FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28366

FusionGeneSummary for PPP1R2_GMNC

check button Fusion gene summary
Fusion gene informationFusion gene name: PPP1R2_GMNC
Fusion gene ID: 28366
HgeneTgene
Gene symbol

PPP1R2

GMNC

Gene ID

5504

647309

Gene nameprotein phosphatase 1 regulatory inhibitor subunit 2geminin coiled-coil domain containing
SynonymsIPP-2|IPP2|PPP1R2AGEMC1
Cytomap

3q29

3q28

Type of geneprotein-codingprotein-coding
Descriptionprotein phosphatase inhibitor 2phosphoprotein phosphatasegeminin coiled-coil domain-containing protein 1
Modification date2018052320180329
UniProtAcc

P41236

A6NCL1

Ensembl transtripts involved in fusion geneENST00000328432, ENST00000442080, 
ENST00000479491, 
Fusion gene scores* DoF score3 X 2 X 3=181 X 1 X 1=1
# samples 31
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: PPP1R2 [Title/Abstract] AND GMNC [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDHNSCTCGA-CQ-A4CB-01APPP1R2chr3

195269727

-GMNCchr3

190578647

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000328432ENST00000442080PPP1R2chr3

195269727

-GMNCchr3

190578647

-
5CDS-intronENST00000328432ENST00000479491PPP1R2chr3

195269727

-GMNCchr3

190578647

-

Top

FusionProtFeatures for PPP1R2_GMNC


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPP1R2

P41236

GMNC

A6NCL1

Inhibitor of protein-phosphatase 1. Regulator of DNA replication. Promotes initiation ofchromosomal DNA replication by mediating TOPBP1- and CDK2-dependent recruitment of CDC45L onto replication origins (Bysimilarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePPP1R2chr3:195269727chr3:190578647ENST00000328432-1612_1740206RegionRequired for binding PPP1CC
TgeneGMNCchr3:195269727chr3:190578647ENST00000442080-0582_1191335Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePPP1R2chr3:195269727chr3:190578647ENST00000328432-16147_15040206RegionRequired for binding PPP1CC catalytic center%2C displacing metal ions and inhibition of PPP1CC catalytic activity
HgenePPP1R2chr3:195269727chr3:190578647ENST00000328432-1643_5540206RegionRequired for binding PPP1CC


Top

FusionGeneSequence for PPP1R2_GMNC


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPP1R2_ENST00000328432_chr3_195269727_-_GMNC_ENST00000442080_chr3_190578647_-_374aa
MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELRTPFCLAKTSTL_EARAIIARIPLQRQNLVLTFPRRLGSLSGLLVSWTTE
SSNKHHRHRNHSVTQIFLFRTCAHGKRLSFPLSSTEISSCKIPWCRRKKNSPGYTKRIITSDNT_ILLWLNVLKKRPRNCSHLMSSPKHM
ENSGRGRENPKSKDTLLLRFPIPKMPKETSLVNLLTVKNKLGPLWIPGSFKHLG_KTLTLSMTPHQLTTVPSHLIPEESPAHFPSFRMMQ
LIIKISPERICQLTIEVTEQPPCTALPLMEKISTSFLNFQIPQWG_KLFLTILLMCHPTRQRWHFPHP_ALIVM_KLIPSTRDKPLCVEM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPP1R2_ENST00000328432_chr3_195269727_-_GMNC_ENST00000442080_chr3_190578647_-_1124nt
ATGGCGGCCTCGACGGCCTCGCACCGGCCCATCAAGGGGATCTTGAAGAACAAGACCTCTACGACTTCCTCTATGGTGGCGTCGGCCGAA
CAGCCCCGCGGGAATGTCGACGAGGAGCTGAGAACACCATTCTGCCTTGCCAAGACCAGTACTTTGTAGGAGGCCAGAGCTATAATTGCC
CGTATTCCACTACAACGTCAGAATCTAGTGTTGACGTTTCCACGGAGACTTGGGTCTCTTTCTGGGCTGCTGGTCTCCTGGACAACAGAG
AGCTCCAACAAGCACCACAGGCACAGGAATCATTCAGTGACTCAAATTTTCCTCTTCCGGACTTGTGCTCATGGGAAGAGGCTCAGCTTT
CCTCTCAGCTCTACAGAAATAAGCAGCTGCAAGATACCCTGGTGCAGAAGGAAGAAGAACTCGCCAGGTTACACGAAGAGAATAATCACC
TCAGACAATACCTGAATTCTGCTTTGGTTAAATGTCTTGAAGAAAAGGCCAAGAAATTGCTCTCATCTGATGAGTTCTCCAAAGCATATG
GAAAATTCAGGAAGGGGAAGAGAAAATCCAAAGAGCAAAGATACTCTCCTGCTGAGATTCCCCATCCCAAAAATGCCAAAAGAAACCTCT
CTAGTGAATTTGCTAACTGTGAAGAACAAGCTGGGCCCCCTGTGGATCCCTGGGTCCTTCAAACACTTGGGTTAAAAGACCTTGACACTA
TCGATGACACCTCATCAGCTAACTACAGTGCCCTCGCATCTCATCCCAGAAGAGTCGCCAGCACATTTTCCCAGTTTCCGGATGATGCAG
TTGATTATAAAAATATCCCCAGAGAGGATATGCCAATTGACTATAGAGGTGACAGAACAACCCCCTTGCACAGCACTGCCACTCATGGAG
AAGATTTCCACATCCTTTCTCAACTTTCAAATCCCCCAGTGGGGCTGAAAACTCTTCCTTACTATACTGCTCATGTGTCACCCAACAAGA
CAGAGATGGCATTTTCCACATCCCTGAGCCCTCATTGTAATGTGAAAACTCATTCCTTCCACCAGGGACAAGCCTTTGTGCGTCGAGATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPP1R2_ENST00000328432_chr3_195269727_-_GMNC_ENST00000442080_chr3_190578647_-_3902nt
GTTCTCGCCCCGCCCTCTCCCCGCCTCCTCCCTAGATATCGCGAGAGGGCGGGTCCGCTTGGCTTCGGCGTCGCGTCGCTCCTGCGCTGG
AGCTCTAGGCCGGCGTCTCTCCGCGAGCCGCGGGTCAAGTGGCAGTGGCTAAGGGTGCGCGAGTAGCCGCCACCCGTTCGGCGTTGGCTC
TGGCGTCGGGGTCGTTGTGTCGTGACAACCGCTGCGGTAGCCGTTTCCGAGGCAGCAGTTGCGGCCGCTTTAGCCCTGAGCGGGATCTGC
GGCTGCCTGCGAGTCTCTGCTGTGCCGACCCTTCTCTTCGCGGACCCCACGCCAAGCAGCGACCCTGAGCCGACAGCCGGAGCGCCCGGC
AATGGCGGCCTCGACGGCCTCGCACCGGCCCATCAAGGGGATCTTGAAGAACAAGACCTCTACGACTTCCTCTATGGTGGCGTCGGCCGA
ACAGCCCCGCGGGAATGTCGACGAGGAGCTGAGAACACCATTCTGCCTTGCCAAGACCAGTACTTTGTAGGAGGCCAGAGCTATAATTGC
CCGTATTCCACTACAACGTCAGAATCTAGTGTTGACGTTTCCACGGAGACTTGGGTCTCTTTCTGGGCTGCTGGTCTCCTGGACAACAGA
GAGCTCCAACAAGCACCACAGGCACAGGAATCATTCAGTGACTCAAATTTTCCTCTTCCGGACTTGTGCTCATGGGAAGAGGCTCAGCTT
TCCTCTCAGCTCTACAGAAATAAGCAGCTGCAAGATACCCTGGTGCAGAAGGAAGAAGAACTCGCCAGGTTACACGAAGAGAATAATCAC
CTCAGACAATACCTGAATTCTGCTTTGGTTAAATGTCTTGAAGAAAAGGCCAAGAAATTGCTCTCATCTGATGAGTTCTCCAAAGCATAT
GGAAAATTCAGGAAGGGGAAGAGAAAATCCAAAGAGCAAAGATACTCTCCTGCTGAGATTCCCCATCCCAAAAATGCCAAAAGAAACCTC
TCTAGTGAATTTGCTAACTGTGAAGAACAAGCTGGGCCCCCTGTGGATCCCTGGGTCCTTCAAACACTTGGGTTAAAAGACCTTGACACT
ATCGATGACACCTCATCAGCTAACTACAGTGCCCTCGCATCTCATCCCAGAAGAGTCGCCAGCACATTTTCCCAGTTTCCGGATGATGCA
GTTGATTATAAAAATATCCCCAGAGAGGATATGCCAATTGACTATAGAGGTGACAGAACAACCCCCTTGCACAGCACTGCCACTCATGGA
