FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28234

FusionGeneSummary for PPM1D_TRIM37

check button Fusion gene summary
Fusion gene informationFusion gene name: PPM1D_TRIM37
Fusion gene ID: 28234
HgeneTgene
Gene symbol

PPM1D

TRIM37

Gene ID

8493

4591

Gene nameprotein phosphatase, Mg2+/Mn2+ dependent 1Dtripartite motif containing 37
SynonymsIDDGIP|PP2C-DELTA|WIP1MUL|POB1|TEF3
Cytomap

17q23.2

17q22

Type of geneprotein-codingprotein-coding
Descriptionprotein phosphatase 1Dprotein phosphatase 1D magnesium-dependent, delta isoformprotein phosphatase 2C delta isoformprotein phosphatase Wip1wild-type p53-induced phosphatase 1E3 ubiquitin-protein ligase TRIM37RING-B-box-coiled-coil proteinRING-type E3 ubiquitin transferase TRIM37mulibrey nanism protein
Modification date2018051920180522
UniProtAcc

O15297

O94972

Ensembl transtripts involved in fusion geneENST00000305921, ENST00000393066, 
ENST00000262294, ENST00000376149, 
ENST00000393065, ENST00000584889, 
Fusion gene scores* DoF score6 X 4 X 3=727 X 6 X 7=294
# samples 57
** MAII scorelog2(5/72*10)=-0.526068811667588
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/294*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PPM1D [Title/Abstract] AND TRIM37 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePPM1D

GO:0035970

peptidyl-threonine dephosphorylation

20801214

TgeneTRIM37

GO:0000122

negative regulation of transcription by RNA polymerase II

25470042

TgeneTRIM37

GO:0032088

negative regulation of NF-kappaB transcription factor activity

11279055

TgeneTRIM37

GO:0035518

histone H2A monoubiquitination

25470042

TgeneTRIM37

GO:0036353

histone H2A-K119 monoubiquitination

25470042

TgeneTRIM37

GO:0051091

positive regulation of DNA binding transcription factor activity

23077300

TgeneTRIM37

GO:0051092

positive regulation of NF-kappaB transcription factor activity

23077300

TgeneTRIM37

GO:0051865

protein autoubiquitination

15885686

TgeneTRIM37

GO:0070842

aggresome assembly

15885686


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E2-A14V-01APPM1Dchr17

58711338

+TRIM37chr17

57060282

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000305921ENST00000393066PPM1Dchr17

58711338

+TRIM37chr17

57060282

-
5CDS-intronENST00000305921ENST00000262294PPM1Dchr17

58711338

+TRIM37chr17

57060282

-
5CDS-intronENST00000305921ENST00000376149PPM1Dchr17

58711338

+TRIM37chr17

57060282

-
5CDS-intronENST00000305921ENST00000393065PPM1Dchr17

58711338

+TRIM37chr17

57060282

-
5CDS-intronENST00000305921ENST00000584889PPM1Dchr17

58711338

+TRIM37chr17

57060282

-

Top

FusionProtFeatures for PPM1D_TRIM37


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPM1D

O15297

TRIM37

O94972

Involved in the negative regulation of p53 expression(PubMed:23242139). Required for the relief of p53-dependentcheckpoint mediated cell cycle arrest. Binds to anddephosphorylates 'Ser-15' of TP53 and 'Ser-345' of CHEK1 whichcontributes to the functional inactivation of these proteins(PubMed:15870257, PubMed:16311512). Mediates MAPK14dephosphorylation and inactivation (PubMed:21283629). Is also animportant regulator of global heterochromatin silencing andcritical in maintaining genome integrity (By similarity).{ECO:0000250|UniProtKB:Q9QZ67, ECO:0000269|PubMed:15870257,ECO:0000269|PubMed:16311512, ECO:0000269|PubMed:21283629,ECO:0000269|PubMed:23242139}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTRIM37chr17:58711338chr17:57060282ENST00000262294-024132_234-87965Coiled coilOntology_term=ECO:0000255
TgeneTRIM37chr17:58711338chr17:57060282ENST00000262294-024419_450-87965Coiled coilOntology_term=ECO:0000255
TgeneTRIM37chr17:58711338chr17:57060282ENST00000262294-024673_700-87965Coiled coilOntology_term=ECO:0000255
TgeneTRIM37chr17:58711338chr17:57060282ENST00000376149-023132_234-270804Coiled coilOntology_term=ECO:0000255
TgeneTRIM37chr17:58711338chr17:57060282ENST00000376149-023419_450-270804Coiled coilOntology_term=ECO:0000255
TgeneTRIM37chr17:58711338chr17:57060282ENST00000376149-023673_700-270804Coiled coilOntology_term=ECO:0000255
TgeneTRIM37chr17:58711338chr17:57060282ENST00000262294-024534_540-87965Compositional biasNote=Poly-Ser
TgeneTRIM37chr17:58711338chr17:57060282ENST00000262294-024578_581-87965Compositional biasNote=Poly-Ala
TgeneTRIM37chr17:58711338chr17:57060282ENST00000376149-023534_540-270804Compositional biasNote=Poly-Ser
TgeneTRIM37chr17:58711338chr17:57060282ENST00000376149-023578_581-270804Compositional biasNote=Poly-Ala
TgeneTRIM37chr17:58711338chr17:57060282ENST00000262294-024276_403-87965DomainMATH
TgeneTRIM37chr17:58711338chr17:57060282ENST00000376149-023276_403-270804DomainMATH
TgeneTRIM37chr17:58711338chr17:57060282ENST00000262294-02415_55-87965Zinc fingerRING-type%3B degenerate
TgeneTRIM37chr17:58711338chr17:57060282ENST00000262294-02490_132-87965Zinc fingerB box-type
TgeneTRIM37chr17:58711338chr17:57060282ENST00000376149-02315_55-270804Zinc fingerRING-type%3B degenerate
TgeneTRIM37chr17:58711338chr17:57060282ENST00000376149-02390_132-270804Zinc fingerB box-type

