FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28275

FusionGeneSummary for PPP1CA_PPP2R3C

check button Fusion gene summary
Fusion gene informationFusion gene name: PPP1CA_PPP2R3C
Fusion gene ID: 28275
HgeneTgene
Gene symbol

PPP1CA

PPP2R3C

Gene ID

5499

55012

Gene nameprotein phosphatase 1 catalytic subunit alphaprotein phosphatase 2 regulatory subunit B''gamma
SynonymsPP-1A|PP1A|PP1alpha|PPP1AC14orf10|G4-1|G5pr
Cytomap

11q13.2

14q13.2

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein phosphatase PP1-alpha catalytic subunitprotein phosphatase 1, catalytic subunit, alpha isoformprotein phosphatase 1, catalytic subunit, alpha isozymeserine/threonine protein phosphatase PP1-alpha 1 catalytic subunittesticular serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gammaprotein phosphatase 2 (formerly 2A), regulatory subunit B''protein phosphatase 2, regulatory subunit B'', gammaprotein phosphatase subunit G5PRrhabdomyosarcoma antigen MU-RMS-
Modification date2018052220180523
UniProtAcc

P62136

Q969Q6

Ensembl transtripts involved in fusion geneENST00000312989, ENST00000532446, 
ENST00000376745, ENST00000358239, 
ENST00000261475, ENST00000555644, 
Fusion gene scores* DoF score2 X 2 X 2=84 X 2 X 4=32
# samples 24
** MAII scorelog2(2/8*10)=1.32192809488736log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PPP1CA [Title/Abstract] AND PPP2R3C [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePPP1CA

GO:0016311

dephosphorylation

22311981


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-98-A53A-01APPP1CAchr11

67165654

-PPP2R3Cchr14

35585943

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000312989ENST00000261475PPP1CAchr11

67165654

-PPP2R3Cchr14

35585943

-
In-frameENST00000312989ENST00000555644PPP1CAchr11

67165654

-PPP2R3Cchr14

35585943

-
intron-3CDSENST00000532446ENST00000261475PPP1CAchr11

67165654

-PPP2R3Cchr14

35585943

-
intron-3CDSENST00000532446ENST00000555644PPP1CAchr11

67165654

-PPP2R3Cchr14

35585943

-
intron-3CDSENST00000376745ENST00000261475PPP1CAchr11

67165654

-PPP2R3Cchr14

35585943

-
intron-3CDSENST00000376745ENST00000555644PPP1CAchr11

67165654

-PPP2R3Cchr14

35585943

-
intron-3CDSENST00000358239ENST00000261475PPP1CAchr11

67165654

-PPP2R3Cchr14

35585943

-
intron-3CDSENST00000358239ENST00000555644PPP1CAchr11

67165654

-PPP2R3Cchr14

35585943

-

Top

FusionProtFeatures for PPP1CA_PPP2R3C


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPP1CA

P62136

PPP2R3C

Q969Q6

Protein phosphatase that associates with over 200regulatory proteins to form highly specific holoenzymes whichdephosphorylate hundreds of biological targets. Proteinphosphatase 1 (PP1) is essential for cell division, andparticipates in the regulation of glycogen metabolism, musclecontractility and protein synthesis. Involved in regulation ofionic conductances and long-term synaptic plasticity. May play animportant role in dephosphorylating substrates such as thepostsynaptic density-associated Ca(2+)/calmodulin dependentprotein kinase II. Component of the PTW/PP1 phosphatase complex,which plays a role in the control of chromatin structure and cellcycle progression during the transition from mitosis intointerphase. Regulates NEK2 function in terms of kinase activityand centrosome number and splitting, both in the presence andabsence of radiation-induced DNA damage. Regulator of neural tubeand optic fissure closure, and enteric neural crest cell (ENCCs)migration during development. In balance with CSNK1D and CSNK1E,determines the circadian period length, through the regulation ofthe speed and rhythmicity of PER1 and PER2 phosphorylation. Maydephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418'residue of FOXP3 in regulatory T-cells (Treg) from patients withrheumatoid arthritis, thereby inactivating FOXP3 and renderingTreg cells functionally defective (PubMed:23396208).Dephosphorylates CENPA (PubMed:25556658). Dephosphorylates the'Ser-139' residue of ATG16L1 causing dissociation of ATG12-ATG5-ATG16L1 complex, thereby inhibiting autophagy (PubMed:26083323).{ECO:0000269|PubMed:17283141, ECO:0000269|PubMed:21712997,ECO:0000269|PubMed:23396208, ECO:0000269|PubMed:25556658,ECO:0000269|PubMed:26083323}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePPP2R3Cchr11:67165654chr14:35585943ENST00000261475-013286_29719454Calcium binding1