GAAGATTTCCACATCCTTTCTCAACTTTCAAATCCCCCAGTGGGGCTGAAAACTCTTCCTTACTATACTGCTCATGTGTCACCCAACAAG
ACAGAGATGGCATTTTCCACATCCCTGAGCCCTCATTGTAATGTGAAAACTCATTCCTTCCACCAGGGACAAGCCTTTGTGCGTCGAGAT
GAGGAGGGAGGCTGGAAGTTTACCTGGGTCCCTAAGCAGTCTTAGTGACCCCTCTTTTATCACAAAGCACTGCCACGAACTCTGTTTACA
AAGACCTCTCTTGCACTTGAATTTGACTATGTGGAACACAGAAGCTGTTGCTTAGACTGTCTCCTGCCACTTTAAATGTCACTCTCAATT
ACCCACTTAAATCTGCAGGGAATGGCTTCCAAGAATCCATAATGAAACGTGTCCGCGCTTCTTTTACCTAAATTTGACTTGTTTACACAC
CAATACCTGCTATTGACATCCTCTCTTTGCCCTATACTTGATAAGGTATTTTCCACTCACTTCTATATTCCTTTAAGACCTAGATACATT
TTTCCAATTTTAACCAGTTTAACAGATTTTCCTCTTTTAAGTAGTTGAAATATTCACAGCCCTTTTACTTTTCTCCCTTTGTCATTTCTG
AAAACTGTCTTTAGAATGAGCCCTATTTTTGCTTCAAGTACTTGCTACTGCATGTTCAAATAGCTGAGGGTGGGGTTGAAACAAGTGTCT
TTGCCCATCACCACTACTCCTGAAGACATAATGTGGATGTGTGTAGCATTATGTTCATGGCAGTTCAAAAAGTTCAGTGCCCCATAGTGG
CATTGACAAAGCCTCTTAAAACAACTGTAACTCCACTAATAATCAATATCACAGATAAACTTTAAAATTACAAAGAATTTAAATTATTTT
TAAATGCCTCATGATGTATCAGCTTCTATATGTACCCAGCATCATTTCTTTAACCAACATGACTCCAAGAAGAACATTTTGAGGGACTGT
GGTAACAAAACTAGTCATCATCTGCAACTACCCAGATGCTGACAAACTCCTATTGCTGAAAATAGACTAACCTAGCTCAGCCATTGTCTC
ATTCATTCATTCATTCGCGTATTCATTTTTTCATTGATCAGTCCACCCAAGAAATCTGTAGAATACCTAATGCCTACTTTGTACCAGGCA
CTATGCTATGTGATGGTGATAAAATACAAGCAATTTAGACACTGTGGCCACCATCATGAGACTTAGACCTACTCATCTGCTATGACTTTG
CGAAAACGACTTCCCTTTTGTGAAGGTTCAGTTTCCCAACTGTAGAATACAGAAGTTGGACTAGATAATTACTAATATTCTATGAATTGA
GGCTGGGTCCTATCAGATTTACTCCAACATGGCAGTTTCAGGTCACTGAAGAAACTAAAGAGAAGTCTTTAGATAGGCACTGCAAGTATT
AGGTAGGGTAAACTTTATGTACAATTAATAAAATTCAAAAACATAAGTCATTTGAAGTTAACATTAGAAATCATTGCTCTGATCACAGTA
CTCTTTTTCTAGAGCCCATTTTGCAGTTAACTCGGCGTAACTGTGTAAGAATAATTTGCCTCTAAAAATAGATACATATTAATTTTTAAA
TAAGTGCGGATAGATTGCATATAAATATTGCTATCAAGGACTTCATATTTCTAAATTTGAAACAATATATTTTCAGTGCTTGTGCTAGTT
TTCTTCTTTCCCATCTCTCAAGACCCCTATCATTCCCAGAATAATTTGCACATCCTGCATGTGCACCTATGTTTTTTGGACAAACTTCAA
TTAATGATGAAATCTTTCATGTTGAAACCTGTTCTCATTTTTCTCTTTTCCACATCTCAATAAGTCATCTTGCACAATCAATATCTCGTA
GGTCAACTGTGTTGGTTAGGATTCTTTGTAACAGAGACATGCCTTTCATTGTTGTTTCTGTTTGGTTGTTGCTTTATTTTGGTGATGTAA
GCAAAGGGTCTGTTTTATAAAGTTTTGTTGCCACCCACTTTTAAAAATAATTTATGAAGAAAATCCAATATAGTAATTAATATTACTCTC
TGGAGTACTTTAAGAAGTAGAACACATTCCATTTTCTAAAAAATAAAATAAAATAAATAACTGTGCCTTTTACATTCTGGTATCTGGGCC
CCTGGTCGGTGAAATTTGTCGCTTTTTAGAATAAGAGATTTAAGGATTCGAATTATTGTACTTTATGACACTAGGAATTGAGAAAGTAAT
ATAACTAATTTTGAAAGTCTAATAATCAAGCTGTAAAAGGAAATGTATGAGTTAACAAATATTTATTTTGCATTCTTTGTGTGCCTTATC
ATGTGTTAAGTACCATGAGGGTACACCCAGGCTTAGCACAATGCATTTGGTATACAAAACCATGTAAAATGTCATAGCTTTTGATAGCTT
TTAAATGAAACTTAATTTTGGCCCAGTTTAAAGATATTACCGAACATTTGGGATAAAATGTGATGGTTTCCTGGCTTCTATCATGGACGA
TGTTATGGAAGACAATTACCACGTTTTTGAAATCATGTCTATAAATATTTAATATCCATTTAAATTATGTATAGAAAATTATTTTGTTCA


Top

FusionGenePPI for PPP1R2_GMNC


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPP1R2PPP1CB, PPP1R9B, LMTK2, NEK2, PPP1CA, ELAVL1, TERF2IP, TINF2, PPP1CC, CIAPIN1, GSK3A, GSK3B, GINS4, ISOC1, DCPS, G6PD, MSN, NAE1, NCDN, NSFL1C, PDHA1, PDIA4, PRCP, PROSC, RAP1GDS1, TATDN1, TNFAIP8, TUFM, VCL, YWHAE, ZNF622, TP53BP2, PPP1R3A, PPP1R11, KDM2A, PDIA5, POLR2G, PPP1R7, SFN, SLK, SULT1C3, HIST1H2BG, EWSR1, THOC7, GTF2H5GMNC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPP1R2_GMNC


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPP1R2_GMNC


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource