FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28434

FusionGeneSummary for PPP2R2C_CTBP1

check button Fusion gene summary
Fusion gene informationFusion gene name: PPP2R2C_CTBP1
Fusion gene ID: 28434
HgeneTgene
Gene symbol

PPP2R2C

CTBP1

Gene ID

5522

1487

Gene nameprotein phosphatase 2 regulatory subunit BgammaC-terminal binding protein 1
SynonymsB55-GAMMA|B55gamma|IMYPNO|IMYPNO1|PR52|PR55GBARS|HADDTS
Cytomap

4p16.1

4p16.3

Type of geneprotein-codingprotein-coding
Descriptionprotein phosphatase 2, regulatory subunit B, gammaPP2A, subunit B, B-gamma isoformPP2A, subunit B, B55-gamma isoformPP2A, subunit B, PR55-gamma isoformPP2A, subunit B, R2-gamma isoformgamma isoform of regulatory subunit B55, protein phosphatase 2phoC-terminal-binding protein 1brefeldin A-ribosylated substrate
Modification date2018052720180522
UniProtAcc

Q9Y2T4

Q13363

Ensembl transtripts involved in fusion geneENST00000506140, ENST00000515571, 
ENST00000382599, ENST00000507294, 
ENST00000314348, ENST00000335585, 
ENST00000382952, ENST00000290921, 
ENST00000510568, ENST00000515690, 
Fusion gene scores* DoF score3 X 3 X 2=188 X 7 X 8=448
# samples 312
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(12/448*10)=-1.90046432644909
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PPP2R2C [Title/Abstract] AND CTBP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-DH-A669-01APPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000506140ENST00000382952PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
Frame-shiftENST00000506140ENST00000290921PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000506140ENST00000510568PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000506140ENST00000515690PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
In-frameENST00000515571ENST00000382952PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
In-frameENST00000515571ENST00000290921PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000515571ENST00000510568PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000515571ENST00000515690PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
Frame-shiftENST00000382599ENST00000382952PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
Frame-shiftENST00000382599ENST00000290921PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000382599ENST00000510568PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000382599ENST00000515690PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
In-frameENST00000507294ENST00000382952PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
In-frameENST00000507294ENST00000290921PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000507294ENST00000510568PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000507294ENST00000515690PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
intron-3CDSENST00000314348ENST00000382952PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
intron-3CDSENST00000314348ENST00000290921PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
intron-intronENST00000314348ENST00000510568PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
intron-intronENST00000314348ENST00000515690PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
Frame-shiftENST00000335585ENST00000382952PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
Frame-shiftENST00000335585ENST00000290921PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000335585ENST00000510568PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-
5CDS-intronENST00000335585ENST00000515690PPP2R2Cchr4

6349573

-CTBP1chr4

1207393

-

Top

FusionProtFeatures for PPP2R2C_CTBP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPP2R2C

Q9Y2T4

CTBP1

Q13363

The B regulatory subunit might modulate substrateselectivity and catalytic activity, and also might direct thelocalization of the catalytic enzyme to a particular subcellularcompartment. Corepressor targeting diverse transcription regulatorssuch as GLIS2 or BCL6. Has dehydrogenase activity. Involved incontrolling the equilibrium between tubular and stacked structuresin the Golgi complex. Functions in brown adipose tissue (BAT)differentiation. {ECO:0000269|PubMed:12419229,ECO:0000269|PubMed:15542832, ECO:0000269|PubMed:18212045,ECO:0000269|PubMed:19103759, ECO:0000269|PubMed:9858600}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PPP2R2C_CTBP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPP2R2C_ENST00000515571_chr4_6349573_-_CTBP1_ENST00000382952_chr4_1207393_-_389aa
MGKRDTADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSL
LSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCETYMSADDLRIN
LWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKPLARALXRMHPTSSAPPMLHGTAS
RHPSRCERRRHGRSAEPSQAGSQTAXRTVSTRTIXQPPPTGPAWTPPSCTLSSMGLPIGTLRAWWAWPPLASQLLWKVSSPAPCPCPTAC

>In-frame_PPP2R2C_ENST00000515571_chr4_6349573_-_CTBP1_ENST00000290921_chr4_1207393_-_389aa
MGKRDTADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSL
LSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCETYMSADDLRIN
LWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKPLARALXRMHPTSSAPPMLHGTAS
RHPSRCERRRHGRSAEPSQAGSQTAXRTVSTRTIXQPPPTGPAWTPPSCTLSSMGLPIGTLRAWWAWPPLASQLLWKVSSPAPCPCPTAC

>In-frame_PPP2R2C_ENST00000507294_chr4_6349573_-_CTBP1_ENST00000382952_chr4_1207393_-_399aa
MREADTLRPPQLMEVSADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKW
LPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCET
YMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKPLARALXRMHPTSS
APPMLHGTASRHPSRCERRRHGRSAEPSQAGSQTAXRTVSTRTIXQPPPTGPAWTPPSCTLSSMGLPIGTLRAWWAWPPLASQLLWKVSS