TgenePPP2R3Cchr11:67165654chr14:35585943ENST00000261475-013226_22919454Compositional biasNote=Poly-Phe
TgenePPP2R3Cchr11:67165654chr14:35585943ENST00000261475-013273_30819454DomainNote=EF-hand 1
TgenePPP2R3Cchr11:67165654chr14:35585943ENST00000261475-013341_37619454DomainNote=EF-hand 2

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PPP1CA_PPP2R3C


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPP1CA_ENST00000312989_chr11_67165654_-_PPP2R3C_ENST00000261475_chr14_35585943_-_434aa
KKKVNKNXKMKKWIYLQNITPNGKEVEKTQMNSIRPFPGFIIGCLLKMKSYYRNXERNQELSFYKEKAENCXIMKNYRTYGFCWTNTRHH
LXLERKRXSITKTFXRLVKRLEQSASNFSQQKSLLNSFIQIHMEEFPSCSSLIMSXEKFGFIKQEXDSVYMMSLGRGTFGNLIXKTTYWN
LSLRCHNXMVWKNLSTPFMFVQQLGSSSSFXILXEQERXKFKIFXHAASXMIYWSXGMRNCPRRVKKQIGFLLLLPXEFMASTXILIKIT
MACSVKKNSHAMEQLPXPMSSXTVFSRSVSLMMEKWTIRPTWTLSLHXKTERNLQLYNIFSNCLILRTKDTXMSFHLIISLGPYRNXXKS

>In-frame_PPP1CA_ENST00000312989_chr11_67165654_-_PPP2R3C_ENST00000555644_chr14_35585943_-_171aa
KKKVNKNXKMKKWIYLQNITPNGKEVEKTQMNSIRPFPGFIIGCLLKMKSYYRNXERNQELSFYKEKAENCXIMKNYRTYGFCWTNTRHH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPP1CA_ENST00000312989_chr11_67165654_-_PPP2R3C_ENST00000261475_chr14_35585943_-_1304nt
AAAAAAAAAGTGAACAAGAATTAAAAGATGAAGAAATGGATTTATTTACAAAATATTACTCCGAATGGAAAGGAGGTAGAAAAAACACAA
ATGAATTCTATAAGACCATTCCCCGGTTTTATTATAGGCTGCCTGCTGAAGATGAAGTCTTACTACAGAAATTAAGAGAGGAATCAAGAG
CTGTCTTTCTACAAAGAAAAAGCAGAGAACTGTTAGATAATGAAGAATTACAGAACTTATGGTTTTTGCTGGACAAACACCAGACACCAC
CTATGATTGGAGAGGAAGCGATGATCAATTACGAAAACTTTTTGAAGGTTGGTGAAAAGGCTGGAGCAAAGTGCAAGCAATTTTTCACAG
CAAAAGTCTTTGCTAAACTCCTTCATACAGATTCATATGGAAGAATTTCCATCATGCAGTTCTTTAATTATGTCATGAGAAAAGTTTGGC
TTCATCAAACAAGAATAGGACTCAGTTTATATGATGTCGCTGGGCAGGGGTACCTTCGGGAATCTGATTTAGAAAACTACATATTGGAAC
TTATCCCTACGTTGCCACAATTAGATGGTCTGGAAAAATCTTTCTACTCCTTTTATGTTTGTACAGCAGTTAGGAAGTTCTTCTTCTTTT
TAGATCCTTTAAGAACAGGAAAGATAAAAATTCAAGATATTTTAGCATGCAGCTTCCTAGATGATTTATTGGAGCTAAGGGATGAGGAAC
TGTCCAAGGAGAGTCAAGAAACAAATTGGTTTTCTGCTCCTTCTGCCCTAAGAGTTTATGGCCAGTACTTGAATCTTGATAAAGATCACA
ATGGCATGCTCAGTAAAGAAGAACTCTCACGCTATGGAACAGCTACCATGACCAATGTCTTCTTAGACCGTGTTTTCCAGGAGTGTCTCA
CTTATGATGGAGAAATGGACTATAAGACCTACTTGGACTTTGTCCTTGCATTAGAAAACAGAAAGGAACCTGCAGCTCTACAATATATTT
TCAAACTGCTTGATATTGAGAACAAAGGATACCTGAATGTCTTTTCACTTAATTATTTCTTTAGGGCCATACAGGAACTAATGAAAATCC
ATGGACAAGATCCTGTTTCATTTCAAGATGTCAAGGATGAAATCTTTGACATGGTAAAACCAAAGGATCCTTTGAAAATCTCTCTTCAGG
ATTTAATCAACAGTAATCAAGGAGACACAGTAACCACCATTCTAATCGATTTGAATGGCTTCTGGACTTACGAGAACAGAGAGGCTCTTG

