FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27466

FusionGeneSummary for PLAUR_XRCC1

check button Fusion gene summary
Fusion gene informationFusion gene name: PLAUR_XRCC1
Fusion gene ID: 27466
HgeneTgene
Gene symbol

PLAUR

XRCC1

Gene ID

5329

7515

Gene nameplasminogen activator, urokinase receptorX-ray repair cross complementing 1
SynonymsCD87|U-PAR|UPAR|URKRRCC|SCAR26
Cytomap

19q13.31

19q13.31

Type of geneprotein-codingprotein-coding
Descriptionurokinase plasminogen activator surface receptormonocyte activation antigen Mo3u-plasminogen activator receptor form 2urokinase-type plasminogen activator (uPA) receptorDNA repair protein XRCC1X-ray repair complementing defective repair in Chinese hamster cells 1X-ray repair cross-complementing protein 1
Modification date2018052320180523
UniProtAcc

Q03405

P18887

Ensembl transtripts involved in fusion geneENST00000339082, ENST00000601723, 
ENST00000340093, ENST00000221264, 
ENST00000262887, ENST00000543982, 
Fusion gene scores* DoF score6 X 4 X 5=1203 X 3 X 3=27
# samples 63
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PLAUR [Title/Abstract] AND XRCC1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePLAUR

GO:0043388

positive regulation of DNA binding

22984561

TgeneXRCC1

GO:0033194

response to hydroperoxide

28002403


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-55-8094-01APLAURchr19

44156377

-XRCC1chr19

44050258

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000339082ENST00000262887PLAURchr19

44156377

-XRCC1chr19

44050258

-
In-frameENST00000339082ENST00000543982PLAURchr19

44156377

-XRCC1chr19

44050258

-
intron-3CDSENST00000601723ENST00000262887PLAURchr19

44156377

-XRCC1chr19

44050258

-
intron-3CDSENST00000601723ENST00000543982PLAURchr19

44156377

-XRCC1chr19

44050258

-
In-frameENST00000340093ENST00000262887PLAURchr19

44156377

-XRCC1chr19

44050258

-
In-frameENST00000340093ENST00000543982PLAURchr19

44156377

-XRCC1chr19

44050258

-
In-frameENST00000221264ENST00000262887PLAURchr19

44156377

-XRCC1chr19

44050258

-
In-frameENST00000221264ENST00000543982PLAURchr19

44156377

-XRCC1chr19

44050258

-

Top

FusionProtFeatures for PLAUR_XRCC1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PLAUR

Q03405

XRCC1

P18887

Involved in DNA single-strand break repair by mediatingthe assembly of DNA break repair protein complexes. Probablyduring DNA repair, negatively regulates ADP-ribose levels bymodulating ADP-ribosyltransferase PARP1 activity.{ECO:0000269|PubMed:28002403}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLAURchr19:44156377chr19:44050258ENST00000221264-5623_114206291DomainNote=UPAR/Ly6 1
HgenePLAURchr19:44156377chr19:44050258ENST00000339082-67115_213251282DomainNote=UPAR/Ly6 2
HgenePLAURchr19:44156377chr19:44050258ENST00000339082-6723_114251282DomainNote=UPAR/Ly6 1
HgenePLAURchr19:44156377chr19:44050258ENST00000340093-67115_213251336DomainNote=UPAR/Ly6 2
HgenePLAURchr19:44156377chr19:44050258ENST00000340093-6723_114251336DomainNote=UPAR/Ly6 1
TgeneXRCC1chr19:44156377chr19:44050258ENST00000262887-1117538_629475634DomainBRCT 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLAURchr19:44156377chr19:44050258ENST00000221264-56115_213206291DomainNote=UPAR/Ly6 2
HgenePLAURchr19:44156377chr19:44050258ENST00000221264-56214_305206291DomainNote=UPAR/Ly6 3
HgenePLAURchr19:44156377chr19:44050258ENST00000339082-67214_305251282DomainNote=UPAR/Ly6 3
HgenePLAURchr19:44156377chr19:44050258ENST00000340093-67214_305251336DomainNote=UPAR/Ly6 3
TgeneXRCC1chr19:44156377chr19:44050258ENST00000262887-1117315_403475634DomainBRCT 1


Top

FusionGeneSequence for PLAUR_XRCC1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PLAUR_ENST00000339082_chr19_44156377_-_XRCC1_ENST00000262887_chr19_44050258_-_410aa
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSTRTGLKITSLTE
VVCGLDLCNQGNSGRAVTTSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEGQDNGAEDSGDTEDELRR
VAEQKEHRLPPGQEENGEDPTAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFV

>In-frame_PLAUR_ENST00000339082_chr19_44156377_-_XRCC1_ENST00000543982_chr19_44050258_-_410aa
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSTRTGLKITSLTE
VVCGLDLCNQGNSGRAVTTSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEGQDNGAEDSGDTEDELRR
VAEQKEHRLPPGQEENGEDPTAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFV

>In-frame_PLAUR_ENST00000340093_chr19_44156377_-_XRCC1_ENST00000262887_chr19_44050258_-_410aa
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSTRTGLKITSLTE
VVCGLDLCNQGNSGRAVTTSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEGQDNGAEDSGDTEDELRR
VAEQKEHRLPPGQEENGEDPTAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFV

>In-frame_PLAUR_ENST00000340093_chr19_44156377_-_XRCC1_ENST00000543982_chr19_44050258_-_410aa
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSTRTGLKITSLTE
VVCGLDLCNQGNSGRAVTTSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEGQDNGAEDSGDTEDELRR
VAEQKEHRLPPGQEENGEDPTAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFV

>In-frame_PLAUR_ENST00000221264_chr19_44156377_-_XRCC1_ENST00000262887_chr19_44050258_-_365aa
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSTRTGLKITSLTE
VVCGLDLCNQGNSGRAVTTSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEVLELENLPQNGRQCYSCKGNSTH
GCSSEETFLIDCRGPMNQCLVATGTHEGQDNGAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPTAGSTDENTDSEEHQEPPDLPVPEL
PDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLTGV

>In-frame_PLAUR_ENST00000221264_chr19_44156377_-_XRCC1_ENST00000543982_chr19_44050258_-_365aa
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSTRTGLKITSLTE
VVCGLDLCNQGNSGRAVTTSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEVLELENLPQNGRQCYSCKGNSTH
GCSSEETFLIDCRGPMNQCLVATGTHEGQDNGAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPTAGSTDENTDSEEHQEPPDLPVPEL
PDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLTGV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PLAUR_ENST00000339082_chr19_44156377_-_XRCC1_ENST00000262887_chr19_44050258_-_1230nt
ATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCCACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACC
AACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGGACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTG
GAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCAACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAG
GTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTGGCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGT
GGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGAGCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCAC
TGGATCCAGGAAGGTGAAGAAGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGT
TTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCG
CAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCC
ATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGACAATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGG
GTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGAGAATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGAC
AGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCTCCCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTC
CCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTTCAATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTG
ATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGATGGACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGT

>In-frame_PLAUR_ENST00000339082_chr19_44156377_-_XRCC1_ENST00000543982_chr19_44050258_-_1230nt
ATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCCACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACC
AACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGGACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTG
GAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCAACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAG
GTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTGGCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGT
GGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGAGCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCAC
TGGATCCAGGAAGGTGAAGAAGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGT
TTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCG
CAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCC
ATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGACAATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGG
GTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGAGAATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGAC
AGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCTCCCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTC
CCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTTCAATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTG
ATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGATGGACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGT

>In-frame_PLAUR_ENST00000340093_chr19_44156377_-_XRCC1_ENST00000262887_chr19_44050258_-_1230nt
ATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCCACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACC
AACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGGACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTG
GAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCAACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAG
GTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTGGCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGT
GGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGAGCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCAC
TGGATCCAGGAAGGTGAAGAAGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGT
TTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCG
CAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCC
ATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGACAATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGG
GTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGAGAATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGAC
AGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCTCCCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTC
CCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTTCAATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTG
ATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGATGGACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGT

>In-frame_PLAUR_ENST00000340093_chr19_44156377_-_XRCC1_ENST00000543982_chr19_44050258_-_1230nt
ATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCCACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACC
AACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGGACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTG
GAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCAACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAG
GTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTGGCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGT
GGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGAGCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCAC
TGGATCCAGGAAGGTGAAGAAGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGT
TTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCG
CAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCC
ATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGACAATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGG
GTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGAGAATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGAC
AGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCTCCCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTC
CCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTTCAATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTG
ATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGATGGACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGT

>In-frame_PLAUR_ENST00000221264_chr19_44156377_-_XRCC1_ENST00000262887_chr19_44050258_-_1095nt
ATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCCACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACC
AACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGGACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTG
GAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCAACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAG
GTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTGGCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGT
GGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGAGCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCAC
TGGATCCAGGAAGGTGAAGAAGTCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCAT
GGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGAC
AATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGGGTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGAG
AATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGACAGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCTC
CCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTCCCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTTC
AATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTGATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGATG
GACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGTTGCAATGAGAAGCAGAAGTTACTTCCTCACCAGCTCTATGGGGTG

>In-frame_PLAUR_ENST00000221264_chr19_44156377_-_XRCC1_ENST00000543982_chr19_44050258_-_1095nt
ATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCCACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACC
AACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGGACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTG
GAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCAACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAG
GTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTGGCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGT
GGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGAGCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCAC
TGGATCCAGGAAGGTGAAGAAGTCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCAT
GGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGAC
AATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGGGTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGAG
AATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGACAGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCTC
CCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTCCCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTTC
AATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTGATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGATG
GACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGTTGCAATGAGAAGCAGAAGTTACTTCCTCACCAGCTCTATGGGGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PLAUR_ENST00000339082_chr19_44156377_-_XRCC1_ENST00000262887_chr19_44050258_-_1628nt
AGAGAAGACGTGCAGGGACCCCGCGCACAGGAGCTGCCCTCGCGACATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCCACAC
CTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACCAACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGGACCT
CTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTGGAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCAACAG
GACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAGGTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTGGCCG
GGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGTGGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGAGCCT
GCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCACTGGATCCAGGAAGGTGAAGAAGGGCGTCCAAAGGATGACCGCCA
CCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACAC
CACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCA
TGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGA
CAATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGGGTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGA
GAATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGACAGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCT
CCCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTCCCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTT
CAATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTGATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGAT
GGACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGTTGCAATGAGAAGCAGAAGTTACTTCCTCACCAGCTCTATGGGGT
GGTGCCGCAAGCCTGAAGTATGTGCTATACACACACACACACACACACACACACACACACACACACGATGCATTTAATAAAGATGAGTTG
GTTCTCATCCAAGAGTCTCCCAAAACTCTAAGAGGCTCCCTGGGACCTGGGGAAGAATGCTGGGCACCTCCGTCAGAGATCTGGTAGAGA
AGGAACTCTTTGTCTCTTCTGCTTGGCCCCTTATCCCTGTGTTGGCAAGAGGCAGGGAACTGGGAATCTGACCCTCAGCACTGCCCCTCA
ACTTTTTCTGGCCCTCTGAGCCACACCTGTATCTTGGCTGTCCCTTTGTGGCTGGAGGCCTGGGTACCCATGAGGCTTGTCTCTCTCCTG

>In-frame_PLAUR_ENST00000339082_chr19_44156377_-_XRCC1_ENST00000543982_chr19_44050258_-_1356nt
AGAGAAGACGTGCAGGGACCCCGCGCACAGGAGCTGCCCTCGCGACATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCCACAC
CTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACCAACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGGACCT
CTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTGGAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCAACAG
GACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAGGTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTGGCCG
GGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGTGGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGAGCCT
GCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCACTGGATCCAGGAAGGTGAAGAAGGGCGTCCAAAGGATGACCGCCA
CCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACAC
CACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCA
TGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGA
CAATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGGGTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGA
GAATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGACAGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCT
CCCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTCCCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTT
CAATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTGATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGAT
GGACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGTTGCAATGAGAAGCAGAAGTTACTTCCTCACCAGCTCTATGGGGT
GGTGCCGCAAGCCTGAAGTATGTGCTATACACACACACACACACACACACACACACACACACACACGATGCATTTAATAAAGATGAGTTG

>In-frame_PLAUR_ENST00000340093_chr19_44156377_-_XRCC1_ENST00000262887_chr19_44050258_-_1812nt
CAGGGCCGAGCCAGCCCCTTCACCACCAGCCGGCCGCGCCCCGGGAAGGGAAGTTTGTGGCGGAGGAGGTTCGTACGGGAGGAGGGGGAG
GCGCCCACGCATCTGGGGCTGACTCGCTCTTTCGCAAAACGTCTGGGAGGAGTCCCTGGGGCCACAAAACTGCCTCCTTCCTGAGGCCAG
AAGGAGAGAAGACGTGCAGGGACCCCGCGCACAGGAGCTGCCCTCGCGACATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCC
ACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACCAACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGG
ACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTGGAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCA
ACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAGGTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTG
GCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGTGGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGA
GCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCACTGGATCCAGGAAGGTGAAGAAGGGCGTCCAAAGGATGACC
GCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCA
ACACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCA
CCCATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGAC
AGGACAATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGGGTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGG
AGGAGAATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGACAGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTG
AGCTCCCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTCCCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAG
CCTTCAATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTGATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCC
TGATGGACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGTTGCAATGAGAAGCAGAAGTTACTTCCTCACCAGCTCTATG
GGGTGGTGCCGCAAGCCTGAAGTATGTGCTATACACACACACACACACACACACACACACACACACACACGATGCATTTAATAAAGATGA
GTTGGTTCTCATCCAAGAGTCTCCCAAAACTCTAAGAGGCTCCCTGGGACCTGGGGAAGAATGCTGGGCACCTCCGTCAGAGATCTGGTA
GAGAAGGAACTCTTTGTCTCTTCTGCTTGGCCCCTTATCCCTGTGTTGGCAAGAGGCAGGGAACTGGGAATCTGACCCTCAGCACTGCCC
CTCAACTTTTTCTGGCCCTCTGAGCCACACCTGTATCTTGGCTGTCCCTTTGTGGCTGGAGGCCTGGGTACCCATGAGGCTTGTCTCTCT

>In-frame_PLAUR_ENST00000340093_chr19_44156377_-_XRCC1_ENST00000543982_chr19_44050258_-_1540nt
CAGGGCCGAGCCAGCCCCTTCACCACCAGCCGGCCGCGCCCCGGGAAGGGAAGTTTGTGGCGGAGGAGGTTCGTACGGGAGGAGGGGGAG
GCGCCCACGCATCTGGGGCTGACTCGCTCTTTCGCAAAACGTCTGGGAGGAGTCCCTGGGGCCACAAAACTGCCTCCTTCCTGAGGCCAG
AAGGAGAGAAGACGTGCAGGGACCCCGCGCACAGGAGCTGCCCTCGCGACATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCC
ACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACCAACGGGGATTGCCGTGTGGAAGAGTGCGCCCTGGGACAGG
ACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTGGAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCA
ACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAGGTTGTGTGTGGGTTAGACTTGTGCAACCAGGGCAACTCTG
GCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGTGGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGA
GCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCACTGGATCCAGGAAGGTGAAGAAGGGCGTCCAAAGGATGACC
GCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCA
ACACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCA
CCCATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGAC
AGGACAATGGGGCGGAAGATTCTGGGGACACAGAGGATGAGCTGAGGAGGGTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGG
AGGAGAATGGGGAAGACCCGTATGCAGGCTCCACGGATGAGAACACGGACAGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTG
AGCTCCCAGATTTCTTCCAGGGCAAGCACTTCTTTCTTTACGGGGAGTTCCCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAG
CCTTCAATGGGGAGCTCGAGGACAATATGAGTGACCGGGTTCAGTTTGTGATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCC
TGATGGACAACCCCTCCCTGGCATTCGTTCGTCCCCGATGGATCTACAGTTGCAATGAGAAGCAGAAGTTACTTCCTCACCAGCTCTATG
GGGTGGTGCCGCAAGCCTGAAGTATGTGCTATACACACACACACACACACACACACACACACACACACACGATGCATTTAATAAAGATGA

>In-frame_PLAUR_ENST00000221264_chr19_44156377_-_XRCC1_ENST00000262887_chr19_44050258_-_1874nt
CAGTATCCCTCCTGACAAAACTAACAAAAATCCTGTTAGCCAAATAATCAGCCACATTCATATTTACCGTCAAAGTTTTTATCCTCATTT
TACAGCAGTGGAGAGCGATTGCCCCGGGTCCCACGTTAGGAAGAGAGAGAACTGGGATTTGCACCCAGGCAATCTGGGGACAGAGCTGTG
ATCACAACTCCATGAGTCAGGGCCGAGCCAGCCCCTTCACCACCAGCCGGCCGCGCCCCGGGAAGGGAAGTTTGTGGCGGAGGAGGTTCG
TACGGGAGGAGGGGGAGGCGCCCACGCATCTGGGGCTGACTCGCTCTTTCGCAAAACGTCTGGGAGGAGTCCCTGGGGCCACAAAACTGC
CTCCTTCCTGAGGCCAGAAGGAGAGAAGACGTGCAGGGACCCCGCGCACAGGAGCTGCCCTCGCGACATGGGTCACCCGCCGCTGCTGCC
GCTGCTGCTGCTGCTCCACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACCAACGGGGATTGCCGTGTGGAAGA
GTGCGCCCTGGGACAGGACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTGGAGCTGGTGGAGAAAAGCTGTAC
CCACTCAGAGAAGACCAACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAGGTTGTGTGTGGGTTAGACTTGTG
CAACCAGGGCAACTCTGGCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGTGGCTCATCAGACATGAGCTGTGA
GAGGGGCCGGCACCAGAGCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCACTGGATCCAGGAAGGTGAAGAAGT
CCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACTTT
CCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGACAATGGGGCGGAAGATTCTGGGGA
CACAGAGGATGAGCTGAGGAGGGTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGAGAATGGGGAAGACCCGTATGCAGG
CTCCACGGATGAGAACACGGACAGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCTCCCAGATTTCTTCCAGGGCAAGCA
CTTCTTTCTTTACGGGGAGTTCCCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTTCAATGGGGAGCTCGAGGACAATAT
GAGTGACCGGGTTCAGTTTGTGATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGATGGACAACCCCTCCCTGGCATTCGT
TCGTCCCCGATGGATCTACAGTTGCAATGAGAAGCAGAAGTTACTTCCTCACCAGCTCTATGGGGTGGTGCCGCAAGCCTGAAGTATGTG
CTATACACACACACACACACACACACACACACACACACACACGATGCATTTAATAAAGATGAGTTGGTTCTCATCCAAGAGTCTCCCAAA
ACTCTAAGAGGCTCCCTGGGACCTGGGGAAGAATGCTGGGCACCTCCGTCAGAGATCTGGTAGAGAAGGAACTCTTTGTCTCTTCTGCTT
GGCCCCTTATCCCTGTGTTGGCAAGAGGCAGGGAACTGGGAATCTGACCCTCAGCACTGCCCCTCAACTTTTTCTGGCCCTCTGAGCCAC

>In-frame_PLAUR_ENST00000221264_chr19_44156377_-_XRCC1_ENST00000543982_chr19_44050258_-_1602nt
CAGTATCCCTCCTGACAAAACTAACAAAAATCCTGTTAGCCAAATAATCAGCCACATTCATATTTACCGTCAAAGTTTTTATCCTCATTT
TACAGCAGTGGAGAGCGATTGCCCCGGGTCCCACGTTAGGAAGAGAGAGAACTGGGATTTGCACCCAGGCAATCTGGGGACAGAGCTGTG
ATCACAACTCCATGAGTCAGGGCCGAGCCAGCCCCTTCACCACCAGCCGGCCGCGCCCCGGGAAGGGAAGTTTGTGGCGGAGGAGGTTCG
TACGGGAGGAGGGGGAGGCGCCCACGCATCTGGGGCTGACTCGCTCTTTCGCAAAACGTCTGGGAGGAGTCCCTGGGGCCACAAAACTGC
CTCCTTCCTGAGGCCAGAAGGAGAGAAGACGTGCAGGGACCCCGCGCACAGGAGCTGCCCTCGCGACATGGGTCACCCGCCGCTGCTGCC
GCTGCTGCTGCTGCTCCACACCTGCGTCCCAGCCTCTTGGGGCCTGCGGTGCATGCAGTGTAAGACCAACGGGGATTGCCGTGTGGAAGA
GTGCGCCCTGGGACAGGACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTGGAGCTGGTGGAGAAAAGCTGTAC
CCACTCAGAGAAGACCAACAGGACCCTGAGCTATCGGACTGGCTTGAAGATCACCAGCCTTACCGAGGTTGTGTGTGGGTTAGACTTGTG
CAACCAGGGCAACTCTGGCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGTGGCTCATCAGACATGAGCTGTGA
GAGGGGCCGGCACCAGAGCCTGCAGTGCCGCAGCCCTGAAGAACAGTGCCTGGATGTGGTGACCCACTGGATCCAGGAAGGTGAAGAAGT
CCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACTTT
CCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAAGGACAGGACAATGGGGCGGAAGATTCTGGGGA
CACAGAGGATGAGCTGAGGAGGGTGGCAGAGCAGAAGGAACACAGACTGCCCCCTGGCCAGGAGGAGAATGGGGAAGACCCGTATGCAGG
CTCCACGGATGAGAACACGGACAGTGAGGAACACCAGGAGCCTCCTGATCTGCCAGTCCCTGAGCTCCCAGATTTCTTCCAGGGCAAGCA
CTTCTTTCTTTACGGGGAGTTCCCTGGGGACGAGCGGCGGAAACTCATCCGATACGTCACAGCCTTCAATGGGGAGCTCGAGGACAATAT
GAGTGACCGGGTTCAGTTTGTGATCACAGCACAGGAATGGGATCCCAGCTTTGAGGAGGCCCTGATGGACAACCCCTCCCTGGCATTCGT
TCGTCCCCGATGGATCTACAGTTGCAATGAGAAGCAGAAGTTACTTCCTCACCAGCTCTATGGGGTGGTGCCGCAAGCCTGAAGTATGTG


Top

FusionGenePPI for PLAUR_XRCC1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PLAURITGB2, KNG1, EEF1A1, PFN2, FAP, ITGAM, PLAU, IGF2R, LRP1, JAK1, TYK2, PSAP, OXCT1, CTSA, CTTN, SELENBP1, SCAF4, VMA21, HDLBP, SDHAF2, UBQLN2, WDHD1, NOTCH2, TXNDC17, TBCA, ELAVL1, LYN, TEX101, TUBB3, GYLTL1B, LARGE, PKN1, PXDN, ZNF146, MBTPS1, DNA2, TAZ, LAMB2, POGLUT1, POMGNT2, ARSA, GALNS, EXT1, CHSY1, CHSY3, DDX11, DDX11L8, TUBA1A, LOXL2, ADCK1, MAN2A1, SPCS2, EOGT, NAGLU, DNAJB9, NDST2, NDST1, SGSH, ARSK, FUT11, DARS2, CNTNAP3B, MAN1A1, MGAT4B, PI4K2B, PCYOX1, FASTKD3, PCSK5, CDYL, MGAT5, LEPREL2, RPUSD3, GCLM, GALNT18, ARSB, HUS1, MELK, EMILIN3, TATDN2, CERCAM, DHFRL1, TRMT11, KIAA0391, HOXD13, DHRS4, MANEA, CCRN4L, PLTP, NR2F2, ST3GAL4, UBE3A, PPOX, MAN2A2, NEK4, EGFL7, PCYOX1L, XRCC3, MCM9, TOP2B, GLB1, TUBA4A, BMP8B, TXNDC16XRCC1LIG3, PNKP, APTX, POLB, NEIL1, PCNA, PARP1, TP53, OGG1, APEX1, PARP2, CHD1L, NCAPG, RAN, POLK, POLD1, ARL6IP5, RNF146, XPO1, POLI, CAND1, PPT1, SEPT11, RBM4, UBAP2L, S100A16, SEC22B, MRPL12, TIMELESS, CSNK2A1, RPA3, RPA2, RPA1, CUL7, EED, UBE2I, RNF166, APLF, HIST1H2BA, NTRK1, HIST1H2BG, C1QBP, RAP1B, CDK2AP1, BRPF1, PPFIA1, GTF2IRD1, PPIH, XPOT, SF3B6, ZAK, SLC39A10, GCC1, RPUSD4, DPH7, CREB1, MAX, FOXB1, FOXD3, FOXP1, NF2, HSP90AA1, RBBP8, NFATC2, PRKDC, CDC14B, PCDHB11, XRCC6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PLAUR_XRCC1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePLAURQ03405DB00009AlteplaseUrokinase plasminogen activator surface receptorbiotechapproved
HgenePLAURQ03405DB00029AnistreplaseUrokinase plasminogen activator surface receptorbiotechapproved
HgenePLAURQ03405DB00031TenecteplaseUrokinase plasminogen activator surface receptorbiotechapproved
HgenePLAURQ03405DB00015ReteplaseUrokinase plasminogen activator surface receptorbiotechapproved|investigational
HgenePLAURQ03405DB00013UrokinaseUrokinase plasminogen activator surface receptorbiotechapproved|investigational|withdrawn

Top

RelatedDiseases for PLAUR_XRCC1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePLAURC0004352Autistic Disorder2CTD_human
HgenePLAURC0021368Inflammation1CTD_human
HgenePLAURC0027626Neoplasm Invasiveness1CTD_human
HgenePLAURC0027627Neoplasm Metastasis1CTD_human
HgenePLAURC0033578Prostatic Neoplasms1CTD_human
HgenePLAURC3495559Juvenile arthritis1CTD_human
TgeneXRCC1C0033578Prostatic Neoplasms3CTD_human
TgeneXRCC1C0025500Mesothelioma2CTD_human
TgeneXRCC1C1449861Micronuclei, Chromosome-Defective2CTD_human
TgeneXRCC1C0005612Birth Weight1CTD_human
TgeneXRCC1C0017638Glioma1CTD_human
TgeneXRCC1C0028797Occupational Diseases1CTD_human
TgeneXRCC1C0036341Schizophrenia1PSYGENET
TgeneXRCC1C0038356Stomach Neoplasms1CTD_human
TgeneXRCC1C0038362Stomatitis1CTD_human
TgeneXRCC1C0041834Erythema1CTD_human
TgeneXRCC1C0279626Squamous cell carcinoma of esophagus1CTD_human
TgeneXRCC1C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human