>In-frame_PPP2R2C_ENST00000507294_chr4_6349573_-_CTBP1_ENST00000290921_chr4_1207393_-_399aa
MREADTLRPPQLMEVSADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKW
LPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCET
YMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKPLARALXRMHPTSS
APPMLHGTASRHPSRCERRRHGRSAEPSQAGSQTAXRTVSTRTIXQPPPTGPAWTPPSCTLSSMGLPIGTLRAWWAWPPLASQLLWKVSS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPP2R2C_ENST00000515571_chr4_6349573_-_CTBP1_ENST00000382952_chr4_1207393_-_1169nt
ATGGGAAAGAGAGACACGGCTGACATCATCTCTACCGTTGAGTTCAACCACACGGGAGAGCTGCTGGCCACAGGTGACAAGGGCGGCCGG
GTCGTCATCTTCCAGCGGGAACCAGAGAGTAAAAATGCGCCCCACAGCCAGGGCGAATACGACGTGTACAGCACTTTCCAGAGCCACGAG
CCGGAGTTTGACTATCTCAAGAGCCTGGAGATAGAGGAGAAGATCAACAAGATCAAGTGGCTCCCACAGCAGAACGCCGCCCACTCACTC
CTGTCCACCAACGATAAAACTATCAAATTATGGAAGATTACCGAACGAGATAAAAGGCCCGAAGGATACAACCTGAAGGATGAAGAGGGG
AAACTTAAGGACCTGTCCACGGTGACGTCACTGCAGGTGCCAGTGCTGAAGCCCATGGATCTGATGGTGGAGGTGAGCCCTCGGAGGATC
TTTGCCAATGGCCACACCTACCACATCAACTCCATCTCCGTCAACAGTGACTGCGAGACCTACATGTCGGCGGATGACCTGCGCATCAAC
CTCTGGCACCTGGCCATCACCGACAGGAGCTTCAACATCGTGGACATCAAGCCGGCCAACATGGAGGACCTTACGGAGGTGATCACAGCA
TCTGAGTTCCATCCGCACCACTGCAACCTCTTCGTCTACAGCAGCAGCAAGGGCTCCCTGCGGCTCTGCGACATGCGGGCAGCTGCCCTG
TGTGACAAGCATTCCAAGCCTTTAGCCAGGGCCCTCTGAAGGATGCACCCAACCTCATCTGCACCCCCCATGCTGCATGGTACAGCGAGC
AGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGAGATCCGCAGAGCCATCACAGGCCGGATCCCAGACAGCCTGAAGAACTGTGTCA
ACAAGGACCATCTGACAGCCGCCACCCACTGGGCCAGCATGGACCCCGCCGTCGTGCACCCTGAGCTCAATGGGGCTGCCTATAGGTACC
CTCCGGGCGTGGTGGGCGTGGCCCCCACTGGCATCCCAGCTGCTGTGGAAGGTATCGTCCCCAGCGCCATGTCCCTGTCCCACGGCCTGC

>In-frame_PPP2R2C_ENST00000515571_chr4_6349573_-_CTBP1_ENST00000290921_chr4_1207393_-_1169nt
ATGGGAAAGAGAGACACGGCTGACATCATCTCTACCGTTGAGTTCAACCACACGGGAGAGCTGCTGGCCACAGGTGACAAGGGCGGCCGG
GTCGTCATCTTCCAGCGGGAACCAGAGAGTAAAAATGCGCCCCACAGCCAGGGCGAATACGACGTGTACAGCACTTTCCAGAGCCACGAG
CCGGAGTTTGACTATCTCAAGAGCCTGGAGATAGAGGAGAAGATCAACAAGATCAAGTGGCTCCCACAGCAGAACGCCGCCCACTCACTC
CTGTCCACCAACGATAAAACTATCAAATTATGGAAGATTACCGAACGAGATAAAAGGCCCGAAGGATACAACCTGAAGGATGAAGAGGGG
AAACTTAAGGACCTGTCCACGGTGACGTCACTGCAGGTGCCAGTGCTGAAGCCCATGGATCTGATGGTGGAGGTGAGCCCTCGGAGGATC
TTTGCCAATGGCCACACCTACCACATCAACTCCATCTCCGTCAACAGTGACTGCGAGACCTACATGTCGGCGGATGACCTGCGCATCAAC
CTCTGGCACCTGGCCATCACCGACAGGAGCTTCAACATCGTGGACATCAAGCCGGCCAACATGGAGGACCTTACGGAGGTGATCACAGCA
TCTGAGTTCCATCCGCACCACTGCAACCTCTTCGTCTACAGCAGCAGCAAGGGCTCCCTGCGGCTCTGCGACATGCGGGCAGCTGCCCTG
TGTGACAAGCATTCCAAGCCTTTAGCCAGGGCCCTCTGAAGGATGCACCCAACCTCATCTGCACCCCCCATGCTGCATGGTACAGCGAGC
AGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGAGATCCGCAGAGCCATCACAGGCCGGATCCCAGACAGCCTGAAGAACTGTGTCA
ACAAGGACCATCTGACAGCCGCCACCCACTGGGCCAGCATGGACCCCGCCGTCGTGCACCCTGAGCTCAATGGGGCTGCCTATAGGTACC
CTCCGGGCGTGGTGGGCGTGGCCCCCACTGGCATCCCAGCTGCTGTGGAAGGTATCGTCCCCAGCGCCATGTCCCTGTCCCACGGCCTGC

>In-frame_PPP2R2C_ENST00000507294_chr4_6349573_-_CTBP1_ENST00000382952_chr4_1207393_-_1199nt
ATGCGTGAGGCGGACACGTTGAGGCCACCTCAGCTGATGGAAGTTTCCGCTGACATCATCTCTACCGTTGAGTTCAACCACACGGGAGAG
CTGCTGGCCACAGGTGACAAGGGCGGCCGGGTCGTCATCTTCCAGCGGGAACCAGAGAGTAAAAATGCGCCCCACAGCCAGGGCGAATAC
GACGTGTACAGCACTTTCCAGAGCCACGAGCCGGAGTTTGACTATCTCAAGAGCCTGGAGATAGAGGAGAAGATCAACAAGATCAAGTGG
CTCCCACAGCAGAACGCCGCCCACTCACTCCTGTCCACCAACGATAAAACTATCAAATTATGGAAGATTACCGAACGAGATAAAAGGCCC
GAAGGATACAACCTGAAGGATGAAGAGGGGAAACTTAAGGACCTGTCCACGGTGACGTCACTGCAGGTGCCAGTGCTGAAGCCCATGGAT
CTGATGGTGGAGGTGAGCCCTCGGAGGATCTTTGCCAATGGCCACACCTACCACATCAACTCCATCTCCGTCAACAGTGACTGCGAGACC
TACATGTCGGCGGATGACCTGCGCATCAACCTCTGGCACCTGGCCATCACCGACAGGAGCTTCAACATCGTGGACATCAAGCCGGCCAAC
ATGGAGGACCTTACGGAGGTGATCACAGCATCTGAGTTCCATCCGCACCACTGCAACCTCTTCGTCTACAGCAGCAGCAAGGGCTCCCTG
CGGCTCTGCGACATGCGGGCAGCTGCCCTGTGTGACAAGCATTCCAAGCCTTTAGCCAGGGCCCTCTGAAGGATGCACCCAACCTCATCT
GCACCCCCCATGCTGCATGGTACAGCGAGCAGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGAGATCCGCAGAGCCATCACAGGCC
GGATCCCAGACAGCCTGAAGAACTGTGTCAACAAGGACCATCTGACAGCCGCCACCCACTGGGCCAGCATGGACCCCGCCGTCGTGCACC
CTGAGCTCAATGGGGCTGCCTATAGGTACCCTCCGGGCGTGGTGGGCGTGGCCCCCACTGGCATCCCAGCTGCTGTGGAAGGTATCGTCC
CCAGCGCCATGTCCCTGTCCCACGGCCTGCCCCCTGTGGCCCACCCGCCCCACGCCCCTTCTCCTGGCCAAACCGTCAAGCCCGAGGCGG

