTTAAAAACCAACCAAGCACCCTGAC
ACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAGCTTCCCGGGAGGGTGGAAACCAACTCCT
GCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGACCGGCTCCACGGTGGCCCCACTACGAGGC
CAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACACACCAGCTCTCCTGGGGAAACTATTTCTT
TCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCATTATTGGAAAGTTGGACAGTCAGGCCAC
GACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGCCCCAAACCTCAGGGTTCCCTCTTGCATA
TTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTGTGGCGCCAGGTCCCAAGGGCCTCTGCAG
AGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAATGAGCTGCCGGCCAGGAGCAGGCAGGCAC
CAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAGGATTGAAGGGAACCTCAGAATCATGTCA
CTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACGTAGCCACCATTCAGAAAGCCCAGAAATT
CTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTAATATCTACTGAGGGACAATCAGCAAAGC
CTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACCCACCCACCCATCAGCTTCCGGTGGCTGA
TCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCATCTCCTCCCCGACTCTGAGGCCTGGCAGG
AGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTATGGCCGCTGGTCGCCCTTGTCCCCAAAA
TCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTTTGGATGATGGATTTTTGATTTACAAACG
GCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCATGAATACATTTTAATGAAACTATTTTAT
TGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAAAGCTAAAAAGAAAATAAATAAATCCTGA
GTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGTGCACGAGCATGTAAACACACACACACAC
ACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAGAAACAGCACTGAGTCTCCCCATGCCAAT
TCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCCGGGGCTCAGGAAGAGGCAGGCCCATCCC
CTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGGCCCCACTTCTCAGCCCCAGCTGCTGGGC
CTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGACGCTGCCCTGGTTTTTCACCCTCTAGTG
GCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGGAAGACACATGCATTTTGCTTTTAATTCT
TTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACTGTATCCGCCAAAGTTTGTGATGCCTGCA
TAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAACCACAATTGAATTGCCTTTGAAAGTGGGA
GATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGTATTCTTTTTTTCTAGTAGAAAATAACTG
ACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTTGAATGTAATTACAGCAGTGCCAATTTGC
CAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGGGAGAAAACAGGGGTGGGGTTTTGGTTTA
ATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAATGGTTGACTGCAACACCTTTATTTTAGA
TTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAGTGGCTGTTACTTGTGAAGAATTGATTTT

>In-frame_PPP2R4_ENST00000355007_chr9_131911224_+_PAX5_ENST00000358127_chr9_37034103_-_11051nt
CACCGACATGGCGGCCGTCTTCGCTGTGGTGACTTTAACTCTCGGTTTTCGGTTATAGCCGGCCGGCGCTCACTTGTCTTCAGGAAGCTC
GGAGCCTTTGGTGGAGCCGGGGAGAGGAAGGGTGGGTGCAAGAGTGAAAGGCGAGAGGGGACTGCAAGCATCCGGGTCGGCTCCTGGCCG
GAGCAAGATGGCTGAGGGCGAGCGGCAGCCGCCGCCAGATTCTTCAGAGGAGGCCCCTCCAGCCACTCAGAACTTCATCATTCCAAAAAA
GGAGATCCACACAGTTCCAGACATGGGCAAATGGAAGCGTTCTCAGGCATACGCTGACTACATCGGATTCATCCTTACCCTCAACGAAGG
TGTGAAGGGGAAGAAGCTGACCTTCGAGTACAGAGTCTCCGAGGAAGCAGAAAACTTGGTGGCCACAGTGGTCCCTACCCATCTGGCAGC
TGCTGTGCCTGAGGTGGCTGTTTACCTAAAGGAGTCAGTGGGGAACTCCACGCGCATTGACTACGGCACAGGGCATGAGGCAGCCTTCGC
TGCTTTCCTCTGCTGTCTCTGCAAGATTGGGGTGCTCCGGGTGGATGACCAAATAGCTATTGTCTTCAAGGTGTTCAATCGGTACCTTGA
GGTTATGCGGAAACTCCAGAAAACATACAGGATGGAGCCAGCCGGCAGCCAGGGAGTGTGGGGTCTGGATGACTTCCAGTTTCTGCCCTT
CATCTGGGGCAGTTCGCAGCTGATAGACCACCCATACCTGGAGCCCAGACACTTTGTGGATGAGAAGGCCGTGAATGAGAACCACAAGGA
CTACATGTTCCTGGAGTGTATCCTGTTTATTACCGAGATGAAGACTGGCCCATTTGCAGAGCACTCCAACCAGCTGTGGAACATCAGCGC
CGTCCCTTCCTGGTCCAAAGTGAACCAGGGTCTCATCCGCATGTATAAGGCCGAGTGCCTGGAGAAGTTCCCTGTGATCCAGCACTTCAA
GTTCGGGAGCCTGCTGCCCATCCATCCTGTCACGTCGGGCTAGGAGGGGCCAAGCCGAAGAGCCACCCAGGCCACAGTTCCTGTGCCTGC
CTTCCCCACCCCAGCAGTGGCCCCTCCCCATCCCCTCCCTCTGTTCGTCCCGTTTGATGAGAGGCTGTTTACTGGGGTGGGGTGGCGAGA
TGGGCTTGAGGGGGCTCAGAGCATAAGGCTTCAGGGCCCAAGTTGGGAGAAGTGACCAAAGTGTAGCCAGTTTTCTGAGTTCCCGTGTGC
TAGACTGGCCAGAAGAGAGGGTCTGGGGCCTGGTCACTCGGCCACTCTCTCCTGTTTCTGGCCTCTTCTCCCTTCACTCCCGTCCAGTCT
GGTTTTGAGAGCAGGGGCTGTTCTGCAGCACCGCAGGGAAGGGAGGAGAGATACCTGCTGCTTCCATTGCTTTTCCCTTCCTGGAGTCGA
TGCCTTTCTAAGGGTTGGAGCTGCTCCTTGCAGGGGCGGGTCAGTTTCCCAGGCCATGCCGGGGTGGCCATCTATGGTAGGGCTGGAAGC
TGAGGCTGGCCGCCAGCTGTGGGCTGGGGTGGGGTGGGTGGGGTCGGGTGGTGGAGAGGCCTTAGCTGTCCTGGCTGGTGCCCCTCCCAG
GCTCCTTTTCACCCTGCCCCCTGGGCCTGAGGCCCCCTGTGTCCAAGCCTCCCCCTGGCTCTTCAGTTCTCTAGCCCTTGGCTCTGCTGG
GTTTCCTGACTGTAGCCACATCTCTCCCGCTCCCTAAGGGTAACCTAGCCAATGGAAGCTGCCCTTTGGGTAGGTGCTGGGCTCCTGGGA
GGGCCCAGATGATGGGGTGAGGCATGTCTTTCCAGAACTTTCCCTGGCAGGGAGGGGATGGCAGAAACTCAGGGAGGGGCTTGGGGCCCA
TTGTATCTGGAGAGCCTGGATTCCTCTTGGCAGTCTTAGGCCCGGCCACTTCTGCTACCTTTGCGCTGCTGTGAGCCTCACCCTGGGCCC
CTGGGCCCTGCTTCTCTGCTCCCCTGGGTGATGGGTGGGCCCAGAAGGTGGCAGTCCCACACCTTGTCCTCCCACCTCCCTGAACTGTCC
ATTGCTTTTATAGGGTGAGGTAAGAGACAGCCTCCCAAGCCCAGGCTTTGGCACTCAGAATGGGCCCAGTGGGGGCTGGGCAGGCCCATT
GAGGGCCACCGCCGAGGTTTCTCCTAGGGCTGTTCCTGGGCCTGGCTCTTACAGGCTCGTCCCCCAGGCCTGCCCTTCTCCACTGCCCCC
TCCTGTGTCTGGGTCCACACACCCTTCAGGAAGGGGGAGCACTGAGAAGCACAGCACAGGGGCTCAGCCTGGGATCCGGTGATGGTCTGG
GCAGAGGCTGGGTCAGGAGTCCCAAAGGTCAGTGACAGTTTCTCAGAAGAGGCCCAGCGTCCACCTCTCTCCCAGGGCCAGACAGCCCTT
CCTGGCTCCCCCATCCCCCTATGGGCTCCCAGCCCCTTGCACCCTCATTGCTGTTCAGATTAAAGCCTCTGTTTTGCACCTGTCAAAAAA
AAAGAAAAAAAAAGGCACAAAAAAGTGGAAACTTTTCCCTGTCCATTCCATCAAGTCCTGAAAAATCAAAATGGATTTAGAGAAAAATTA
TCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTAGT
CCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGCAA
AATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTGGA
AAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAATGA
CACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCACAG
CATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGCAT
CACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGCAG
AGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTACTC
AGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGACAT
GAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGACTT
GGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTGCC
TGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGG
CTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGG
CGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAG
CATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTT
GTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCC
CAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACCACCCCAGCCTGGGAAGGAGAGCTTGCTTTTGTTGCTTCA
GCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTCCGACTGAGAAGACTGCTCCACCCATGATGCATCTCGCACTCT
TGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGCCCTGGGTGACCCTGGCAGGTGCGCTCAGAGCTGTCCTCAAGA
TGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCTTTAGTATCTTTACGAGGAGTCTCACTGGGCTGGTTGTGCTGC
AGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGATGTCCTGGTTTCCTGCCTCCATTTCTCTGGGACCGATGCAGTA
TCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGAGATTCCTCAGCTACTTTTCCGAAGCAGAATGTCATCCGAGGT
ATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGGAGATCATCTGATCCCAGCCAAGGAGGGGCCTGAGGCTCTCCC
TACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTCAGGTCACTTCGGACACCTGCCATGGACACTTCACCCACCCTC
CAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAGACAATAATTAACACAGAGGACTTTCCCCCACACCCAGATCAC
AAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCTCCCCGTCCTCGTGGAGCTTAGCAGGCAGCTGGGCATGGAGGT
GCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTGTTGATCTAAGGGGCCGCGATGGTCAGGGCCACGGCCAAGGGC
CACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGTGGTCAGAGGAAGCCAGCAGGGAAGATCTGGGGGACAGAGGAA
GGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGACCTGGGAGTGATTTTGACATGGGGGTGCCAGGTGCCATCATCT
CTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAGAACAGCCAGGTAGAGCCCTTGTCCAAACCTGGGCTGAATGAC
AGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATATCTGTATGTCACCAGGATGGCAGAGAGCCAGGGCAGAGAGAGA
CTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCCACATGTCTTTGCTGTGGGACCTCAGACAAAACCCTGCACCTC
TTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACCCCACAGCTCTTTCCTTCCCCTCCTCTCTCCAGGGAGCCGGGG
CTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGATGGGGGTGGGCACCTGAGGCCCAATAATATTTGGACCAAGTG
GGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAAGACCTAGCCCAACTTCCCTTGTGGGAAACTGAGGCCCAGCTT
GGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCCACCGCTAAGTATTTTGTTCCCTAAGTCCCCCACAGGGTGGTG
GAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGTGACTGGTGGGGGTGGGGCTGGGACTCGGGCTCCTGACCCCCA
ACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCTGAGGAGAGTTGACAGTAAGAGCAGTGAGAGATGGTTCTGGGC
CCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGTCACCCAGGCCAGGGATGGAGCCCAGCGAGCTCACAGCAGGCA
CATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGTAGTTGGGGCCAGAGTCCACCTCCAGGAGCCAGGGTGAGCTGG
CTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGGCATCTCTCTCCCTGCCTCCCTCCATTTAGCAGGAAGTGGTGG
GGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCACCCTTCTTTTGGAATGATGTGTACCCACATCTTTGGATCCTGC
CCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAACCAGCTGCCTGAGGCATGCAGCATCCTTCCTCGGCAAAGCCCA
CCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCCTGTAATGAGCTCCCCCCATACCTTTCCTCCCTCACCTGAGGC
TTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGACTCCTGGGCTGCCAGGCGGAAGCACAAGCGCACATGGATGCAC
ACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACCTCGTGGTCCAGCGGAGCTGCCTGGGAGCTTGGTGAGGATGGC
TCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGAAAACACAAGTCCGGGGCCTCACCAGCATCGTGGCAGAAGGCC
TGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTTTTGGAAAAGGACATTGTGGATTTTATGAAAATTTCTCATACC
ATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAACATCCCTTTCCCAAGGCACCTTAGTTAAGGCTAGCCCTTCCA
TAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGCAAAGAGCATGATGCCTACTTTATAGACGGGGAAATTGACATT
TGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCAGGCCCCATTCTCTCTCCACCGAGTTGTGCTCCTGTCATGGGA
GTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCCCAGACCCACAATCAGGCAAGAAAGAACAGGGACCCAGAGGCT
GGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACATTGAAACCTGCGGAGTCTTTGACCAAATCCACAACAGTGCTT
CTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGGGTATCAGAGTCAATTCAAGGCCATGCCATAATCCCTGACCAG
GCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGTCATGTGCTGTCCCCCACTTCCCTTTCTTTGCCTTCGCACTTT
GGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGCCAGGGCCACCAGGGTGTCCACAGCCCCTGGAAACACAGATCA
CAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGTGTAGCCTTGCCACTCGGGCAGCGCACCAGACAGTACGGTGCA
GCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATTCAAGTATGAAAACTTGTAAAATTTTCTGTCGGCCTAAAGAAA
AATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCCCAATGCCTGTCAATTGCCCCCTTTCTCATTCACCTCCTGTCC
TTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGTGCTTCAGGGTGTCCAGCAAGGCAGGGGTAGAAACGGGCACGC
CCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCTTGCGCTTTGAAGATGGAGTTGGGTGGAAGGTCAGAGGCGCTG
GGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGCTTGGGCACCTTTCACATGTGCAGGGAAGAGACTCAGATGTGG
CCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCAGAACGACTGCCCAGCCTTGGCAGCCAGTGGCTCCAGCCACCC
CCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAAATCTTAAAAACCAACCAAGCACCCTGACACAGCCCTAGAAAC
ACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAGCTTCCCGGGAGGGTGGAAACCAACTCCTGCCCCACGGCCAGG
CCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGACCGGCTCCACGGTGGCCCCACTACGAGGCCAGTTCTGCAGTCT
TGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACACACCAGCTCTCCTGGGGAAACTATTTCTTTCGTTCTTTTGGCC
TCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCATTATTGGAAAGTTGGACAGTCAGGCCACGACTCCTAGCCCAC
GGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGCCCCAAACCTCAGGGTTCCCTCTTGCATATTCATGGGGGAACC
ACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTGTGGCGCCAGGTCCCAAGGGCCTCTGCAGAGGCCAGGCTGTGA
GCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAATGAGCTGCCGGCCAGGAGCAGGCAGGCACCAGCCTGTCTTTCC
TTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAGGATTGAAGGGAACCTCAGAATCATGTCACTGCCATTCTAGAG
TTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACGTAGCCACCATTCAGAAAGCCCAGAAATTCTTGTTCCCACATC
TTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTAATATCTACTGAGGGACAATCAGCAAAGCCTCAAAGGAGTCGT
CTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACCCACCCACCCATCAGCTTCCGGTGGCTGATCGGGGCCCAGGGA
GGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCATCTCCTCCCCGACTCTGAGGCCTGGCAGGAGGAGGCCACACCA
GCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTATGGCCGCTGGTCGCCCTTGTCCCCAAAATCACCATGCCTGTG
GCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTTTGGATGATGGATTTTTGATTTACAAACGGCGCATTTCCCTTG
GAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCATGAATACATTTTAATGAAACTATTTTATTGTATTTGAGGAAA
TGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAAAGCTAAAAAGAAAATAAATAAATCCTGAGTCTATTTTAAACA
CTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGTGCACGAGCATGTAAACACACACACACACACACACACACACAC
ACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAGAAACAGCACTGAGTCTCCCCATGCCAATTCTTGCCTGCTGTC
TTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCCGGGGCTCAGGAAGAGGCAGGCCCATCCCCTGGCCCCAAGCAC
CCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGGCCCCACTTCTCAGCCCCAGCTGCTGGGCCTCCAAGGTTGGGC
TGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGACGCTGCCCTGGTTTTTCACCCTCTAGTGGCCTTGGACATTGA
GTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGGAAGACACATGCATTTTGCTTTTAATTCTTTGAGACATTTGAT
TTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACTGTATCCGCCAAAGTTTGTGATGCCTGCATAGACGCTTACTTG
TAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAACCACAATTGAATTGCCTTTGAAAGTGGGAGATGATCTGTCTCC
AACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGTATTCTTTTTTTCTAGTAGAAAATAACTGACTTGAAATATTGG
TGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTTGAATGTAATTACAGCAGTGCCAATTTGCCAAAGATGTTGGAC
ATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGGGAGAAAACAGGGGTGGGGTTTTGGTTTAATTTTTTTTTTACT
TTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAATGGTTGACTGCAACACCTTTATTTTAGATTAGTTGGAGAAAC
ATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAGTGGCTGTTACTTGTGAAGAATTGATTTTATGTAACCTTTATG


Top

FusionGenePPI for PPP2R4_PAX5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPP2R4CCNG1, PPP2R3A, H2AFX, CYP17A1, HDAC4, CCT5, CCT8, CCT2, CCT4, CCT7, CCT3, TCP1, PPP4C, PPP2CA, SLC25A3, CCT6A, MYLPF, MYOCD, MYH9, PPP2R1A, PTEN, ARRB2, SET, MDM2, SP1, PPP1CA, AURKB, CYLD, STK26, ATM, AKT1, MAP2K3, MID1, MARK2, CAV1, RACGAP1, APP, IER3, MAPT, PRKCB, EIF4EBP1, STAT1, SP3, BHLHB9, AMOT, MOV10, NXF1, FAM110C, TUBA1A, PPP4R2, ANXA3, ACOT13, PHPT1, BRINP1, FOXO3, KISS1R, CCNE1, PPP2CB, SMEK1, F3, TRIM25PAX5TLE4, DAXX, RUNX1, MYB, ID3, EP300, TBP, RB1, MAPK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPP2R4_PAX5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPP2R4_PAX5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePAX5C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human;UNIPROT
TgenePAX5C0023485Precursor B-Cell Lymphoblastic Leukemia-Lymphoma1CTD_human