>In-frame_PPP1CA_ENST00000312989_chr11_67165654_-_PPP2R3C_ENST00000555644_chr14_35585943_-_515nt
AAAAAAAAAGTGAACAAGAATTAAAAGATGAAGAAATGGATTTATTTACAAAATATTACTCCGAATGGAAAGGAGGTAGAAAAAACACAA
ATGAATTCTATAAGACCATTCCCCGGTTTTATTATAGGCTGCCTGCTGAAGATGAAGTCTTACTACAGAAATTAAGAGAGGAATCAAGAG
CTGTCTTTCTACAAAGAAAAAGCAGAGAACTGTTAGATAATGAAGAATTACAGAACTTATGGTTTTTGCTGGACAAACACCAGACACCAC
CTATGATTGGAGAGGAAGCGATGATCAATTACGAAAACTTTTTGAAGGTTGGTGAAAAGGCTGGAGCAAAGTGCAAGCAATTTTTCACAG
CAAAAGTCTTTGCTAAACTCCTTCATACAGATTCATATGGAAGAATTTCCATCATGCAGTTCTTTAATTATGTCATGAGAAAAGGTGATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPP1CA_ENST00000312989_chr11_67165654_-_PPP2R3C_ENST00000261475_chr14_35585943_-_2816nt
GCGGCGCCGCCATGTCCGACAGCGAGAAGCTCAACCTGGACTCGATCATCGGGCGCCTGCTGGAAGGGTCCAGGGTCCTGACACCCCATT
GCGCCCCAGTGCAGGGCTCGCGGCCTGGCAAGAATGTACAGCTGACAGAGAACGAGATCCGCGGTCTGTGCCTGAAATCCCGGGAGATTT
TTCTGAGCCAGCCCATTCTTCTGGAGCTGGAGGCACCCCTCAAGATCTGCGGTGACATACACGGCCAGTACTACGACCTTCTGCGACTAT
TTGAGTATGGCGGTTTCCCTCCCGAGAGCAACTACCTCTTTCTGGGGGACTATGTGGACAGGGGCAAGCAGTCCTTGGAGACCATCTGCC
TGCTGCTGGCCTATAAGATCAAGTACCCCGAGAACTTCTTCCTGCTCCGTGGGAACCACGAGTGTGCCAGCATCAACCGCATCTATGGTT
TCTACGATGAGTGCAAGAGACGCTACAACATCAAACTGTGGAAAACCTTCACTGACTGCTTCAACTGCCTGCCCATCGCGGCCATAGTGG
ACGAAAAGATCTTCTGCTGCCACGGAGGCCTGTCCCCGGACCTGCAGTCTATGGAGCAGATTCGGCGGATCATGCGGCCCACAGATGTGC
CTGACCAGGGCCTGCTGTGTGACCTGCTGTGGTCTGACCCTGACAAGGACGTGCAGGGCTGGGGCGAGAACGACCGTGGCGTCTCTTTTA
CCTTTGGAGCCGAGGTGGTGGCCAAGTTCCTCCACAAGCACGACTTGGACCTCATCTGCCGAGCACACCAGGTGGTAGAAGACGGCTACG
AGTTCTTTGCCAAGCGGCAGCTGGTGACACTTTTCTCAGCTCCCAACTACTGTGGCGAGTTTGACAATGCTGGCGCCATGATGAGTGTGG
ACGAGACCCTCATGTGCTCTTTCCAGATCCTCAAGCCCGCCGACAAGAACAAGGGGAAGTACGGGCAGTTCAGTGGCCTGAACCCTGGAG
GCCGACCCATCACCCCACCCCGCAATTCCGCCAAAGCCAAGAAATAGCCCCCGCACACCACCCTGTGCCCCAGATGATGGATTGATTGTA
CAGAAATCATGCTGCCATGCTGGGGGGGGGTCACCCCGACCCCTCAGGCCCACCTGTCACGGGGAACATGGAGCCTTGGTGTATTTTTCT
TTTCTTTTTTTAATGAATCAATAGCAGCGTCCAGTCCCCCAGGGCTGCTTCCTGCCTGCACCTGCGGTGACTGTGAGCAGGATCCTGGGG
CCGAGGCTGCAGCTCAGGGCAACGGCAGGCCAGGTCGTGGGTCTCCAGCCGTGCTTGGCCTCAGGGCTGGCAGCCGGATCCTGGGGCAAC
CCATCTGGTCTCTTGAATAAAGGTCAAAGCTGGATTCTCAAAAAAAAAGTGAACAAGAATTAAAAGATGAAGAAATGGATTTATTTACAA
AATATTACTCCGAATGGAAAGGAGGTAGAAAAAACACAAATGAATTCTATAAGACCATTCCCCGGTTTTATTATAGGCTGCCTGCTGAAG
ATGAAGTCTTACTACAGAAATTAAGAGAGGAATCAAGAGCTGTCTTTCTACAAAGAAAAAGCAGAGAACTGTTAGATAATGAAGAATTAC
AGAACTTATGGTTTTTGCTGGACAAACACCAGACACCACCTATGATTGGAGAGGAAGCGATGATCAATTACGAAAACTTTTTGAAGGTTG
GTGAAAAGGCTGGAGCAAAGTGCAAGCAATTTTTCACAGCAAAAGTCTTTGCTAAACTCCTTCATACAGATTCATATGGAAGAATTTCCA
TCATGCAGTTCTTTAATTATGTCATGAGAAAAGTTTGGCTTCATCAAACAAGAATAGGACTCAGTTTATATGATGTCGCTGGGCAGGGGT
ACCTTCGGGAATCTGATTTAGAAAACTACATATTGGAACTTATCCCTACGTTGCCACAATTAGATGGTCTGGAAAAATCTTTCTACTCCT
TTTATGTTTGTACAGCAGTTAGGAAGTTCTTCTTCTTTTTAGATCCTTTAAGAACAGGAAAGATAAAAATTCAAGATATTTTAGCATGCA
GCTTCCTAGATGATTTATTGGAGCTAAGGGATGAGGAACTGTCCAAGGAGAGTCAAGAAACAAATTGGTTTTCTGCTCCTTCTGCCCTAA
GAGTTTATGGCCAGTACTTGAATCTTGATAAAGATCACAATGGCATGCTCAGTAAAGAAGAACTCTCACGCTATGGAACAGCTACCATGA
CCAATGTCTTCTTAGACCGTGTTTTCCAGGAGTGTCTCACTTATGATGGAGAAATGGACTATAAGACCTACTTGGACTTTGTCCTTGCAT
TAGAAAACAGAAAGGAACCTGCAGCTCTACAATATATTTTCAAACTGCTTGATATTGAGAACAAAGGATACCTGAATGTCTTTTCACTTA
ATTATTTCTTTAGGGCCATACAGGAACTAATGAAAATCCATGGACAAGATCCTGTTTCATTTCAAGATGTCAAGGATGAAATCTTTGACA
TGGTAAAACCAAAGGATCCTTTGAAAATCTCTCTTCAGGATTTAATCAACAGTAATCAAGGAGACACAGTAACCACCATTCTAATCGATT
TGAATGGCTTCTGGACTTACGAGAACAGAGAGGCTCTTGTTGCAAATGACAGTGAAAACTCTGCAGACCTTGATGATACATGATCTCTGA
AAGACTAGACTGTCTTATATTATGAGATACTTGAATGCTGCATGTAAAGCCTTTAAAGCAAAATCCTCAGAAATGGTCTAAATAAAACAC

>In-frame_PPP1CA_ENST00000312989_chr11_67165654_-_PPP2R3C_ENST00000555644_chr14_35585943_-_2324nt
GCGGCGCCGCCATGTCCGACAGCGAGAAGCTCAACCTGGACTCGATCATCGGGCGCCTGCTGGAAGGGTCCAGGGTCCTGACACCCCATT
GCGCCCCAGTGCAGGGCTCGCGGCCTGGCAAGAATGTACAGCTGACAGAGAACGAGATCCGCGGTCTGTGCCTGAAATCCCGGGAGATTT
TTCTGAGCCAGCCCATTCTTCTGGAGCTGGAGGCACCCCTCAAGATCTGCGGTGACATACACGGCCAGTACTACGACCTTCTGCGACTAT
TTGAGTATGGCGGTTTCCCTCCCGAGAGCAACTACCTCTTTCTGGGGGACTATGTGGACAGGGGCAAGCAGTCCTTGGAGACCATCTGCC
TGCTGCTGGCCTATAAGATCAAGTACCCCGAGAACTTCTTCCTGCTCCGTGGGAACCACGAGTGTGCCAGCATCAACCGCATCTATGGTT
TCTACGATGAGTGCAAGAGACGCTACAACATCAAACTGTGGAAAACCTTCACTGACTGCTTCAACTGCCTGCCCATCGCGGCCATAGTGG
ACGAAAAGATCTTCTGCTGCCACGGAGGCCTGTCCCCGGACCTGCAGTCTATGGAGCAGATTCGGCGGATCATGCGGCCCACAGATGTGC
CTGACCAGGGCCTGCTGTGTGACCTGCTGTGGTCTGACCCTGACAAGGACGTGCAGGGCTGGGGCGAGAACGACCGTGGCGTCTCTTTTA
CCTTTGGAGCCGAGGTGGTGGCCAAGTTCCTCCACAAGCACGACTTGGACCTCATCTGCCGAGCACACCAGGTGGTAGAAGACGGCTACG
AGTTCTTTGCCAAGCGGCAGCTGGTGACACTTTTCTCAGCTCCCAACTACTGTGGCGAGTTTGACAATGCTGGCGCCATGATGAGTGTGG
ACGAGACCCTCATGTGCTCTTTCCAGATCCTCAAGCCCGCCGACAAGAACAAGGGGAAGTACGGGCAGTTCAGTGGCCTGAACCCTGGAG
GCCGACCCATCACCCCACCCCGCAATTCCGCCAAAGCCAAGAAATAGCCCCCGCACACCACCCTGTGCCCCAGATGATGGATTGATTGTA
CAGAAATCATGCTGCCATGCTGGGGGGGGGTCACCCCGACCCCTCAGGCCCACCTGTCACGGGGAACATGGAGCCTTGGTGTATTTTTCT
TTTCTTTTTTTAATGAATCAATAGCAGCGTCCAGTCCCCCAGGGCTGCTTCCTGCCTGCACCTGCGGTGACTGTGAGCAGGATCCTGGGG
CCGAGGCTGCAGCTCAGGGCAACGGCAGGCCAGGTCGTGGGTCTCCAGCCGTGCTTGGCCTCAGGGCTGGCAGCCGGATCCTGGGGCAAC
CCATCTGGTCTCTTGAATAAAGGTCAAAGCTGGATTCTCAAAAAAAAAGTGAACAAGAATTAAAAGATGAAGAAATGGATTTATTTACAA
AATATTACTCCGAATGGAAAGGAGGTAGAAAAAACACAAATGAATTCTATAAGACCATTCCCCGGTTTTATTATAGGCTGCCTGCTGAAG
ATGAAGTCTTACTACAGAAATTAAGAGAGGAATCAAGAGCTGTCTTTCTACAAAGAAAAAGCAGAGAACTGTTAGATAATGAAGAATTAC
AGAACTTATGGTTTTTGCTGGACAAACACCAGACACCACCTATGATTGGAGAGGAAGCGATGATCAATTACGAAAACTTTTTGAAGGTTG
GTGAAAAGGCTGGAGCAAAGTGCAAGCAATTTTTCACAGCAAAAGTCTTTGCTAAACTCCTTCATACAGATTCATATGGAAGAATTTCCA
TCATGCAGTTCTTTAATTATGTCATGAGAAAAGGTGATTCATTTTTACTGTGCTTGAACTCCTTATCTGGGAATCAAGTAGGTTTTTGGT
CTGTGCTTTTATAAGTATTTCTTCTATGTGAAATCACTCTAAGTTTGAATAGTAGAATTTCTTATCTTTTGACCAAGATGTGTTACATAA
ACTTGGGTTAGCATAAAAAAACAAAAATTTTTTAAACCCTCATGTGTCTTAAAGATAATAGTAGACTAGAAATATTAAGAGCTGAACCAA
GAGTTTTAATGTATGGTAATTTGAAATAATTTTAATTTACTGATAATTTTATTTTACCAGTATATTACAAGTTGAGTTGACTGATAGTTT
CAAACCCAAAGCTGTAATATCAGTTTCAAGGAGCATCAATTAAACAGCTTGGACTTATGATTCCTACAAGTGCCATAATAATCTGTGAAA


Top

FusionGenePPI for PPP1CA_PPP2R3C


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPP1CAPHACTR3, PHACTR1, ACTA1, EED, PPP1R8, PPP1R15A, AKAP11, GSK3B, SMARCB1, PPP1R9B, RYR2, EIF2AK2, KCNQ1, BCL2L1, BCL2L2, HSPA8, PPP1R10, NOC2L, RRP1B, HCFC1, LMTK2, CDC5L, BRCA1, RUVBL2, RPAP2, RPAP3, NCOR1, IKBKB, CUEDC2, CCDC6, CREB1, TRIM28, WDR82, TOX4, MYC, HDAC5, STAU1, NONO, SFPQ, AATK, CSRNP1, C1QA, CNST, TPRN, PPP1R18, TOR1AIP1, NEK2, PPP1R2, PPP1R3C, PPP1R3D, PPP1R3E, TP53BP2, PPP1R13B, PPP1R3G, PPP1R13L, PPP1R15B, PPP1R16A, RANBP9, RIF1, SH3RF2, WBP11, YLPM1, ZFYVE9, KANK1, BTBD10, CLCN2, CEP170, CLTC, CKB, CNP, CNTN1, CRK, CXXC1, DCTN1, DEAF1, FRMPD4, GLIPR1L2, GLTSCR2, IBTK, MIIP, JPH3, KCTD20, RPRD2, KIAA1377, LPIN2, MAFG, MAL2, MAP4K4, NDP, PHC1, PIAS1, PIAS3, PREX1, PRR16, SLC45A1, SNCAIP, SORL1, SPRED1, UBE2Z, ULK1, ZBTB11, ZNF827, SF3A2, SIRT7, TFG, ACTB, INA, PPP1R1B, ATM, AURKB, BCL2, PTK2, LBR, RB1, CDK1, CDK2, CDK4, CCNB1, CCND3, HSPA4, MAX, SKP1, STX1A, APAF1, CCNA1, PPP2R4, CDH1, PTEN, CUL1, BAD, WWTR1, CUL3, KIF13B, DCX, NCAM1, CAV1, AKT1, AURKA, PPP1CB, SRSF7, SRSF5, SRSF11, DDX1, SYNCRIP, VTN, OGT, SON, RPS24, TPBG, ZNF326, CHMP2A, SMARCA5, ESR1, ECT2, MDC1, MDM4, AXIN1, CSNK1E, PRKCB, TCTEX1D4, SFRP1, PPP1R32, FN1, VCAM1, CD2BP2, TOE1, GPKOW, GRB2, MPHOSPH10, PPP1R37, TP53, TUSC3, NOM1, PPP1R26, CCDC181, ZFYVE16, PPP1R3B, CASC5, KIF18A, STAM, CSRNP2, SYTL2, HEYL, PLCL2, ITGA4, PRKAR1A, MST1R, CTDP1, CHUK, TNFRSF1A, POLR2A, YAP1, MAT2B, PKM, ALDH7A1, ASNS, CAPNS1, STK24, TBCB, YWHAH, SCPEP1, TMOD3, XPO1, WWOX, HUWE1, PPP1R2P3, CUL7, OBSL1, CSNK2B, DEC1, RORC, CLOCK, PPP2R5E, ARNTL, PPP1R7, GPN3, PIH1D1, WDR92, PPP1CC, PDRG1, PPP1R9A, GYS2, GYS1, CDCA2, UXT, POLR3A, SCRIB, LRRC1, C12orf57, KIAA1279, MKI67, PEAK1, ERBB2IP, EIF2AK4, URI1, RUVBL1, SHOC2, NUP153, C20orf27, POLR2E, CCDC85C, RASSF8, GYG1, TANC2, PHACTR4, PPP1R11, CCDC85B, POLR3E, POLR3B, RASSF7, HOMEZ, SUPT6H, PPP1R3A, RASSF9, RASSF10, NTRK1, DPYSL2, HDAC1, HDAC6, HDAC3, NINL, CAPZA2, DBN1, FLNA, MYH9, MYO1C, IQGAP1, MATR3, MTX2, SYNPO, ASF1A, LIMA1, ANLN, MYO5C, MYO19, PARD6B, MYO18A, AR, MDM2, SKP2, SNW1, UBXN2B, UBXN2A, LATS1, PARD3, NFATC2, PTPN7, GSK3A, LEO1, PFDN2, PFDN6, RPL13, TERF2, PPP1R16B, SH2D4A, SFRP2, SFRP5, PAK1, PQBP1, PACS1, HSPA1L, DCAF7, MAPRE2, MAPRE1, PPP2R5C, PPP2R5D, DLD, HSD17B10, TRIM25, TES, NR3C2PPP2R3CIKBKB, POLR1C, RTN3, CCDC33, CMTM5, PPP2CB, FGFR1OP, HSPB1, CEP128, CEP19, DYNC1H1, ITGB4, MYBL2, PCM1, LGMN, OFD1, KIAA0753, CEP350, CEP131, PPP2R1A, CCDC132, CEP72, DYNC2H1, CCDC77, NCBP2-AS2, MTNR1A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPP1CA_PPP2R3C


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPP1CA_PPP2R3C


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource