FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28333

FusionGeneSummary for PPP1R13L_OPA3

check button Fusion gene summary
Fusion gene informationFusion gene name: PPP1R13L_OPA3
Fusion gene ID: 28333
HgeneTgene
Gene symbol

PPP1R13L

OPA3

Gene ID

10848

80207

Gene nameprotein phosphatase 1 regulatory subunit 13 likeOPA3, outer mitochondrial membrane lipid metabolism regulator
SynonymsIASPP|NKIP1|RAI|RAI4MGA3
Cytomap

19q13.32

19q13.32

Type of geneprotein-codingprotein-coding
DescriptionrelA-associated inhibitorNFkB interacting protein 1PPP1R13B-like proteininhibitor of ASPP proteininhibitor of apoptosis stimulating protein of p53protein iASPPprotein phosphatase 1, regulatory (inhibitor) subunit 13 likeretinoic acid induced 4optic atrophy 3 proteinOptic atrophy 3 (Iraqi-Jewish 'optic atrophy plus')optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)
Modification date2018052220180523
UniProtAcc

Q8WUF5

Q9H6K4

Ensembl transtripts involved in fusion geneENST00000360957, ENST00000418234, 
ENST00000323060, ENST00000263275, 
ENST00000544371, 
Fusion gene scores* DoF score4 X 4 X 4=648 X 7 X 4=224
# samples 49
** MAII scorelog2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/224*10)=-1.31550182572793
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PPP1R13L [Title/Abstract] AND OPA3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-78-8640-01APPP1R13Lchr19

45895138

-OPA3chr19

46032714

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000360957ENST00000323060PPP1R13Lchr19

45895138

-OPA3chr19

46032714

-
5CDS-intronENST00000360957ENST00000263275PPP1R13Lchr19

45895138

-OPA3chr19

46032714

-
5CDS-intronENST00000360957ENST00000544371PPP1R13Lchr19

45895138

-OPA3chr19

46032714

-
In-frameENST00000418234ENST00000323060PPP1R13Lchr19

45895138

-OPA3chr19

46032714

-
5CDS-intronENST00000418234ENST00000263275PPP1R13Lchr19

45895138

-OPA3chr19

46032714

-
5CDS-intronENST00000418234ENST00000544371PPP1R13Lchr19

45895138

-OPA3chr19

46032714

-

Top

FusionProtFeatures for PPP1R13L_OPA3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPP1R13L

Q8WUF5

OPA3

Q9H6K4

Regulator that plays a central role in regulation ofapoptosis and transcription via its interaction with NF-kappa-Band p53/TP53 proteins. Blocks transcription of HIV-1 virus byinhibiting the action of both NF-kappa-B and SP1. Also inhibitsp53/TP53 function, possibly by preventing the association betweenp53/TP53 and ASPP1 or ASPP2, and therefore suppressing thesubsequent activation of apoptosis. {ECO:0000269|PubMed:10336463,ECO:0000269|PubMed:12134007, ECO:0000269|PubMed:12524540,ECO:0000269|PubMed:15489900}. May play some role in mitochondrial processes.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000360957-813407_444605829Compositional biasNote=Gln-rich
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000360957-81354_602605829Compositional biasNote=Pro-rich
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000418234-813407_444605829Compositional biasNote=Gln-rich
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000418234-81354_602605829Compositional biasNote=Pro-rich
TgeneOPA3chr19:45895138chr19:46032714ENST00000263275-02103_163-19180Coiled coilOntology_term=ECO:0000255
TgeneOPA3chr19:45895138chr19:46032714ENST00000323060-02103_16347181Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000360957-813758_820605829DomainSH3
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000418234-813758_820605829DomainSH3
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000360957-813659_691605829RepeatNote=ANK 1
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000360957-813692_724605829RepeatNote=ANK 2
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000418234-813659_691605829RepeatNote=ANK 1
HgenePPP1R13Lchr19:45895138chr19:46032714ENST00000418234-813692_724605829RepeatNote=ANK 2


Top

FusionGeneSequence for PPP1R13L_OPA3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPP1R13L_ENST00000360957_chr19_45895138_-_OPA3_ENST00000323060_chr19_46032714_-_738aa
MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQAGPPSRPPRYSSSSIPEPFGSRGSPRKAAT
DGADTPFGRSESAPTLHPYSPLSPKGRPSSPRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGR
AGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDLTLRRRPPKAWNESDLDVAYEKKPSQTASTE
RLDVFARPASPSLQLLPWRESSLDGLGGTGKDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQ
PRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQPQPQLPPQPQTQPQTPTPAPQHPQQTWPPVN
EGPPKPPTELEPEPEIEGLLTPVLEAGDVDEGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHK
KQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPEQPQSMCTTGWRCGPKCASWVSMPLPSSR_T
RVQPPSWARSCWARASSSSPPAAA_CWSIGATSCSSAARKRSDVLPGRRCGARWATWGWRSRSCRRRCRRRRRSSPWRSCALSCRRCEPT