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePPM1Dchr17:58711338chr17:57060282ENST00000305921+368_375275606DomainPPM-type phosphatase
TgeneTRIM37chr17:58711338chr17:57060282ENST00000393066-2325132_234963965Coiled coilOntology_term=ECO:0000255
TgeneTRIM37chr17:58711338chr17:57060282ENST00000393066-2325419_450963965Coiled coilOntology_term=ECO:0000255
TgeneTRIM37chr17:58711338chr17:57060282ENST00000393066-2325673_700963965Coiled coilOntology_term=ECO:0000255
TgeneTRIM37chr17:58711338chr17:57060282ENST00000393066-2325534_540963965Compositional biasNote=Poly-Ser
TgeneTRIM37chr17:58711338chr17:57060282ENST00000393066-2325578_581963965Compositional biasNote=Poly-Ala
TgeneTRIM37chr17:58711338chr17:57060282ENST00000393066-2325276_403963965DomainMATH
TgeneTRIM37chr17:58711338chr17:57060282ENST00000393066-232515_55963965Zinc fingerRING-type%3B degenerate
TgeneTRIM37chr17:58711338chr17:57060282ENST00000393066-232590_132963965Zinc fingerB box-type


Top

FusionGeneSequence for PPM1D_TRIM37


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPM1D_ENST00000305921_chr17_58711338_+_TRIM37_ENST00000393066_chr17_57060282_-_276aa
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPGGEVSGKGPAVAAREARDPLPDAGASPAPSR
CCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVII
RGMKMTVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPM1D_ENST00000305921_chr17_58711338_+_TRIM37_ENST00000393066_chr17_57060282_-_830nt
ATGGCGGGGCTGTACTCGCTGGGAGTGAGCGTCTTCTCCGACCAGGGCGGGAGGAAGTACATGGAGGACGTTACTCAAATCGTTGTGGAG
CCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCGGTCGCTGTCTCAGCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGC
GGCGAAGTCTCGGGGAAAGGCCCAGCGGTGGCAGCCCGAGAGGCTCGCGACCCTCTCCCGGACGCCGGGGCCTCGCCGGCACCTAGCCGC
TGCTGCCGCCGCCGTTCCTCCGTGGCCTTTTTCGCCGTGTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCGGGAGCACTTG
TGGGGTTTCATCAAGAAGCAGAAGGGTTTCACCTCGTCCGAGCCGGCTAAGGTTTGCGCTGCCATCCGCAAAGGCTTTCTCGCTTGTCAC
CTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGACTATGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATT
CGGGGCATGAAGATGTATGTAGCTCACGTAGGTGACTCAGGGGTGGTTCTTGGAATTCAGGATGACCCGAAGGATGACTTTGTCAGAGCT
GTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAAGGAAAGAGAACGAATCGAAGGACTTGGTGGGAGTGTAATGAACAAGTCTGGG
GTGAATCGTGTAGTTTGGAAACGACCTCGACTCACTCACAATGGACCTGTTAGAAGGAGCACAGTTATTGACCAGATTCCTTTTCTGGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPM1D_ENST00000305921_chr17_58711338_+_TRIM37_ENST00000393066_chr17_57060282_-_1329nt
GGGGAAGCGCAGTGCGCAGGCGCAACTGCCTGGCTCTGCTCGCTCCGGCGCTCCGGCCCAGCTCTCGCGGACAAGTCCAGACATCGCGCG
CCCCCCCTTCTCCGGGTCCGCCCCCTCCCCCTTCTCGGCGTCGTCGAAGATAAACAATAGTTGGCCGGCGAGCGCCTAGTGTGTCTCCCG
CCGCCGGATTCGGCGGGCTGCGTGGGACCGGCGGGATCCCGGCCAGCCGGCCATGGCGGGGCTGTACTCGCTGGGAGTGAGCGTCTTCTC
CGACCAGGGCGGGAGGAAGTACATGGAGGACGTTACTCAAATCGTTGTGGAGCCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCG
GTCGCTGTCTCAGCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGCGGCGAAGTCTCGGGGAAAGGCCCAGCGGTGGCAGCCCG
AGAGGCTCGCGACCCTCTCCCGGACGCCGGGGCCTCGCCGGCACCTAGCCGCTGCTGCCGCCGCCGTTCCTCCGTGGCCTTTTTCGCCGT
GTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCGGGAGCACTTGTGGGGTTTCATCAAGAAGCAGAAGGGTTTCACCTCGTC
CGAGCCGGCTAAGGTTTGCGCTGCCATCCGCAAAGGCTTTCTCGCTTGTCACCTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGAC
TATGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATTCGGGGCATGAAGATGTATGTAGCTCACGTAGGTGACTC
AGGGGTGGTTCTTGGAATTCAGGATGACCCGAAGGATGACTTTGTCAGAGCTGTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAA
GGAAAGAGAACGAATCGAAGGACTTGGTGGGAGTGTAATGAACAAGTCTGGGGTGAATCGTGTAGTTTGGAAACGACCTCGACTCACTCA
CAATGGACCTGTTAGAAGGAGCACAGTTATTGACCAGATTCCTTTTCTGGCAGTAGCAAGAGCACTTGATAATTTGATTTGAAACTGACA
CTGCACCTGATGGGTTAACAAGATCTAGGCTTCAGAAGGTGACAGATATGAGTGAGGACCATGTGTGGGGCAAAGCCTCAGAATGATGAA
AAGGTTCCGGCACTATAGTTGGGGCCATGTTGACTCCTTTTCAACCATTTGTCACAGACGTGAGAAGAAGAAATGACTTCAAAATCAAGA


Top

FusionGenePPI for PPM1D_TRIM37


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPM1DCDC5L, MDM2, H2AFX, RAD21, UBC, KDM1A, BEX2, CASZ1, DIRAS3, DKK3, EPSTI1, ERRFI1, GLCE, ITIH5, LYPD3, MRC2, NAT2, OSGIN1, RHOBTB2, WHSC1L1, KPNA2, KPNA3, KPNB1, NUP153, PSMD4, RANBP2, SPAG9, CHEK2TRIM37FAM124B, MAGEB18, TCEB3B, APEX2, FXR2, FAM107A, RIBC2, RHPN1, BYSL, ZNF655, DLGAP5, PNKP, PRC1, COPB1, KIAA0408, ZNF417, MCM10, EWSR1, MCRS1, NUDT18, PBK, TRAF1, TRAF2, TRAF3, TRAF4, TRAF5, TRAF6, TRIM37, TNFRSF1B, LTBR, NGFR, UBE2U, UBE2H, ELAVL1, UBE2D1, UBE2D2, UBE2D3, UBE2E1, UBE2E2, UBE2E3, APTX, HSP90AA1, CCDC33, CDK5RAP2, LATS2, ANKRD11, ARNT2, CEP250, DDX6, RPL9, KAT5, FAM50B, RASD1, UBASH3A, KIF9, SCNM1, ZNF329, FAM161A, SSX2IP, CWF19L2, ZMAT2, CDC20B, C17orf59, CEP192, KIAA0753, CCDC14, RPGRIP1L, CNTROB, SPICE1, CEP128, CEP63, CEP89, RPGRIP1, XPO1, HIST2H2AC, EZH2, SUZ12, BMI1, HIST3H3, ZNF816, ZNF610, ZNF550, NCAPH2, ZNF263, ZNF211, ZNF214, CDC16, TPTE2, ZNF416, BBS7, CTNNB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgenePPM1Dchr17:58711338chr17:57060282ENST00000305921+361_101275606CHEK1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPM1D_TRIM37


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPM1D_TRIM37


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePPM1DC0017638Glioma1CTD_human
HgenePPM1DC0677866Brain Stem Neoplasms1CTD_human
TgeneTRIM37C0524582Mulibrey Nanism4CTD_human;ORPHANET;UNIPROT
TgeneTRIM37C0016063Osteitis Fibrosa Disseminata1CTD_human
TgeneTRIM37C0019209Hepatomegaly1CTD_human;HPO
TgeneTRIM37C0376634Craniofacial Abnormalities1CTD_human