FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27495

FusionGeneSummary for PLCB3_PGA5

check button Fusion gene summary
Fusion gene informationFusion gene name: PLCB3_PGA5
Fusion gene ID: 27495
HgeneTgene
Gene symbol

PLCB3

PGA5

Gene ID

5331

5222

Gene namephospholipase C beta 3pepsinogen 5, group I (pepsinogen A)
Synonyms-Pg5
Cytomap

11q13.1

11q12.2

Type of geneprotein-codingprotein-coding
Description1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3PLC beta 3phosphoinositide phospholipase C-beta-3phospholipase C, beta 3 (phosphatidylinositol-specific)pepsin A-5pepsin Apepsinogen A5pepsinogen-5
Modification date2018052220180523
UniProtAcc

Q01970

P0DJD9

Ensembl transtripts involved in fusion geneENST00000279230, ENST00000540288, 
ENST00000325234, 
ENST00000312403, 
ENST00000451616, ENST00000541528, 
Fusion gene scores* DoF score4 X 4 X 2=321 X 1 X 1=1
# samples 41
** MAII scorelog2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: PLCB3 [Title/Abstract] AND PGA5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePLCB3

GO:0003073

regulation of systemic arterial blood pressure

18468998


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-LL-A6FQ-01APLCB3chr11

64023088

+PGA5chr11

61013418

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000279230ENST00000312403PLCB3chr11

64023088

+PGA5chr11

61013418

+
5CDS-intronENST00000279230ENST00000451616PLCB3chr11

64023088

+PGA5chr11

61013418

+
5CDS-intronENST00000279230ENST00000541528PLCB3chr11

64023088

+PGA5chr11

61013418

+
In-frameENST00000540288ENST00000312403PLCB3chr11

64023088

+PGA5chr11

61013418

+
5CDS-intronENST00000540288ENST00000451616PLCB3chr11

64023088

+PGA5chr11

61013418

+
5CDS-intronENST00000540288ENST00000541528PLCB3chr11

64023088

+PGA5chr11

61013418

+
In-frameENST00000325234ENST00000312403PLCB3chr11

64023088

+PGA5chr11

61013418

+
5CDS-intronENST00000325234ENST00000451616PLCB3chr11

64023088

+PGA5chr11

61013418

+
5CDS-intronENST00000325234ENST00000541528PLCB3chr11

64023088

+PGA5chr11

61013418

+

Top

FusionProtFeatures for PLCB3_PGA5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PLCB3

Q01970

PGA5

P0DJD9

The production of the second messenger moleculesdiacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) ismediated by activated phosphatidylinositol-specific phospholipaseC enzymes. Shows particularly broad specificity; although bondsinvolving phenylalanine and leucine are preferred, many others arealso cleaved to some extent.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLCB3chr11:64023088chr11:61013418ENST00000279230+731318_4681991235DomainPI-PLC X-box
HgenePLCB3chr11:64023088chr11:61013418ENST00000279230+731590_7061991235DomainPI-PLC Y-box
HgenePLCB3chr11:64023088chr11:61013418ENST00000279230+731713_8101991235DomainC2
HgenePLCB3chr11:64023088chr11:61013418ENST00000325234+529318_4681321168DomainPI-PLC X-box
HgenePLCB3chr11:64023088chr11:61013418ENST00000325234+529590_7061321168DomainPI-PLC Y-box
HgenePLCB3chr11:64023088chr11:61013418ENST00000325234+529713_8101321168DomainC2
HgenePLCB3chr11:64023088chr11:61013418ENST00000540288+732318_4681991383DomainPI-PLC X-box
HgenePLCB3chr11:64023088chr11:61013418ENST00000540288+732590_7061991383DomainPI-PLC Y-box
HgenePLCB3chr11:64023088chr11:61013418ENST00000540288+732713_8101991383DomainC2
TgenePGA5chr11:64023088chr11:61013418ENST00000312403+3976_385152389DomainPeptidase A1


Top

FusionGeneSequence for PLCB3_PGA5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PLCB3_ENST00000279230_chr11_64023088_+_PGA5_ENST00000312403_chr11_61013418_+_436aa
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNMEVDTLDISSIRDTRTGRYARLPKDPKIREVL
GFGGPDARLEEKLMTVVSGPDPVNTVFLNFMAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKS
GSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSA

>In-frame_PLCB3_ENST00000540288_chr11_64023088_+_PGA5_ENST00000312403_chr11_61013418_+_436aa
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNMEVDTLDISSIRDTRTGRYARLPKDPKIREVL
GFGGPDARLEEKLMTVVSGPDPVNTVFLNFMAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKS
GSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSA

>In-frame_PLCB3_ENST00000325234_chr11_64023088_+_PGA5_ENST00000312403_chr11_61013418_+_369aa
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEEKLMTVVSGPDPVNTVFLNFMAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAY
TKLKLQVNQDGRIPVKNILKMFSADKKRVETALESCGLKFNRVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFD
NIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPI
ANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PLCB3_ENST00000279230_chr11_64023088_+_PGA5_ENST00000312403_chr11_61013418_+_1308nt
ATGGCGGGCGCCCAGCCCGGCGTCCACGCGCTGCAGTTGGAGCCGCCCACCGTGGTGGAGACCCTGCGGCGCGGGAGTAAGTTCATCAAA
TGGGACGAGGAGACCTCCAGTCGGAACCTGGTGACCCTGCGTGTGGACCCCAATGGCTTCTTCTTGTACTGGACGGGCCCCAACATGGAG
GTGGACACACTGGACATCAGTTCCATCAGGGACACACGGACAGGCCGGTACGCCCGCCTGCCCAAGGACCCCAAGATCCGGGAAGTTCTG
GGCTTTGGGGGTCCCGATGCCCGGCTGGAGGAGAAGCTGATGACGGTGGTGTCTGGGCCAGACCCAGTGAACACAGTGTTCTTGAACTTC
ATGGCCGTGCAGGATGACACAGCCAAGGTCTGGTCTGAGGAGCTATTCAAGCTGGCTATGAACATCCTGGCTCAGAACGCCTCCCGGAAC
ACCTTCCTGCGCAAAGCATACACGAAGCTGAAGCTGCAGGTGAACCAGGATGGTCGGATCCCCGTCAAGAACATCCTGAAGATGTTCTCA
GCAGACAAGAAGCGGGTGGAGACTGCGCTGGAATCCTGTGGCCTCAAATTCAACCGGGTTGGAGGCATCTCTGACACCAATCAGATCTTC
GGCCTGAGCGAGACGGAACCTGGCTCCTTCCTGTATTATGCTCCCTTCGATGGCATCCTGGGGCTGGCCTACCCCAGCATTTCCTCCTCC
GGGGCCACACCCGTCTTTGACAACATCTGGAACCAGGGCCTGGTTTCTCAGGACCTCTTCTCTGTCTACCTCAGCGCCGATGACAAGAGT
GGCAGCGTGGTGATCTTTGGTGGCATTGACTCTTCTTACTACACTGGAAGTCTGAACTGGGTGCCTGTTACCGTCGAGGGTTACTGGCAG
ATCACCGTGGACAGCATCACCATGAACGGAGAGACCATCGCCTGTGCTGAGGGCTGCCAGGCCATTGTTGACACCGGCACCTCTCTGCTG
ACCGGCCCAACCAGCCCCATTGCCAACATCCAGAGCGACATCGGAGCCAGCGAGAACTCAGATGGCGACATGGTGGTCAGCTGCTCAGCC
ATCAGCAGCCTGCCCGACATCGTCTTCACCATCAATGGAGTCCAGTACCCCGTGCCACCCAGTGCCTACATCCTGCAGAGCGAGGGGAGC
TGCATCAGTGGCTTCCAGGGCATGAACGTCCCCACCGAATCTGGAGAGCTTTGGATCCTGGGTGATGTCTTCATCCGCCAGTACTTTACC

>In-frame_PLCB3_ENST00000540288_chr11_64023088_+_PGA5_ENST00000312403_chr11_61013418_+_1308nt
ATGGCGGGCGCCCAGCCCGGCGTCCACGCGCTGCAGTTGGAGCCGCCCACCGTGGTGGAGACCCTGCGGCGCGGGAGTAAGTTCATCAAA
TGGGACGAGGAGACCTCCAGTCGGAACCTGGTGACCCTGCGTGTGGACCCCAATGGCTTCTTCTTGTACTGGACGGGCCCCAACATGGAG
GTGGACACACTGGACATCAGTTCCATCAGGGACACACGGACAGGCCGGTACGCCCGCCTGCCCAAGGACCCCAAGATCCGGGAAGTTCTG
GGCTTTGGGGGTCCCGATGCCCGGCTGGAGGAGAAGCTGATGACGGTGGTGTCTGGGCCAGACCCAGTGAACACAGTGTTCTTGAACTTC
ATGGCCGTGCAGGATGACACAGCCAAGGTCTGGTCTGAGGAGCTATTCAAGCTGGCTATGAACATCCTGGCTCAGAACGCCTCCCGGAAC
ACCTTCCTGCGCAAAGCATACACGAAGCTGAAGCTGCAGGTGAACCAGGATGGTCGGATCCCCGTCAAGAACATCCTGAAGATGTTCTCA
GCAGACAAGAAGCGGGTGGAGACTGCGCTGGAATCCTGTGGCCTCAAATTCAACCGGGTTGGAGGCATCTCTGACACCAATCAGATCTTC
GGCCTGAGCGAGACGGAACCTGGCTCCTTCCTGTATTATGCTCCCTTCGATGGCATCCTGGGGCTGGCCTACCCCAGCATTTCCTCCTCC
GGGGCCACACCCGTCTTTGACAACATCTGGAACCAGGGCCTGGTTTCTCAGGACCTCTTCTCTGTCTACCTCAGCGCCGATGACAAGAGT
GGCAGCGTGGTGATCTTTGGTGGCATTGACTCTTCTTACTACACTGGAAGTCTGAACTGGGTGCCTGTTACCGTCGAGGGTTACTGGCAG
ATCACCGTGGACAGCATCACCATGAACGGAGAGACCATCGCCTGTGCTGAGGGCTGCCAGGCCATTGTTGACACCGGCACCTCTCTGCTG
ACCGGCCCAACCAGCCCCATTGCCAACATCCAGAGCGACATCGGAGCCAGCGAGAACTCAGATGGCGACATGGTGGTCAGCTGCTCAGCC
ATCAGCAGCCTGCCCGACATCGTCTTCACCATCAATGGAGTCCAGTACCCCGTGCCACCCAGTGCCTACATCCTGCAGAGCGAGGGGAGC
TGCATCAGTGGCTTCCAGGGCATGAACGTCCCCACCGAATCTGGAGAGCTTTGGATCCTGGGTGATGTCTTCATCCGCCAGTACTTTACC

>In-frame_PLCB3_ENST00000325234_chr11_64023088_+_PGA5_ENST00000312403_chr11_61013418_+_1107nt
ATGGCGGGCGCCCAGCCCGGCGTCCACGCGCTGCAGTTGGAGCCGCCCACCGTGGTGGAGACCCTGCGGCGCGGGAGTAAGTTCATCAAA
TGGGACGAGGAGAAGCTGATGACGGTGGTGTCTGGGCCAGACCCAGTGAACACAGTGTTCTTGAACTTCATGGCCGTGCAGGATGACACA
GCCAAGGTCTGGTCTGAGGAGCTATTCAAGCTGGCTATGAACATCCTGGCTCAGAACGCCTCCCGGAACACCTTCCTGCGCAAAGCATAC
ACGAAGCTGAAGCTGCAGGTGAACCAGGATGGTCGGATCCCCGTCAAGAACATCCTGAAGATGTTCTCAGCAGACAAGAAGCGGGTGGAG
ACTGCGCTGGAATCCTGTGGCCTCAAATTCAACCGGGTTGGAGGCATCTCTGACACCAATCAGATCTTCGGCCTGAGCGAGACGGAACCT
GGCTCCTTCCTGTATTATGCTCCCTTCGATGGCATCCTGGGGCTGGCCTACCCCAGCATTTCCTCCTCCGGGGCCACACCCGTCTTTGAC
AACATCTGGAACCAGGGCCTGGTTTCTCAGGACCTCTTCTCTGTCTACCTCAGCGCCGATGACAAGAGTGGCAGCGTGGTGATCTTTGGT
GGCATTGACTCTTCTTACTACACTGGAAGTCTGAACTGGGTGCCTGTTACCGTCGAGGGTTACTGGCAGATCACCGTGGACAGCATCACC
ATGAACGGAGAGACCATCGCCTGTGCTGAGGGCTGCCAGGCCATTGTTGACACCGGCACCTCTCTGCTGACCGGCCCAACCAGCCCCATT
GCCAACATCCAGAGCGACATCGGAGCCAGCGAGAACTCAGATGGCGACATGGTGGTCAGCTGCTCAGCCATCAGCAGCCTGCCCGACATC
GTCTTCACCATCAATGGAGTCCAGTACCCCGTGCCACCCAGTGCCTACATCCTGCAGAGCGAGGGGAGCTGCATCAGTGGCTTCCAGGGC
ATGAACGTCCCCACCGAATCTGGAGAGCTTTGGATCCTGGGTGATGTCTTCATCCGCCAGTACTTTACCGTCTTCGACAGGGCAAACAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PLCB3_ENST00000279230_chr11_64023088_+_PGA5_ENST00000312403_chr11_61013418_+_1602nt
CCGGGACAGACTGGCGGGCGGGCGGGCACTGACGCCGCGGGGCCGGAGCGGGCCGCGCGGTGGGAGCAGCGGCGCCGTCGGTCCCCGTCA
GGGCTCCGTGGGTCCCCGACCCGCCCCTGGCCGGGCCATGGCGGGCGCCCAGCCCGGCGTCCACGCGCTGCAGTTGGAGCCGCCCACCGT
GGTGGAGACCCTGCGGCGCGGGAGTAAGTTCATCAAATGGGACGAGGAGACCTCCAGTCGGAACCTGGTGACCCTGCGTGTGGACCCCAA
TGGCTTCTTCTTGTACTGGACGGGCCCCAACATGGAGGTGGACACACTGGACATCAGTTCCATCAGGGACACACGGACAGGCCGGTACGC
CCGCCTGCCCAAGGACCCCAAGATCCGGGAAGTTCTGGGCTTTGGGGGTCCCGATGCCCGGCTGGAGGAGAAGCTGATGACGGTGGTGTC
TGGGCCAGACCCAGTGAACACAGTGTTCTTGAACTTCATGGCCGTGCAGGATGACACAGCCAAGGTCTGGTCTGAGGAGCTATTCAAGCT
GGCTATGAACATCCTGGCTCAGAACGCCTCCCGGAACACCTTCCTGCGCAAAGCATACACGAAGCTGAAGCTGCAGGTGAACCAGGATGG
TCGGATCCCCGTCAAGAACATCCTGAAGATGTTCTCAGCAGACAAGAAGCGGGTGGAGACTGCGCTGGAATCCTGTGGCCTCAAATTCAA
CCGGGTTGGAGGCATCTCTGACACCAATCAGATCTTCGGCCTGAGCGAGACGGAACCTGGCTCCTTCCTGTATTATGCTCCCTTCGATGG
CATCCTGGGGCTGGCCTACCCCAGCATTTCCTCCTCCGGGGCCACACCCGTCTTTGACAACATCTGGAACCAGGGCCTGGTTTCTCAGGA
CCTCTTCTCTGTCTACCTCAGCGCCGATGACAAGAGTGGCAGCGTGGTGATCTTTGGTGGCATTGACTCTTCTTACTACACTGGAAGTCT
GAACTGGGTGCCTGTTACCGTCGAGGGTTACTGGCAGATCACCGTGGACAGCATCACCATGAACGGAGAGACCATCGCCTGTGCTGAGGG
CTGCCAGGCCATTGTTGACACCGGCACCTCTCTGCTGACCGGCCCAACCAGCCCCATTGCCAACATCCAGAGCGACATCGGAGCCAGCGA
GAACTCAGATGGCGACATGGTGGTCAGCTGCTCAGCCATCAGCAGCCTGCCCGACATCGTCTTCACCATCAATGGAGTCCAGTACCCCGT
GCCACCCAGTGCCTACATCCTGCAGAGCGAGGGGAGCTGCATCAGTGGCTTCCAGGGCATGAACGTCCCCACCGAATCTGGAGAGCTTTG
GATCCTGGGTGATGTCTTCATCCGCCAGTACTTTACCGTCTTCGACAGGGCAAACAACCAGGTCGGCCTGGCCCCTGTGGCTTAAGCCTA
AGTCTCTTCAGCCACCTCCCAGGAAGATCTGGCCTCCGTCCTATGCCCACTTTAGATGTATCTAATTCTCCTGACTGTTCTTCCCAGGGG

>In-frame_PLCB3_ENST00000540288_chr11_64023088_+_PGA5_ENST00000312403_chr11_61013418_+_1578nt
GGCACTGACGCCGCGGGGCCGGAGCGGGCCGCGCGGTGGGAGCAGCGGCGCCGTCGGTCCCCGTCAGGGCTCCGTGGGTCCCCGACCCGC
CCCTGGCCGGGCCATGGCGGGCGCCCAGCCCGGCGTCCACGCGCTGCAGTTGGAGCCGCCCACCGTGGTGGAGACCCTGCGGCGCGGGAG
TAAGTTCATCAAATGGGACGAGGAGACCTCCAGTCGGAACCTGGTGACCCTGCGTGTGGACCCCAATGGCTTCTTCTTGTACTGGACGGG
CCCCAACATGGAGGTGGACACACTGGACATCAGTTCCATCAGGGACACACGGACAGGCCGGTACGCCCGCCTGCCCAAGGACCCCAAGAT
CCGGGAAGTTCTGGGCTTTGGGGGTCCCGATGCCCGGCTGGAGGAGAAGCTGATGACGGTGGTGTCTGGGCCAGACCCAGTGAACACAGT
GTTCTTGAACTTCATGGCCGTGCAGGATGACACAGCCAAGGTCTGGTCTGAGGAGCTATTCAAGCTGGCTATGAACATCCTGGCTCAGAA
CGCCTCCCGGAACACCTTCCTGCGCAAAGCATACACGAAGCTGAAGCTGCAGGTGAACCAGGATGGTCGGATCCCCGTCAAGAACATCCT
GAAGATGTTCTCAGCAGACAAGAAGCGGGTGGAGACTGCGCTGGAATCCTGTGGCCTCAAATTCAACCGGGTTGGAGGCATCTCTGACAC
CAATCAGATCTTCGGCCTGAGCGAGACGGAACCTGGCTCCTTCCTGTATTATGCTCCCTTCGATGGCATCCTGGGGCTGGCCTACCCCAG
CATTTCCTCCTCCGGGGCCACACCCGTCTTTGACAACATCTGGAACCAGGGCCTGGTTTCTCAGGACCTCTTCTCTGTCTACCTCAGCGC
CGATGACAAGAGTGGCAGCGTGGTGATCTTTGGTGGCATTGACTCTTCTTACTACACTGGAAGTCTGAACTGGGTGCCTGTTACCGTCGA
GGGTTACTGGCAGATCACCGTGGACAGCATCACCATGAACGGAGAGACCATCGCCTGTGCTGAGGGCTGCCAGGCCATTGTTGACACCGG
CACCTCTCTGCTGACCGGCCCAACCAGCCCCATTGCCAACATCCAGAGCGACATCGGAGCCAGCGAGAACTCAGATGGCGACATGGTGGT
CAGCTGCTCAGCCATCAGCAGCCTGCCCGACATCGTCTTCACCATCAATGGAGTCCAGTACCCCGTGCCACCCAGTGCCTACATCCTGCA
GAGCGAGGGGAGCTGCATCAGTGGCTTCCAGGGCATGAACGTCCCCACCGAATCTGGAGAGCTTTGGATCCTGGGTGATGTCTTCATCCG
CCAGTACTTTACCGTCTTCGACAGGGCAAACAACCAGGTCGGCCTGGCCCCTGTGGCTTAAGCCTAAGTCTCTTCAGCCACCTCCCAGGA
AGATCTGGCCTCCGTCCTATGCCCACTTTAGATGTATCTAATTCTCCTGACTGTTCTTCCCAGGGGAGTGTGAAGGTCTTGGCCCTGTTC

>In-frame_PLCB3_ENST00000325234_chr11_64023088_+_PGA5_ENST00000312403_chr11_61013418_+_1349nt
CCGCGCGGTGGGAGCAGCGGCGCCGTCGGTCCCCGTCAGGGCTCCGTGGGTCCCCGACCCGCCCCTGGCCGGGCCATGGCGGGCGCCCAG
CCCGGCGTCCACGCGCTGCAGTTGGAGCCGCCCACCGTGGTGGAGACCCTGCGGCGCGGGAGTAAGTTCATCAAATGGGACGAGGAGAAG
CTGATGACGGTGGTGTCTGGGCCAGACCCAGTGAACACAGTGTTCTTGAACTTCATGGCCGTGCAGGATGACACAGCCAAGGTCTGGTCT
GAGGAGCTATTCAAGCTGGCTATGAACATCCTGGCTCAGAACGCCTCCCGGAACACCTTCCTGCGCAAAGCATACACGAAGCTGAAGCTG
CAGGTGAACCAGGATGGTCGGATCCCCGTCAAGAACATCCTGAAGATGTTCTCAGCAGACAAGAAGCGGGTGGAGACTGCGCTGGAATCC
TGTGGCCTCAAATTCAACCGGGTTGGAGGCATCTCTGACACCAATCAGATCTTCGGCCTGAGCGAGACGGAACCTGGCTCCTTCCTGTAT
TATGCTCCCTTCGATGGCATCCTGGGGCTGGCCTACCCCAGCATTTCCTCCTCCGGGGCCACACCCGTCTTTGACAACATCTGGAACCAG
GGCCTGGTTTCTCAGGACCTCTTCTCTGTCTACCTCAGCGCCGATGACAAGAGTGGCAGCGTGGTGATCTTTGGTGGCATTGACTCTTCT
TACTACACTGGAAGTCTGAACTGGGTGCCTGTTACCGTCGAGGGTTACTGGCAGATCACCGTGGACAGCATCACCATGAACGGAGAGACC
ATCGCCTGTGCTGAGGGCTGCCAGGCCATTGTTGACACCGGCACCTCTCTGCTGACCGGCCCAACCAGCCCCATTGCCAACATCCAGAGC
GACATCGGAGCCAGCGAGAACTCAGATGGCGACATGGTGGTCAGCTGCTCAGCCATCAGCAGCCTGCCCGACATCGTCTTCACCATCAAT
GGAGTCCAGTACCCCGTGCCACCCAGTGCCTACATCCTGCAGAGCGAGGGGAGCTGCATCAGTGGCTTCCAGGGCATGAACGTCCCCACC
GAATCTGGAGAGCTTTGGATCCTGGGTGATGTCTTCATCCGCCAGTACTTTACCGTCTTCGACAGGGCAAACAACCAGGTCGGCCTGGCC
CCTGTGGCTTAAGCCTAAGTCTCTTCAGCCACCTCCCAGGAAGATCTGGCCTCCGTCCTATGCCCACTTTAGATGTATCTAATTCTCCTG


Top

FusionGenePPI for PLCB3_PGA5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PLCB3TRPM7, SLC9A3R2, KRIT1, NAA16, SNTA1, XRCC5, MOV10, NXF1, SMYD3, SORT1, SYNCRIP, NEDD1, LPAR2, CDH1PGA5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgenePLCB3chr11:64023088chr11:61013418ENST00000279230+7311231_12341991235SHANK2
HgenePLCB3chr11:64023088chr11:61013418ENST00000325234+5291231_12341321168SHANK2
HgenePLCB3chr11:64023088chr11:61013418ENST00000540288+7321231_12341991383SHANK2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PLCB3_PGA5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PLCB3_PGA5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePGA5C0014868Esophagitis1CTD_human