>In-frame_PPP1R13L_ENST00000418234_chr19_45895138_-_OPA3_ENST00000323060_chr19_46032714_-_738aa
MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQAGPPSRPPRYSSSSIPEPFGSRGSPRKAAT
DGADTPFGRSESAPTLHPYSPLSPKGRPSSPRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGR
AGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDLTLRRRPPKAWNESDLDVAYEKKPSQTASTE
RLDVFARPASPSLQLLPWRESSLDGLGGTGKDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQ
PRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQPQPQLPPQPQTQPQTPTPAPQHPQQTWPPVN
EGPPKPPTELEPEPEIEGLLTPVLEAGDVDEGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHK
KQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPEQPQSMCTTGWRCGPKCASWVSMPLPSSR_T
RVQPPSWARSCWARASSSSPPAAA_CWSIGATSCSSAARKRSDVLPGRRCGARWATWGWRSRSCRRRCRRRRRSSPWRSCALSCRRCEPT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPP1R13L_ENST00000360957_chr19_45895138_-_OPA3_ENST00000323060_chr19_46032714_-_2216nt
ATGGACAGCGAGGCATTCCAGAGCGCGCGGGACTTTCTGGACATGAACTTCCAGTCGCTGGCCATGAAACACATGGATCTGAAGCAGATG
GAGCTGGACACGGCGGCGGCCAAGGTGGATGAACTGACCAAGCAGCTGGAGTCGCTGTGGTCAGACTCTCCCGCGCCTCCTGGCCCGCAG
GCCGGACCCCCTTCTAGGCCGCCCCGGTACAGCTCCAGCTCGATCCCTGAGCCCTTCGGCAGCCGAGGGTCCCCCCGGAAGGCGGCCACC
GACGGCGCAGACACCCCGTTCGGACGATCAGAGAGTGCCCCAACCCTACACCCCTACAGCCCGCTGTCCCCCAAGGGACGGCCGTCGTCG
CCGCGCACCCCGCTCTACCTGCAGCCGGACGCCTACGGCAGCCTGGACCGCGCGACCTCGCCCCGGCCCCGCGCCTTCGATGGCGCAGGC
AGCTCCCTCGGCCGTGCGCCCTCCCCGCGGCCCGGGCCAGGCCCGCTCCGCCAGCAGGGTCCCCCCACGCCTTTCGACTTCCTGGGCCGC
GCAGGCTCCCCCCGCGGCAGCCCCCTGGCGGAGGGGCCCCAGGCCTTCTTCCCCGAGCGTGGGCCGTCACCGCGCCCCCCTGCCACAGCC