>In-frame_PPP2R2C_ENST00000507294_chr4_6349573_-_CTBP1_ENST00000290921_chr4_1207393_-_1199nt
ATGCGTGAGGCGGACACGTTGAGGCCACCTCAGCTGATGGAAGTTTCCGCTGACATCATCTCTACCGTTGAGTTCAACCACACGGGAGAG
CTGCTGGCCACAGGTGACAAGGGCGGCCGGGTCGTCATCTTCCAGCGGGAACCAGAGAGTAAAAATGCGCCCCACAGCCAGGGCGAATAC
GACGTGTACAGCACTTTCCAGAGCCACGAGCCGGAGTTTGACTATCTCAAGAGCCTGGAGATAGAGGAGAAGATCAACAAGATCAAGTGG
CTCCCACAGCAGAACGCCGCCCACTCACTCCTGTCCACCAACGATAAAACTATCAAATTATGGAAGATTACCGAACGAGATAAAAGGCCC
GAAGGATACAACCTGAAGGATGAAGAGGGGAAACTTAAGGACCTGTCCACGGTGACGTCACTGCAGGTGCCAGTGCTGAAGCCCATGGAT
CTGATGGTGGAGGTGAGCCCTCGGAGGATCTTTGCCAATGGCCACACCTACCACATCAACTCCATCTCCGTCAACAGTGACTGCGAGACC
TACATGTCGGCGGATGACCTGCGCATCAACCTCTGGCACCTGGCCATCACCGACAGGAGCTTCAACATCGTGGACATCAAGCCGGCCAAC
ATGGAGGACCTTACGGAGGTGATCACAGCATCTGAGTTCCATCCGCACCACTGCAACCTCTTCGTCTACAGCAGCAGCAAGGGCTCCCTG
CGGCTCTGCGACATGCGGGCAGCTGCCCTGTGTGACAAGCATTCCAAGCCTTTAGCCAGGGCCCTCTGAAGGATGCACCCAACCTCATCT
GCACCCCCCATGCTGCATGGTACAGCGAGCAGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGAGATCCGCAGAGCCATCACAGGCC
GGATCCCAGACAGCCTGAAGAACTGTGTCAACAAGGACCATCTGACAGCCGCCACCCACTGGGCCAGCATGGACCCCGCCGTCGTGCACC
CTGAGCTCAATGGGGCTGCCTATAGGTACCCTCCGGGCGTGGTGGGCGTGGCCCCCACTGGCATCCCAGCTGCTGTGGAAGGTATCGTCC
CCAGCGCCATGTCCCTGTCCCACGGCCTGCCCCCTGTGGCCCACCCGCCCCACGCCCCTTCTCCTGGCCAAACCGTCAAGCCCGAGGCGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPP2R2C_ENST00000515571_chr4_6349573_-_CTBP1_ENST00000382952_chr4_1207393_-_2244nt
ATGTGTTTTGGGGGAAACAGAGAGAAAGGTGTGGCCTCTCCACTTCTGTGGACACCCCAAATAGGAAGAAGGGTGCACACAAAGCACCGC
TTCCTCCACGAAGCCCTCCTCAGGCACATCGAGGAGAACCAGCTGCCCAAGCTCTTGGCTGCTGCCCTTCTGAGGCCTGCCTGATTTGGG
CCACATAGATCTGGTTTTGGCCATTGACTGGCAACATGGCAGTAGCCAACTGCAGAGCCACCAGGGAGCAGCCTCATTCTGATTGAGTAT
AACGAAGACGCTGATGGGAAAGAGAGACACGGCTGACATCATCTCTACCGTTGAGTTCAACCACACGGGAGAGCTGCTGGCCACAGGTGA
CAAGGGCGGCCGGGTCGTCATCTTCCAGCGGGAACCAGAGAGTAAAAATGCGCCCCACAGCCAGGGCGAATACGACGTGTACAGCACTTT
CCAGAGCCACGAGCCGGAGTTTGACTATCTCAAGAGCCTGGAGATAGAGGAGAAGATCAACAAGATCAAGTGGCTCCCACAGCAGAACGC
CGCCCACTCACTCCTGTCCACCAACGATAAAACTATCAAATTATGGAAGATTACCGAACGAGATAAAAGGCCCGAAGGATACAACCTGAA
GGATGAAGAGGGGAAACTTAAGGACCTGTCCACGGTGACGTCACTGCAGGTGCCAGTGCTGAAGCCCATGGATCTGATGGTGGAGGTGAG
CCCTCGGAGGATCTTTGCCAATGGCCACACCTACCACATCAACTCCATCTCCGTCAACAGTGACTGCGAGACCTACATGTCGGCGGATGA
CCTGCGCATCAACCTCTGGCACCTGGCCATCACCGACAGGAGCTTCAACATCGTGGACATCAAGCCGGCCAACATGGAGGACCTTACGGA
GGTGATCACAGCATCTGAGTTCCATCCGCACCACTGCAACCTCTTCGTCTACAGCAGCAGCAAGGGCTCCCTGCGGCTCTGCGACATGCG
GGCAGCTGCCCTGTGTGACAAGCATTCCAAGCCTTTAGCCAGGGCCCTCTGAAGGATGCACCCAACCTCATCTGCACCCCCCATGCTGCA
TGGTACAGCGAGCAGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGAGATCCGCAGAGCCATCACAGGCCGGATCCCAGACAGCCTG
AAGAACTGTGTCAACAAGGACCATCTGACAGCCGCCACCCACTGGGCCAGCATGGACCCCGCCGTCGTGCACCCTGAGCTCAATGGGGCT
GCCTATAGGTACCCTCCGGGCGTGGTGGGCGTGGCCCCCACTGGCATCCCAGCTGCTGTGGAAGGTATCGTCCCCAGCGCCATGTCCCTG
TCCCACGGCCTGCCCCCTGTGGCCCACCCGCCCCACGCCCCTTCTCCTGGCCAAACCGTCAAGCCCGAGGCGGATAGAGACCACGCCAGT
GACCAGTTGTAGCCCGGGAGGAGCTCTCCAGCCTCGGCGCCTGGGCAGAGGGCCCGGAAACCCTCGGACCAGAGTGTGTGGAGGAGGCAT
CTGTGTGGTGGCCCTGGCACTGCAGAGACTGGTCCGGGCTGTCAGGAGGCGGGAGGGGGCAGCGCTGGGCCTCGTGTCGCTTGTCGTCGT
CCGTCCTGTGGGCGCTCTGCCCTGTGTCCTTCGCGTTCCTCGTTAAGCAGAAGAAGTCAGTAGTTATTCTCCCATGAACGTTCTTGTCTG
TGTACAGTTTTTAGAACATTACAAAGGATCTGTTTGCTTAGCTGTCAACAAAAAGAAAACCTGAAGGAGCATTTGGAAGTCAATTTGAGG
TTTTTTTTTTTGTTTTTTTTTTTTTTGTATGTTGGAACGTGCCCCAGAATGAGGCAGTTGGCAAACTTCTCAGGACAATGAATCCTTCCC
GTTTTTCTTTTTATGCCACACAGTGCATTGTTTTTTCTACCTGCTTGTCTTATTTTTAGAATAATTTAGAAAAACAAAACAAAGGCTGTT
TTTCCTAATTTTGGCATGAACCCCCCCTTGTTCCAAATGAAGACGGCATCACGAAGCAGCTCCAAAAGGAAAAGCTTGGGCGGTGCCCAG
CGTGCCCGCTGCCCATCGACGTCTGTCCTGGGGACGTGGAGGGTGGCAGCGTCCCCGCCTGCACCAGTGCCGTCCTGCTGATGTGGTAGG

>In-frame_PPP2R2C_ENST00000515571_chr4_6349573_-_CTBP1_ENST00000290921_chr4_1207393_-_2244nt
ATGTGTTTTGGGGGAAACAGAGAGAAAGGTGTGGCCTCTCCACTTCTGTGGACACCCCAAATAGGAAGAAGGGTGCACACAAAGCACCGC
TTCCTCCACGAAGCCCTCCTCAGGCACATCGAGGAGAACCAGCTGCCCAAGCTCTTGGCTGCTGCCCTTCTGAGGCCTGCCTGATTTGGG
CCACATAGATCTGGTTTTGGCCATTGACTGGCAACATGGCAGTAGCCAACTGCAGAGCCACCAGGGAGCAGCCTCATTCTGATTGAGTAT
AACGAAGACGCTGATGGGAAAGAGAGACACGGCTGACATCATCTCTACCGTTGAGTTCAACCACACGGGAGAGCTGCTGGCCACAGGTGA
CAAGGGCGGCCGGGTCGTCATCTTCCAGCGGGAACCAGAGAGTAAAAATGCGCCCCACAGCCAGGGCGAATACGACGTGTACAGCACTTT
CCAGAGCCACGAGCCGGAGTTTGACTATCTCAAGAGCCTGGAGATAGAGGAGAAGATCAACAAGATCAAGTGGCTCCCACAGCAGAACGC
CGCCCACTCACTCCTGTCCACCAACGATAAAACTATCAAATTATGGAAGATTACCGAACGAGATAAAAGGCCCGAAGGATACAACCTGAA
GGATGAAGAGGGGAAACTTAAGGACCTGTCCACGGTGACGTCACTGCAGGTGCCAGTGCTGAAGCCCATGGATCTGATGGTGGAGGTGAG
CCCTCGGAGGATCTTTGCCAATGGCCACACCTACCACATCAACTCCATCTCCGTCAACAGTGACTGCGAGACCTACATGTCGGCGGATGA
CCTGCGCATCAACCTCTGGCACCTGGCCATCACCGACAGGAGCTTCAACATCGTGGACATCAAGCCGGCCAACATGGAGGACCTTACGGA
GGTGATCACAGCATCTGAGTTCCATCCGCACCACTGCAACCTCTTCGTCTACAGCAGCAGCAAGGGCTCCCTGCGGCTCTGCGACATGCG
GGCAGCTGCCCTGTGTGACAAGCATTCCAAGCCTTTAGCCAGGGCCCTCTGAAGGATGCACCCAACCTCATCTGCACCCCCCATGCTGCA
TGGTACAGCGAGCAGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGAGATCCGCAGAGCCATCACAGGCCGGATCCCAGACAGCCTG
AAGAACTGTGTCAACAAGGACCATCTGACAGCCGCCACCCACTGGGCCAGCATGGACCCCGCCGTCGTGCACCCTGAGCTCAATGGGGCT
GCCTATAGGTACCCTCCGGGCGTGGTGGGCGTGGCCCCCACTGGCATCCCAGCTGCTGTGGAAGGTATCGTCCCCAGCGCCATGTCCCTG
TCCCACGGCCTGCCCCCTGTGGCCCACCCGCCCCACGCCCCTTCTCCTGGCCAAACCGTCAAGCCCGAGGCGGATAGAGACCACGCCAGT
GACCAGTTGTAGCCCGGGAGGAGCTCTCCAGCCTCGGCGCCTGGGCAGAGGGCCCGGAAACCCTCGGACCAGAGTGTGTGGAGGAGGCAT
CTGTGTGGTGGCCCTGGCACTGCAGAGACTGGTCCGGGCTGTCAGGAGGCGGGAGGGGGCAGCGCTGGGCCTCGTGTCGCTTGTCGTCGT
CCGTCCTGTGGGCGCTCTGCCCTGTGTCCTTCGCGTTCCTCGTTAAGCAGAAGAAGTCAGTAGTTATTCTCCCATGAACGTTCTTGTCTG
TGTACAGTTTTTAGAACATTACAAAGGATCTGTTTGCTTAGCTGTCAACAAAAAGAAAACCTGAAGGAGCATTTGGAAGTCAATTTGAGG
TTTTTTTTTTTGTTTTTTTTTTTTTTGTATGTTGGAACGTGCCCCAGAATGAGGCAGTTGGCAAACTTCTCAGGACAATGAATCCTTCCC
GTTTTTCTTTTTATGCCACACAGTGCATTGTTTTTTCTACCTGCTTGTCTTATTTTTAGAATAATTTAGAAAAACAAAACAAAGGCTGTT
TTTCCTAATTTTGGCATGAACCCCCCCTTGTTCCAAATGAAGACGGCATCACGAAGCAGCTCCAAAAGGAAAAGCTTGGGCGGTGCCCAG
CGTGCCCGCTGCCCATCGACGTCTGTCCTGGGGACGTGGAGGGTGGCAGCGTCCCCGCCTGCACCAGTGCCGTCCTGCTGATGTGGTAGG

>In-frame_PPP2R2C_ENST00000507294_chr4_6349573_-_CTBP1_ENST00000382952_chr4_1207393_-_2194nt
ATCATTCAAAGGATTCCTGCGGTGGTGCAGAGCTGCGGCAAAGGGCCCTCGCCCGTGGGGTTCACTCTCATCACCCAGAAGCAGGGAGAA
GGGCCTGCGGCTGCAGGCCTGGCTGCCACACCGGCCTCCAGACAACACACAGCAGAAGTAAAATAGAAAGAAGACCTTTTTTGAAATGAC
CTGTGTTAGTCACCTCTCTCAGGATGCGTGAGGCGGACACGTTGAGGCCACCTCAGCTGATGGAAGTTTCCGCTGACATCATCTCTACCG
TTGAGTTCAACCACACGGGAGAGCTGCTGGCCACAGGTGACAAGGGCGGCCGGGTCGTCATCTTCCAGCGGGAACCAGAGAGTAAAAATG
CGCCCCACAGCCAGGGCGAATACGACGTGTACAGCACTTTCCAGAGCCACGAGCCGGAGTTTGACTATCTCAAGAGCCTGGAGATAGAGG
AGAAGATCAACAAGATCAAGTGGCTCCCACAGCAGAACGCCGCCCACTCACTCCTGTCCACCAACGATAAAACTATCAAATTATGGAAGA
TTACCGAACGAGATAAAAGGCCCGAAGGATACAACCTGAAGGATGAAGAGGGGAAACTTAAGGACCTGTCCACGGTGACGTCACTGCAGG
TGCCAGTGCTGAAGCCCATGGATCTGATGGTGGAGGTGAGCCCTCGGAGGATCTTTGCCAATGGCCACACCTACCACATCAACTCCATCT
CCGTCAACAGTGACTGCGAGACCTACATGTCGGCGGATGACCTGCGCATCAACCTCTGGCACCTGGCCATCACCGACAGGAGCTTCAACA
TCGTGGACATCAAGCCGGCCAACATGGAGGACCTTACGGAGGTGATCACAGCATCTGAGTTCCATCCGCACCACTGCAACCTCTTCGTCT
ACAGCAGCAGCAAGGGCTCCCTGCGGCTCTGCGACATGCGGGCAGCTGCCCTGTGTGACAAGCATTCCAAGCCTTTAGCCAGGGCCCTCT
GAAGGATGCACCCAACCTCATCTGCACCCCCCATGCTGCATGGTACAGCGAGCAGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGA
GATCCGCAGAGCCATCACAGGCCGGATCCCAGACAGCCTGAAGAACTGTGTCAACAAGGACCATCTGACAGCCGCCACCCACTGGGCCAG
CATGGACCCCGCCGTCGTGCACCCTGAGCTCAATGGGGCTGCCTATAGGTACCCTCCGGGCGTGGTGGGCGTGGCCCCCACTGGCATCCC
AGCTGCTGTGGAAGGTATCGTCCCCAGCGCCATGTCCCTGTCCCACGGCCTGCCCCCTGTGGCCCACCCGCCCCACGCCCCTTCTCCTGG
CCAAACCGTCAAGCCCGAGGCGGATAGAGACCACGCCAGTGACCAGTTGTAGCCCGGGAGGAGCTCTCCAGCCTCGGCGCCTGGGCAGAG
GGCCCGGAAACCCTCGGACCAGAGTGTGTGGAGGAGGCATCTGTGTGGTGGCCCTGGCACTGCAGAGACTGGTCCGGGCTGTCAGGAGGC
GGGAGGGGGCAGCGCTGGGCCTCGTGTCGCTTGTCGTCGTCCGTCCTGTGGGCGCTCTGCCCTGTGTCCTTCGCGTTCCTCGTTAAGCAG
AAGAAGTCAGTAGTTATTCTCCCATGAACGTTCTTGTCTGTGTACAGTTTTTAGAACATTACAAAGGATCTGTTTGCTTAGCTGTCAACA
AAAAGAAAACCTGAAGGAGCATTTGGAAGTCAATTTGAGGTTTTTTTTTTTGTTTTTTTTTTTTTTGTATGTTGGAACGTGCCCCAGAAT
GAGGCAGTTGGCAAACTTCTCAGGACAATGAATCCTTCCCGTTTTTCTTTTTATGCCACACAGTGCATTGTTTTTTCTACCTGCTTGTCT
TATTTTTAGAATAATTTAGAAAAACAAAACAAAGGCTGTTTTTCCTAATTTTGGCATGAACCCCCCCTTGTTCCAAATGAAGACGGCATC
ACGAAGCAGCTCCAAAAGGAAAAGCTTGGGCGGTGCCCAGCGTGCCCGCTGCCCATCGACGTCTGTCCTGGGGACGTGGAGGGTGGCAGC
GTCCCCGCCTGCACCAGTGCCGTCCTGCTGATGTGGTAGGCTAGCAATATTTTGGTTAAAATCATGTTTGTGACTGTAACCATTTGTATG

>In-frame_PPP2R2C_ENST00000507294_chr4_6349573_-_CTBP1_ENST00000290921_chr4_1207393_-_2194nt
ATCATTCAAAGGATTCCTGCGGTGGTGCAGAGCTGCGGCAAAGGGCCCTCGCCCGTGGGGTTCACTCTCATCACCCAGAAGCAGGGAGAA
GGGCCTGCGGCTGCAGGCCTGGCTGCCACACCGGCCTCCAGACAACACACAGCAGAAGTAAAATAGAAAGAAGACCTTTTTTGAAATGAC
CTGTGTTAGTCACCTCTCTCAGGATGCGTGAGGCGGACACGTTGAGGCCACCTCAGCTGATGGAAGTTTCCGCTGACATCATCTCTACCG
TTGAGTTCAACCACACGGGAGAGCTGCTGGCCACAGGTGACAAGGGCGGCCGGGTCGTCATCTTCCAGCGGGAACCAGAGAGTAAAAATG
CGCCCCACAGCCAGGGCGAATACGACGTGTACAGCACTTTCCAGAGCCACGAGCCGGAGTTTGACTATCTCAAGAGCCTGGAGATAGAGG
AGAAGATCAACAAGATCAAGTGGCTCCCACAGCAGAACGCCGCCCACTCACTCCTGTCCACCAACGATAAAACTATCAAATTATGGAAGA
TTACCGAACGAGATAAAAGGCCCGAAGGATACAACCTGAAGGATGAAGAGGGGAAACTTAAGGACCTGTCCACGGTGACGTCACTGCAGG
TGCCAGTGCTGAAGCCCATGGATCTGATGGTGGAGGTGAGCCCTCGGAGGATCTTTGCCAATGGCCACACCTACCACATCAACTCCATCT
CCGTCAACAGTGACTGCGAGACCTACATGTCGGCGGATGACCTGCGCATCAACCTCTGGCACCTGGCCATCACCGACAGGAGCTTCAACA
TCGTGGACATCAAGCCGGCCAACATGGAGGACCTTACGGAGGTGATCACAGCATCTGAGTTCCATCCGCACCACTGCAACCTCTTCGTCT
ACAGCAGCAGCAAGGGCTCCCTGCGGCTCTGCGACATGCGGGCAGCTGCCCTGTGTGACAAGCATTCCAAGCCTTTAGCCAGGGCCCTCT
GAAGGATGCACCCAACCTCATCTGCACCCCCCATGCTGCATGGTACAGCGAGCAGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGA
GATCCGCAGAGCCATCACAGGCCGGATCCCAGACAGCCTGAAGAACTGTGTCAACAAGGACCATCTGACAGCCGCCACCCACTGGGCCAG
CATGGACCCCGCCGTCGTGCACCCTGAGCTCAATGGGGCTGCCTATAGGTACCCTCCGGGCGTGGTGGGCGTGGCCCCCACTGGCATCCC
AGCTGCTGTGGAAGGTATCGTCCCCAGCGCCATGTCCCTGTCCCACGGCCTGCCCCCTGTGGCCCACCCGCCCCACGCCCCTTCTCCTGG
CCAAACCGTCAAGCCCGAGGCGGATAGAGACCACGCCAGTGACCAGTTGTAGCCCGGGAGGAGCTCTCCAGCCTCGGCGCCTGGGCAGAG
GGCCCGGAAACCCTCGGACCAGAGTGTGTGGAGGAGGCATCTGTGTGGTGGCCCTGGCACTGCAGAGACTGGTCCGGGCTGTCAGGAGGC
GGGAGGGGGCAGCGCTGGGCCTCGTGTCGCTTGTCGTCGTCCGTCCTGTGGGCGCTCTGCCCTGTGTCCTTCGCGTTCCTCGTTAAGCAG
AAGAAGTCAGTAGTTATTCTCCCATGAACGTTCTTGTCTGTGTACAGTTTTTAGAACATTACAAAGGATCTGTTTGCTTAGCTGTCAACA
AAAAGAAAACCTGAAGGAGCATTTGGAAGTCAATTTGAGGTTTTTTTTTTTGTTTTTTTTTTTTTTGTATGTTGGAACGTGCCCCAGAAT
GAGGCAGTTGGCAAACTTCTCAGGACAATGAATCCTTCCCGTTTTTCTTTTTATGCCACACAGTGCATTGTTTTTTCTACCTGCTTGTCT
TATTTTTAGAATAATTTAGAAAAACAAAACAAAGGCTGTTTTTCCTAATTTTGGCATGAACCCCCCCTTGTTCCAAATGAAGACGGCATC
ACGAAGCAGCTCCAAAAGGAAAAGCTTGGGCGGTGCCCAGCGTGCCCGCTGCCCATCGACGTCTGTCCTGGGGACGTGGAGGGTGGCAGC
GTCCCCGCCTGCACCAGTGCCGTCCTGCTGATGTGGTAGGCTAGCAATATTTTGGTTAAAATCATGTTTGTGACTGTAACCATTTGTATG


Top

FusionGenePPI for PPP2R2C_CTBP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPP2R2CARL2, TCP1, CCT2, PPP2R1A, CCT6A, CCT5, CCT7, CCT4, CCT8, CCT3, PPP2CA, PPP2R1B, CDCA4, BAG2, PPP2R2B, SLC25A3, HSPD1, BLNK, POLR3A, SIK2, IQGAP1, STRN, STRN3, STRN4, ZCCHC8, PDCL, SKA1, RBM7, ZNF746, SKA3, FAM122B, DCAF10, IER5, MTCL1, FAM122A, SERTAD4, REPIN1, ZNF114, KNG1CTBP1PNN, IKZF1, SMAD6, RBBP8, TGIF1, NRIP1, MDM2, HDAC1, HDAC3, HDAC4, HDAC5, HDAC9, BRCA1, HDAC2, KAT2B, GEMIN2, TBP, GTF2B, FOXP1, FOXP2, KMT2A, CBX4, MECOM, IKZF4, CTBP2, ZEB1, ACTL6B, HTT, TBL1X, ZNF217, RCOR1, SATB1, CTBP1, TCF4, LCOR, TP53, HIC1, EHMT2, EHMT1, WIZ, APC, PLK1, TUBG1, HSD11B2, TCF7L2, KDM1A, CREBBP, EP300, KAT2A, SP1, RREB1, CDYL, UBE2I, BCORL1, SERPINH1, BCL3, AKT1, HIST3H3, SPEN, ZBP1, SOBP, ZNF219, LCORL, CHD3, RBBP5, CTNNA1, SOX2, ELAVL1, ZEB2, TERF2IP, TERF2, TFAP4, ATXN1L, BCL6, NCOR2, ECT2, CTNNB1, KLF4, DNMT1, RUNX1, BAG3, THAP11, HEMGN, NME2, ORC4, ARNT2, NOL4L, KLF12, MARCH10, CDC23, FUNDC1, IKZF2, KLF3, LNX1, PIAS2, RAI2, RNF111, ZBTB18, CEP68, NOL4, DGCR6, SNRPN, CRY2, HOXB5, PRKAA1, MAPK9, PLCB1, BCAS3, TSHZ3, DMRTB1, EGFR, HIC2, PRDM2, ZNF516, DYRK1A, TRPS1, C10orf12, BCOR, FBXO11, RCOR2, RCOR3, C2orf44, RBL1, INA, RB1, E2F7, TRMT61B, FOXK1, C15orf39, AMPD2, TOR2A, ADSS, ATIC, CARM1, CTH, ECHS1, FKBP1A, GAPDH, DUT, HYI, SSNA1, WDR1, NTRK1, MED23, OFD1, FBF1, KCNIP3, KLF8, NFATC1, NFATC2, MTMR7, RBM14-RBM4, IGFBP1, CHD4, NISCH, KIAA0430, HELZ, PCGF5, SOWAHA, PAN2, EIF4ENIF1, FANCC, FANCA, FANCF, FANCG, FANCL, FANCE, FANCD2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPP2R2C_CTBP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPP2R2C_CTBP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePPP2R2CC0005586Bipolar Disorder2PSYGENET
HgenePPP2R2CC0013990Pathological accumulation of air in tissues1CTD_human
TgeneCTBP1C0009404Colorectal Neoplasms1CTD_human