TACGACGCGCCAGCGTCCGCCTTCGGGAGCTCCCTGCTAGGCTCCGGCGGCAGCGCATTCGCCCCGCCTCTGCGCGCGCAAGACGACCTG
ACGCTGCGCCGGCGGCCTCCGAAAGCCTGGAACGAGTCTGACCTGGACGTGGCGTACGAGAAGAAGCCTTCGCAGACAGCGAGCTATGAA
CGCCTGGACGTCTTCGCAAGGCCTGCCTCGCCGAGCCTGCAGCTGTTGCCTTGGAGGGAGAGCAGCCTGGATGGACTGGGGGGCACCGGC
AAGGACAACCTCACTAGCGCCACCCTGCCGCGCAATTACAAGGTCTCTCCTCTGGCCAGCGACCGGCGTTCAGACGCGGGCAGCTACCGG
CGCTCGCTGGGCTCCGCGGGGCCGTCGGGCACTTTGCCTCGCAGCTGGCAGCCCGTCAGCCGCATCCCCATGCCCCCCTCCAGCCCCCAG
CCCCGCGGGGCCCCGCGCCAGCGTCCCATCCCCCTCAGCATGATCTTCAAGCTGCAGAACGCCTTCTGGGAGCACGGGGCCAGCCGCGCC
ATGCTCCCTGGGTCCCCCCTCTTCACCCGAGCACCCCCGCCTAAGCTGCAGCCCCAACCACAACCACAGCCCCAGCCACAATCACAACCA
CAGCCCCAGCTGCCCCCACAGCCCCAGACCCAACCCCAAACCCCTACCCCAGCCCCCCAGCATCCCCAACAGACATGGCCCCCTGTGAAC
GAAGGACCCCCCAAACCCCCCACCGAGCTGGAGCCTGAGCCGGAGATAGAGGGGCTGCTGACACCAGTGCTGGAGGCTGGCGATGTGGAT
GAAGGCCCTGTAGCAAGGCCTCTCAGCCCCACGAGGCTGCAGCCAGCACTGCCACCGGAGGCACAGTCGGTGCCCGAGCTGGAGGAGGTG
GCACGGGTGTTGGCGGAAATTCCCCGGCCCCTCAAACGCAGGGGCTCCATGGAGCAGGCCCCTGCTGTGGCCCTGCCCCCTACCCACAAG
AAACAGTACCAGCAGATCATCAGCCGCCTCTTCCATCGTCATGGGGGGCCAGGGCCCGGGGGGCCGGAGCCAGAGCTGTCCCCCATCACT
GAGGGATCTGAGGCCAGGGCAGGGCCCCCTGCTCCTGCCCCACCAGCTCCCATTCCACCCCCGGCCCCGTCCCAGAGCAGCCCACCAGAG
CAGCCGCAGAGCATGTGTACCACTGGCTGGAGATGCGGACCAAAATGCGCATCATGGGTTTCAATGCCGCTGCCATCAAGCCGCTGAACG
AGGGTGCAGCCGCCGAGCTGGGCGCGGAGCTGCTGGGCGAGGGCATCATCTTCATCACCGCCTGCAGCTGCCTGATGCTGGAGTATTGGC
GCCACCAGTTGCAGCAGCGCCGCAAGGAAAAGGAGCGACGTGTTGCCAGGGAGGCGCTGCGGGGCGAGGTGGGCCACTTGGGGCTGGCGC
TCGAGGAGTTGCAGGCGCAGGTGCAGGCGACGTCGACGCAGCTCGCCCTGGAGGAGCTGCGCGCTCAGCTGCAGGAGGTGCGAGCCCACC

>In-frame_PPP1R13L_ENST00000418234_chr19_45895138_-_OPA3_ENST00000323060_chr19_46032714_-_2216nt
ATGGACAGCGAGGCATTCCAGAGCGCGCGGGACTTTCTGGACATGAACTTCCAGTCGCTGGCCATGAAACACATGGATCTGAAGCAGATG
GAGCTGGACACGGCGGCGGCCAAGGTGGATGAACTGACCAAGCAGCTGGAGTCGCTGTGGTCAGACTCTCCCGCGCCTCCTGGCCCGCAG
GCCGGACCCCCTTCTAGGCCGCCCCGGTACAGCTCCAGCTCGATCCCTGAGCCCTTCGGCAGCCGAGGGTCCCCCCGGAAGGCGGCCACC
GACGGCGCAGACACCCCGTTCGGACGATCAGAGAGTGCCCCAACCCTACACCCCTACAGCCCGCTGTCCCCCAAGGGACGGCCGTCGTCG
CCGCGCACCCCGCTCTACCTGCAGCCGGACGCCTACGGCAGCCTGGACCGCGCGACCTCGCCCCGGCCCCGCGCCTTCGATGGCGCAGGC
AGCTCCCTCGGCCGTGCGCCCTCCCCGCGGCCCGGGCCAGGCCCGCTCCGCCAGCAGGGTCCCCCCACGCCTTTCGACTTCCTGGGCCGC
GCAGGCTCCCCCCGCGGCAGCCCCCTGGCGGAGGGGCCCCAGGCCTTCTTCCCCGAGCGTGGGCCGTCACCGCGCCCCCCTGCCACAGCC
TACGACGCGCCAGCGTCCGCCTTCGGGAGCTCCCTGCTAGGCTCCGGCGGCAGCGCATTCGCCCCGCCTCTGCGCGCGCAAGACGACCTG
ACGCTGCGCCGGCGGCCTCCGAAAGCCTGGAACGAGTCTGACCTGGACGTGGCGTACGAGAAGAAGCCTTCGCAGACAGCGAGCTATGAA
CGCCTGGACGTCTTCGCAAGGCCTGCCTCGCCGAGCCTGCAGCTGTTGCCTTGGAGGGAGAGCAGCCTGGATGGACTGGGGGGCACCGGC
AAGGACAACCTCACTAGCGCCACCCTGCCGCGCAATTACAAGGTCTCTCCTCTGGCCAGCGACCGGCGTTCAGACGCGGGCAGCTACCGG
CGCTCGCTGGGCTCCGCGGGGCCGTCGGGCACTTTGCCTCGCAGCTGGCAGCCCGTCAGCCGCATCCCCATGCCCCCCTCCAGCCCCCAG
CCCCGCGGGGCCCCGCGCCAGCGTCCCATCCCCCTCAGCATGATCTTCAAGCTGCAGAACGCCTTCTGGGAGCACGGGGCCAGCCGCGCC
ATGCTCCCTGGGTCCCCCCTCTTCACCCGAGCACCCCCGCCTAAGCTGCAGCCCCAACCACAACCACAGCCCCAGCCACAATCACAACCA
CAGCCCCAGCTGCCCCCACAGCCCCAGACCCAACCCCAAACCCCTACCCCAGCCCCCCAGCATCCCCAACAGACATGGCCCCCTGTGAAC
GAAGGACCCCCCAAACCCCCCACCGAGCTGGAGCCTGAGCCGGAGATAGAGGGGCTGCTGACACCAGTGCTGGAGGCTGGCGATGTGGAT
GAAGGCCCTGTAGCAAGGCCTCTCAGCCCCACGAGGCTGCAGCCAGCACTGCCACCGGAGGCACAGTCGGTGCCCGAGCTGGAGGAGGTG
GCACGGGTGTTGGCGGAAATTCCCCGGCCCCTCAAACGCAGGGGCTCCATGGAGCAGGCCCCTGCTGTGGCCCTGCCCCCTACCCACAAG
AAACAGTACCAGCAGATCATCAGCCGCCTCTTCCATCGTCATGGGGGGCCAGGGCCCGGGGGGCCGGAGCCAGAGCTGTCCCCCATCACT
GAGGGATCTGAGGCCAGGGCAGGGCCCCCTGCTCCTGCCCCACCAGCTCCCATTCCACCCCCGGCCCCGTCCCAGAGCAGCCCACCAGAG
CAGCCGCAGAGCATGTGTACCACTGGCTGGAGATGCGGACCAAAATGCGCATCATGGGTTTCAATGCCGCTGCCATCAAGCCGCTGAACG
AGGGTGCAGCCGCCGAGCTGGGCGCGGAGCTGCTGGGCGAGGGCATCATCTTCATCACCGCCTGCAGCTGCCTGATGCTGGAGTATTGGC
GCCACCAGTTGCAGCAGCGCCGCAAGGAAAAGGAGCGACGTGTTGCCAGGGAGGCGCTGCGGGGCGAGGTGGGCCACTTGGGGCTGGCGC
TCGAGGAGTTGCAGGCGCAGGTGCAGGCGACGTCGACGCAGCTCGCCCTGGAGGAGCTGCGCGCTCAGCTGCAGGAGGTGCGAGCCCACC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPP1R13L_ENST00000360957_chr19_45895138_-_OPA3_ENST00000323060_chr19_46032714_-_3906nt
GCTGGAGGAAGCCCCCAGGTGCCAGGATCTGCCCGGATCCGCGCCCGCTCCGGCCGGCACCATGGACAGCGAGGCATTCCAGAGCGCGCG
GGACTTTCTGGACATGAACTTCCAGTCGCTGGCCATGAAACACATGGATCTGAAGCAGATGGAGCTGGACACGGCGGCGGCCAAGGTGGA
TGAACTGACCAAGCAGCTGGAGTCGCTGTGGTCAGACTCTCCCGCGCCTCCTGGCCCGCAGGCCGGACCCCCTTCTAGGCCGCCCCGGTA
CAGCTCCAGCTCGATCCCTGAGCCCTTCGGCAGCCGAGGGTCCCCCCGGAAGGCGGCCACCGACGGCGCAGACACCCCGTTCGGACGATC
AGAGAGTGCCCCAACCCTACACCCCTACAGCCCGCTGTCCCCCAAGGGACGGCCGTCGTCGCCGCGCACCCCGCTCTACCTGCAGCCGGA
CGCCTACGGCAGCCTGGACCGCGCGACCTCGCCCCGGCCCCGCGCCTTCGATGGCGCAGGCAGCTCCCTCGGCCGTGCGCCCTCCCCGCG
GCCCGGGCCAGGCCCGCTCCGCCAGCAGGGTCCCCCCACGCCTTTCGACTTCCTGGGCCGCGCAGGCTCCCCCCGCGGCAGCCCCCTGGC
GGAGGGGCCCCAGGCCTTCTTCCCCGAGCGTGGGCCGTCACCGCGCCCCCCTGCCACAGCCTACGACGCGCCAGCGTCCGCCTTCGGGAG
CTCCCTGCTAGGCTCCGGCGGCAGCGCATTCGCCCCGCCTCTGCGCGCGCAAGACGACCTGACGCTGCGCCGGCGGCCTCCGAAAGCCTG
GAACGAGTCTGACCTGGACGTGGCGTACGAGAAGAAGCCTTCGCAGACAGCGAGCTATGAACGCCTGGACGTCTTCGCAAGGCCTGCCTC
GCCGAGCCTGCAGCTGTTGCCTTGGAGGGAGAGCAGCCTGGATGGACTGGGGGGCACCGGCAAGGACAACCTCACTAGCGCCACCCTGCC
GCGCAATTACAAGGTCTCTCCTCTGGCCAGCGACCGGCGTTCAGACGCGGGCAGCTACCGGCGCTCGCTGGGCTCCGCGGGGCCGTCGGG
CACTTTGCCTCGCAGCTGGCAGCCCGTCAGCCGCATCCCCATGCCCCCCTCCAGCCCCCAGCCCCGCGGGGCCCCGCGCCAGCGTCCCAT
CCCCCTCAGCATGATCTTCAAGCTGCAGAACGCCTTCTGGGAGCACGGGGCCAGCCGCGCCATGCTCCCTGGGTCCCCCCTCTTCACCCG
AGCACCCCCGCCTAAGCTGCAGCCCCAACCACAACCACAGCCCCAGCCACAATCACAACCACAGCCCCAGCTGCCCCCACAGCCCCAGAC
CCAACCCCAAACCCCTACCCCAGCCCCCCAGCATCCCCAACAGACATGGCCCCCTGTGAACGAAGGACCCCCCAAACCCCCCACCGAGCT
GGAGCCTGAGCCGGAGATAGAGGGGCTGCTGACACCAGTGCTGGAGGCTGGCGATGTGGATGAAGGCCCTGTAGCAAGGCCTCTCAGCCC
CACGAGGCTGCAGCCAGCACTGCCACCGGAGGCACAGTCGGTGCCCGAGCTGGAGGAGGTGGCACGGGTGTTGGCGGAAATTCCCCGGCC
CCTCAAACGCAGGGGCTCCATGGAGCAGGCCCCTGCTGTGGCCCTGCCCCCTACCCACAAGAAACAGTACCAGCAGATCATCAGCCGCCT
CTTCCATCGTCATGGGGGGCCAGGGCCCGGGGGGCCGGAGCCAGAGCTGTCCCCCATCACTGAGGGATCTGAGGCCAGGGCAGGGCCCCC
TGCTCCTGCCCCACCAGCTCCCATTCCACCCCCGGCCCCGTCCCAGAGCAGCCCACCAGAGCAGCCGCAGAGCATGTGTACCACTGGCTG
GAGATGCGGACCAAAATGCGCATCATGGGTTTCAATGCCGCTGCCATCAAGCCGCTGAACGAGGGTGCAGCCGCCGAGCTGGGCGCGGAG
CTGCTGGGCGAGGGCATCATCTTCATCACCGCCTGCAGCTGCCTGATGCTGGAGTATTGGCGCCACCAGTTGCAGCAGCGCCGCAAGGAA
AAGGAGCGACGTGTTGCCAGGGAGGCGCTGCGGGGCGAGGTGGGCCACTTGGGGCTGGCGCTCGAGGAGTTGCAGGCGCAGGTGCAGGCG
ACGTCGACGCAGCTCGCCCTGGAGGAGCTGCGCGCTCAGCTGCAGGAGGTGCGAGCCCACCTCTGCCTCCGAGACCCGCCGCCTGCACCC
CCAGTTGCGCCGGCGTCCGAGAAATAGGAGGTCTCGGGGCCCTGGTCTTGGAGGTGACTGCTGTCTGGACTGCGAAGTCTCTGTCTTGGC
CTATTCTCCGCACTGTCCCATCCTGGACCGGCCCAGCTGACACCACCCAGTCCTTCGGGGGCGCCGGAGAGATCCTGGGCTGGAGCTGAT
CGAACCTCCCTACTAACCTGCCCAGTGGTACCTTCCACTGGGACTCTCCGCCTCCTGCAGGTGGAACGTTCCAAGAAGGACCCCGCCCTA
TCCCACCCCGCCCCTGCCAGCGCATTTGTTGAGCACTTTGGAAAGACAGCGTCTTTTATCAGACCCCACCTCCCTACCGCTAGGTAGGCC
AGCAGGACGTCCACCTCTTTTGGCAAAACAAAATTCTGCACCCGGATTTAGCCACCTCTCATTCTGTCACCCGCACCCTCACTCACCTGA
GTGGACCCTTCCCCTAGGACGCTCATCCTTTGCACCGAACACCACCTACCTCCTCCTCATTGGTACAGACCATTGTAAAGATGCACAAAG
TTCCTACGGACTTCCCGACCCGCCCCCTTCCATCTACCTCAGTCTTAGGGGGAAAGGTGGGGGTGAATCCTGGACTGCGTTAGCTCCAAT
GAGTCACCACCCTGCGGCTCCTGACCTTAATCCATCTTAGTACCTGTCATTGACATCCTCCCCTCCCTGAGTGGATCGATCCAACATAAC
CCCCCTCTTCTTCCACCTATGGCGCACCCCACTGGCATGGCTATGCTGGGTCTTCCAGGGAAACGCCTCCCAGCCCGGCATTCTGTGGTC
TGTTCCAGCAGGACGTGGCCTTTTGGGAGGAAAAACCGGTCTTGACCAGGGCTAGTCCATTCTGGCTTTCAGGCTCAGTCACTTGGTCAC
CAGTCCCCAGTCCTGGACCTACTGCTACTGTCCTTTTATCCGGTCCTCCCTCGCTGTCCTCTTCAGTTGCCTTTGCTAGGGACCGGCCTG
TCCCTTTACTACCTAAGTCATCGTCAGTTCGCCCAACTTCCCTCCAAATCTGCCCCTCACGGTACGCAGGGATCGCCCTTCCTTCCTGCC
TTTGGACTGGTCCAGGTCCTCCTCCGCCCTCCTTCACGCAAAGGCCTCCTCCAGGGGGACTACCTGTCCCTCAGCCCAGAGGTCCCCCTG
TCCAAGCGGGGTATTCCACCAGGCCATATGACCTACCCACCCGACAACTGAAGGGGGCGTGGATGAGCTCTGTGACTCTGAATGCTACTT
TATAAATCGACTGTCAGCGTTTTCTAATTAAAGGAGCTCTGGGGTAAAGATCTTAAGAACGTGTCTGAGAACCATAATGTGCGTCTGCAA
AATGTCATTGAAATTAGGAAAGAAGGCCGGACACAGTGGCTCACGCCTGTAATTCCAGCACTTTAAGAGGCCAAAGCAGGAGGACTGCTG
GAGGCCAGGAGTTAGAGACCAACCTAGGCAACACAGCAAGACCGCATCTCTACGAAAAATGAAAATATTAGCTAGGCGTCATACCAAACG
CCTGTAGTTCCAGCTACTTGGGAGGCTGAGGCAGGAGGATCCCTTGAGCCCAGGAGTTCAAGGCTGCAGTGAGCTGTGATCCTGCCACTA

>In-frame_PPP1R13L_ENST00000418234_chr19_45895138_-_OPA3_ENST00000323060_chr19_46032714_-_3924nt
CTTCCTAAGCCTTAAAGAGACAGGACGGTCGATTGGTCTGAAATTCTTGAAGAGACAGGCGCCCGCTCCGGCCGGCACCATGGACAGCGA
GGCATTCCAGAGCGCGCGGGACTTTCTGGACATGAACTTCCAGTCGCTGGCCATGAAACACATGGATCTGAAGCAGATGGAGCTGGACAC
GGCGGCGGCCAAGGTGGATGAACTGACCAAGCAGCTGGAGTCGCTGTGGTCAGACTCTCCCGCGCCTCCTGGCCCGCAGGCCGGACCCCC
TTCTAGGCCGCCCCGGTACAGCTCCAGCTCGATCCCTGAGCCCTTCGGCAGCCGAGGGTCCCCCCGGAAGGCGGCCACCGACGGCGCAGA
CACCCCGTTCGGACGATCAGAGAGTGCCCCAACCCTACACCCCTACAGCCCGCTGTCCCCCAAGGGACGGCCGTCGTCGCCGCGCACCCC
GCTCTACCTGCAGCCGGACGCCTACGGCAGCCTGGACCGCGCGACCTCGCCCCGGCCCCGCGCCTTCGATGGCGCAGGCAGCTCCCTCGG
CCGTGCGCCCTCCCCGCGGCCCGGGCCAGGCCCGCTCCGCCAGCAGGGTCCCCCCACGCCTTTCGACTTCCTGGGCCGCGCAGGCTCCCC
CCGCGGCAGCCCCCTGGCGGAGGGGCCCCAGGCCTTCTTCCCCGAGCGTGGGCCGTCACCGCGCCCCCCTGCCACAGCCTACGACGCGCC
AGCGTCCGCCTTCGGGAGCTCCCTGCTAGGCTCCGGCGGCAGCGCATTCGCCCCGCCTCTGCGCGCGCAAGACGACCTGACGCTGCGCCG
GCGGCCTCCGAAAGCCTGGAACGAGTCTGACCTGGACGTGGCGTACGAGAAGAAGCCTTCGCAGACAGCGAGCTATGAACGCCTGGACGT
CTTCGCAAGGCCTGCCTCGCCGAGCCTGCAGCTGTTGCCTTGGAGGGAGAGCAGCCTGGATGGACTGGGGGGCACCGGCAAGGACAACCT
CACTAGCGCCACCCTGCCGCGCAATTACAAGGTCTCTCCTCTGGCCAGCGACCGGCGTTCAGACGCGGGCAGCTACCGGCGCTCGCTGGG
CTCCGCGGGGCCGTCGGGCACTTTGCCTCGCAGCTGGCAGCCCGTCAGCCGCATCCCCATGCCCCCCTCCAGCCCCCAGCCCCGCGGGGC
CCCGCGCCAGCGTCCCATCCCCCTCAGCATGATCTTCAAGCTGCAGAACGCCTTCTGGGAGCACGGGGCCAGCCGCGCCATGCTCCCTGG
GTCCCCCCTCTTCACCCGAGCACCCCCGCCTAAGCTGCAGCCCCAACCACAACCACAGCCCCAGCCACAATCACAACCACAGCCCCAGCT
GCCCCCACAGCCCCAGACCCAACCCCAAACCCCTACCCCAGCCCCCCAGCATCCCCAACAGACATGGCCCCCTGTGAACGAAGGACCCCC
CAAACCCCCCACCGAGCTGGAGCCTGAGCCGGAGATAGAGGGGCTGCTGACACCAGTGCTGGAGGCTGGCGATGTGGATGAAGGCCCTGT
AGCAAGGCCTCTCAGCCCCACGAGGCTGCAGCCAGCACTGCCACCGGAGGCACAGTCGGTGCCCGAGCTGGAGGAGGTGGCACGGGTGTT
GGCGGAAATTCCCCGGCCCCTCAAACGCAGGGGCTCCATGGAGCAGGCCCCTGCTGTGGCCCTGCCCCCTACCCACAAGAAACAGTACCA
GCAGATCATCAGCCGCCTCTTCCATCGTCATGGGGGGCCAGGGCCCGGGGGGCCGGAGCCAGAGCTGTCCCCCATCACTGAGGGATCTGA
GGCCAGGGCAGGGCCCCCTGCTCCTGCCCCACCAGCTCCCATTCCACCCCCGGCCCCGTCCCAGAGCAGCCCACCAGAGCAGCCGCAGAG
CATGTGTACCACTGGCTGGAGATGCGGACCAAAATGCGCATCATGGGTTTCAATGCCGCTGCCATCAAGCCGCTGAACGAGGGTGCAGCC
GCCGAGCTGGGCGCGGAGCTGCTGGGCGAGGGCATCATCTTCATCACCGCCTGCAGCTGCCTGATGCTGGAGTATTGGCGCCACCAGTTG
CAGCAGCGCCGCAAGGAAAAGGAGCGACGTGTTGCCAGGGAGGCGCTGCGGGGCGAGGTGGGCCACTTGGGGCTGGCGCTCGAGGAGTTG
CAGGCGCAGGTGCAGGCGACGTCGACGCAGCTCGCCCTGGAGGAGCTGCGCGCTCAGCTGCAGGAGGTGCGAGCCCACCTCTGCCTCCGA
GACCCGCCGCCTGCACCCCCAGTTGCGCCGGCGTCCGAGAAATAGGAGGTCTCGGGGCCCTGGTCTTGGAGGTGACTGCTGTCTGGACTG
CGAAGTCTCTGTCTTGGCCTATTCTCCGCACTGTCCCATCCTGGACCGGCCCAGCTGACACCACCCAGTCCTTCGGGGGCGCCGGAGAGA
TCCTGGGCTGGAGCTGATCGAACCTCCCTACTAACCTGCCCAGTGGTACCTTCCACTGGGACTCTCCGCCTCCTGCAGGTGGAACGTTCC
AAGAAGGACCCCGCCCTATCCCACCCCGCCCCTGCCAGCGCATTTGTTGAGCACTTTGGAAAGACAGCGTCTTTTATCAGACCCCACCTC
CCTACCGCTAGGTAGGCCAGCAGGACGTCCACCTCTTTTGGCAAAACAAAATTCTGCACCCGGATTTAGCCACCTCTCATTCTGTCACCC
GCACCCTCACTCACCTGAGTGGACCCTTCCCCTAGGACGCTCATCCTTTGCACCGAACACCACCTACCTCCTCCTCATTGGTACAGACCA
TTGTAAAGATGCACAAAGTTCCTACGGACTTCCCGACCCGCCCCCTTCCATCTACCTCAGTCTTAGGGGGAAAGGTGGGGGTGAATCCTG
GACTGCGTTAGCTCCAATGAGTCACCACCCTGCGGCTCCTGACCTTAATCCATCTTAGTACCTGTCATTGACATCCTCCCCTCCCTGAGT
GGATCGATCCAACATAACCCCCCTCTTCTTCCACCTATGGCGCACCCCACTGGCATGGCTATGCTGGGTCTTCCAGGGAAACGCCTCCCA
GCCCGGCATTCTGTGGTCTGTTCCAGCAGGACGTGGCCTTTTGGGAGGAAAAACCGGTCTTGACCAGGGCTAGTCCATTCTGGCTTTCAG
GCTCAGTCACTTGGTCACCAGTCCCCAGTCCTGGACCTACTGCTACTGTCCTTTTATCCGGTCCTCCCTCGCTGTCCTCTTCAGTTGCCT
TTGCTAGGGACCGGCCTGTCCCTTTACTACCTAAGTCATCGTCAGTTCGCCCAACTTCCCTCCAAATCTGCCCCTCACGGTACGCAGGGA
TCGCCCTTCCTTCCTGCCTTTGGACTGGTCCAGGTCCTCCTCCGCCCTCCTTCACGCAAAGGCCTCCTCCAGGGGGACTACCTGTCCCTC
AGCCCAGAGGTCCCCCTGTCCAAGCGGGGTATTCCACCAGGCCATATGACCTACCCACCCGACAACTGAAGGGGGCGTGGATGAGCTCTG
TGACTCTGAATGCTACTTTATAAATCGACTGTCAGCGTTTTCTAATTAAAGGAGCTCTGGGGTAAAGATCTTAAGAACGTGTCTGAGAAC
CATAATGTGCGTCTGCAAAATGTCATTGAAATTAGGAAAGAAGGCCGGACACAGTGGCTCACGCCTGTAATTCCAGCACTTTAAGAGGCC
AAAGCAGGAGGACTGCTGGAGGCCAGGAGTTAGAGACCAACCTAGGCAACACAGCAAGACCGCATCTCTACGAAAAATGAAAATATTAGC
TAGGCGTCATACCAAACGCCTGTAGTTCCAGCTACTTGGGAGGCTGAGGCAGGAGGATCCCTTGAGCCCAGGAGTTCAAGGCTGCAGTGA


Top

FusionGenePPI for PPP1R13L_OPA3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPP1R13LRELA, TP53, SP1, PPP1CA, AURKB, CEP57, EP300, MAPRE1, WDR83, MAGEA4, PPP1CC, CREBBP, PPP1R3A, SRPK2, XPO1, PPP1CB, SMS, SEC16A, ATP6AP2, CDH1, FAM19A3, PPP1R7, KEAP1, NFE2L2, TRIM25OPA3APP, KDM1A, PRMT6, SUV39H1, NXF1, NRG1, OPA3, IDE, STOML2, CLPB, ATP5A1, PHYHIPL, YME1L1, SCO2, ECH1, SCO1, TIMM23, C1QBP, ATP5C1, LAMC1, ATP5O, COX5A, STARD7, NRD1, MTCH2, ATP5J, PCDHGB1, TNFRSF17, SLC15A1, PCDHGB4, UBC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPP1R13L_OPA3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPP1R13L_OPA3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePPP1R13LC0023418leukemia1CTD_human
TgeneOPA3C1833809OPTIC ATROPHY AND CATARACT, AUTOSOMAL DOMINANT1CTD_human;ORPHANET;UNIPROT