FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27436

FusionGeneSummary for PLA2G2A_ITGA6

check button Fusion gene summary
Fusion gene informationFusion gene name: PLA2G2A_ITGA6
Fusion gene ID: 27436
HgeneTgene
Gene symbol

PLA2G2A

ITGA6

Gene ID

5320

3655

Gene namephospholipase A2 group IIAintegrin subunit alpha 6
SynonymsMOM1|PLA2|PLA2B|PLA2L|PLA2S|PLAS1|sPLA2CD49f|ITGA6B|VLA-6
Cytomap

1p36.13

2q31.1

Type of geneprotein-codingprotein-coding
Descriptionphospholipase A2, membrane associatedGIIC sPLA2NPS-PLA2group IIA phospholipase A2non-pancreatic secretory phospholipase A2phosphatidylcholine 2-acylhydrolase 2Aphospholipase A2, group IIA (platelets, synovial fluid)integrin alpha-6CD49 antigen-like family member Fintegrin alpha6Bintegrin, alpha 6
Modification date2018051920180522
UniProtAcc

P14555

P23229

Ensembl transtripts involved in fusion geneENST00000400520, ENST00000496748, 
ENST00000375111, 
ENST00000409532, 
ENST00000264107, ENST00000343713, 
ENST00000264106, ENST00000375221, 
ENST00000409080, 
Fusion gene scores* DoF score6 X 2 X 1=123 X 3 X 2=18
# samples 63
** MAII scorelog2(6/12*10)=2.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PLA2G2A [Title/Abstract] AND ITGA6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePLA2G2A

GO:0006644

phospholipid metabolic process

17069818

HgenePLA2G2A

GO:0046473

phosphatidic acid metabolic process

9032461

HgenePLA2G2A

GO:0070374

positive regulation of ERK1 and ERK2 cascade

22837859


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-G9-6348-01APLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000400520ENST00000409532PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
intron-3CDSENST00000400520ENST00000264107PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
intron-3CDSENST00000400520ENST00000343713PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
intron-3CDSENST00000400520ENST00000264106PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
intron-3CDSENST00000400520ENST00000375221PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
intron-3CDSENST00000400520ENST00000409080PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
Frame-shitENST00000496748ENST00000409532PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
Frame-shitENST00000496748ENST00000264107PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
Frame-shitENST00000496748ENST00000343713PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
Frame-shitENST00000496748ENST00000264106PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
Frame-shitENST00000496748ENST00000375221PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
Frame-shitENST00000496748ENST00000409080PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
In-frameENST00000375111ENST00000409532PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
In-frameENST00000375111ENST00000264107PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
In-frameENST00000375111ENST00000343713PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
In-frameENST00000375111ENST00000264106PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
In-frameENST00000375111ENST00000375221PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+
In-frameENST00000375111ENST00000409080PLA2G2Achr1

20301931

-ITGA6chr2

173351992

+

Top

FusionProtFeatures for PLA2G2A_ITGA6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PLA2G2A

P14555

ITGA6

P23229

Catalyzes the calcium-dependent hydrolysis of the 2-acylgroups in 3-sn-phosphoglycerides (PubMed:2925633). Thought toparticipate in the regulation of phospholipid metabolism inbiomembranes including eicosanoid biosynthesis. Independent of itscatalytic activity, acts as a ligand for integrins(PubMed:18635536, PubMed:25398877). Binds to and activatesintegrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1(PubMed:18635536, PubMed:25398877). Binds to a site (site 2) whichis distinct from the classical ligand-binding site (site 1) andinduces integrin conformational changes and enhanced ligandbinding to site 1 (PubMed:25398877). Induces cell proliferation inan integrin-dependent manner (PubMed:18635536).{ECO:0000269|PubMed:18635536, ECO:0000269|PubMed:25398877,ECO:0000269|PubMed:2925633}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PLA2G2A_ITGA6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000409532_chr2_173351992_+_417aa
SKRCTRTSSKRSEGTCFRNNSDKQPFQPKESHKRWR_RP_G_TDCNVSRHFNLFCI_RTEGFP_ETVELCCQPEWLAS_L_ARKSF_KKF
KCHFLFGFKYN_SHL_HPRSGT_SEVRNNKQSR_FGSNYS_SKSGT_TAFIGLGSC_TFPGVFWRYSCWRASTEI_R_SGKFNRV_IQGN
KLR_TSYKPRHSNLEHSVAKRN_QWEMVALFGESRIQRIGKGNL_ATKGDKLPEPNGVSQLKKETGNY_KTDR__QKIFFIC_KKIPDS_
L_RERELCEHQMPAAGAGQQGVSTFALEVMEQHISRGIFQTELLGHSHASLH_CDCCCRKTQAAKCRHSGSSDCVSLKDCSSVFGSTLVD

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000264107_chr2_173351992_+_417aa
SKRCTRTSSKRSEGTCFRNNSDKQPFQPKESHKRWR_RP_G_TDCNVSRHFNLFCI_RTEGFP_ETVELCCQPEWLAS_L_ARKSF_KKF
KCHFLFGFKYN_SHL_HPRSGT_SEVRNNKQSR_FGSNYS_SKSGT_TAFIGLGSC_TFPGVFWRYSCWRASTEI_R_SGKFNRV_IQGN
KLR_TSYKPRHSNLEHSVAKRN_QWEMVALFGESRIQRIGKGNL_ATKGDKLPEPNGVSQLKKETGNY_KTDR__QKIFFIC_KKIPDS_
L_RERELCEHQMPAAGAGQQGVSTFALEVMEQHISRGIFQTELLGHSHASLH_CDCCCRKTQAAKCRHSGSSDCVSLKDCSSVFGSTLVD

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000343713_chr2_173351992_+_417aa
SKRCTRTSSKRSEGTCFRNNSDKQPFQPKESHKRWR_RP_G_TDCNVSRHFNLFCI_RTEGFP_ETVELCCQPEWLAS_L_ARKSF_KKF
KCHFLFGFKYN_SHL_HPRSGT_SEVRNNKQSR_FGSNYS_SKSGT_TAFIGLGSC_TFPGVFWRYSCWRASTEI_R_SGKFNRV_IQGN
KLR_TSYKPRHSNLEHSVAKRN_QWEMVALFGESRIQRIGKGNL_ATKGDKLPEPNGVSQLKKETGNY_KTDR__QKIFFIC_KKIPDS_
L_RERELCEHQMPAAGAGQQGVSTFALEVMEQHISRGIFQTELLGHSHASLH_CDCCCRKTQAAKCRHSGSSDCVSLKDCSSVFGSTLVD

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000264106_chr2_173351992_+_435aa
SKRCTRTSSKRSEGTCFRNNSDKQPFQPKESHKRWR_RP_G_TDCNVSRHFNLFCI_RTEGFP_ETVELCCQPEWLAS_L_ARKSF_KKF
KCHFLFGFKYN_SHL_HPRSGT_SEVRNNKQSR_FGSNYS_SKSGT_TAFIGLGSC_TFPGVFWRYSCWRASTEI_R_SGKFNRV_IQGN
KLR_TSYKPRHSNLEHSVAKRN_QWEMVALFGESRIQRIGKGNL_ATKGDKLPEPNGVSQLKKETGNY_KTDR__QKIFFIC_KKIPDS_
L_RERELCEHQMPAAGAGQQGVSTFALEVMEQHISRGIFQTELLGHSHASLH_CDCCCRKTQAAKCRHSGSSDCVSLKDCSSVFGSTLVD

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000375221_chr2_173351992_+_417aa
SKRCTRTSSKRSEGTCFRNNSDKQPFQPKESHKRWR_RP_G_TDCNVSRHFNLFCI_RTEGFP_ETVELCCQPEWLAS_L_ARKSF_KKF
KCHFLFGFKYN_SHL_HPRSGT_SEVRNNKQSR_FGSNYS_SKSGT_TAFIGLGSC_TFPGVFWRYSCWRASTEI_R_SGKFNRV_IQGN
KLR_TSYKPRHSNLEHSVAKRN_QWEMVALFGESRIQRIGKGNL_ATKGDKLPEPNGVSQLKKETGNY_KTDR__QKIFFIC_KKIPDS_
L_RERELCEHQMPAAGAGQQGVSTFALEVMEQHISRGIFQTELLGHSHASLH_CDCCCRKTQAAKCRHSGSSDCVSLKDCSSVFGSTLVD

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000409080_chr2_173351992_+_435aa
SKRCTRTSSKRSEGTCFRNNSDKQPFQPKESHKRWR_RP_G_TDCNVSRHFNLFCI_RTEGFP_ETVELCCQPEWLAS_L_ARKSF_KKF
KCHFLFGFKYN_SHL_HPRSGT_SEVRNNKQSR_FGSNYS_SKSGT_TAFIGLGSC_TFPGVFWRYSCWRASTEI_R_SGKFNRV_IQGN
KLR_TSYKPRHSNLEHSVAKRN_QWEMVALFGESRIQRIGKGNL_ATKGDKLPEPNGVSQLKKETGNY_KTDR__QKIFFIC_KKIPDS_
L_RERELCEHQMPAAGAGQQGVSTFALEVMEQHISRGIFQTELLGHSHASLH_CDCCCRKTQAAKCRHSGSSDCVSLKDCSSVFGSTLVD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000409532_chr2_173351992_+_1252nt
TCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAA
TCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAG
GGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTC
AAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAG
CAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCA
GGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAAT
AAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTA
TTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAA
CTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAA
CTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATG
GAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAA
TATCAGGCTGCCAAATGCAGGCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGAT
CATCCTAGTGGCTATTCTCGCTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGTTTCTTCAAGAGAAATAAGAA

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000264107_chr2_173351992_+_1252nt
TCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAA
TCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAG
GGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTC
AAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAG
CAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCA
GGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAAT
AAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTA
TTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAA
CTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAA
CTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATG
GAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAA
TATCAGGCTGCCAAATGCAGGCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGAT
CATCCTAGTGGCTATTCTCGCTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGTTTCTTCAAGAGAAATAAGAA

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000343713_chr2_173351992_+_1252nt
TCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAA
TCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAG
GGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTC
AAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAG
CAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCA
GGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAAT
AAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTA
TTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAA
CTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAA
CTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATG
GAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAA
TATCAGGCTGCCAAATGCAGGCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGAT
CATCCTAGTGGCTATTCTCGCTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGTTTCTTCAAGAGAAATAAGAA

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000264106_chr2_173351992_+_1306nt
TCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAA
TCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAG
GGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTC
AAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAG
CAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCA
GGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAAT
AAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTA
TTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAA
CTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAA
CTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATG
GAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAA
TATCAGGCTGCCAAATGCAGGCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGAT
CATCCTAGTGGCTATTCTCGCTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGATTCTTTAAACGCTCTAGGTA
CGATGACAGTGTTCCCCGATACCATGCTGTAAGGATCCGGAAAGAAGAGCGAGAGATCAAAGATGAAAAGTATATTGATAACCTTGAAAA

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000375221_chr2_173351992_+_1252nt
TCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAA
TCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAG
GGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTC
AAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAG
CAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCA
GGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAAT
AAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTA
TTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAA
CTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAA
CTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATG
GAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAA
TATCAGGCTGCCAAATGCAGGCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGAT
CATCCTAGTGGCTATTCTCGCTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGTTTCTTCAAGAGAAATAAGAA

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000409080_chr2_173351992_+_1306nt
TCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAA
TCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAG
GGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTC
AAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAG
CAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCA
GGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAAT
AAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTA
TTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAA
CTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAA
CTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATG
GAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAA
TATCAGGCTGCCAAATGCAGGCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGAT
CATCCTAGTGGCTATTCTCGCTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGATTCTTTAAACGCTCTAGGTA
CGATGACAGTGTTCCCCGATACCATGCTGTAAGGATCCGGAAAGAAGAGCGAGAGATCAAAGATGAAAAGTATATTGATAACCTTGAAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000409532_chr2_173351992_+_2688nt
GAAGGAAAAAGAGCAACAGATCCAGGGAGCATTCACCTGCCCTGTCTCCAAACAGCCTTGTGCCTCACCTACCCCCAACCTCCCAGAGGG
AGCAGCTATTTAAGGGGAGCAGGAGTGCAGAACAAACAAGACGGCCTGGGGATACAACTCTGGAGTCCTCTGAGAGAGCCACCAAGGAGG
AGCAGGGGAGCGACGGCCGGGGCAGAAGTTGAGACCACCCAGCAGAGGAGCTAGGCCAGTCCATCTGCATTTGTCACCCAAGAACTCTTA
CCATGAAGACCCTCCTACTGTTGGCAGTGATCATGATCTTTGGCCTACTGCAGGCCCATGGGAATTTGGTGAATTTCCACAGAATGATCA
AGTTGACGACAGGAAAGGAAGCCGCACTCAGTTATGGCTTCTACGGCTGCCACTGTGGCGTGGGTGGCAGAGGATCCCCCAAGGATGCAA
CGGATCGCTGCTGTGTCACTCATGACTGTTGCTACAAACGTCTGGAGAAACGTGGATGTGGCACCAAATTTCTGAGCTACAAGTTTAGCA
ACTCGGGGAGCAGAATCACCTGTGCAAAACAGGACTCCTGCAGAAGTCAACTGTGTGAGTGTGATAAGGCTGCTGCCACCTGTTTTGCTA
GAAACAAGACGACCTACAATAAAAAGTACCAGTACTATTCCAATAAACACTGCAGAGGGAGCACCCCTCGTTGCTGAGTCCCCTCTTCCC
TGGAAACCTTCCACCCAGTGCTGAATTTCCCTCTCTCATACCCTCCCTCCCTACCCTAACCAAGTTCCTTGGCCATGCAGAAAGCATCCC
TCACCCATCCTAGAGGCCAGGCAGGAGCCCTTCTATACCCACCCAGAATGAGACATCCAGCAGATTTCCAGCCTTCTACTGCTCTCCTCC
ACCTCAACTCCGTGCTTAACCAAAGAAGCTGTACTCCGGGGGGTCTCTTCTGAATAAAGCAATTAGCAAATCAAAAAGGTGTACCAGAAC
TAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATG
ACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGT
TGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGG
TTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTC
CAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAG
TTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTA
CAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCA
AAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAA
TTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACT
GTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGG
AATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAG
GCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGATCATCCTAGTGGCTATTCTCG
CTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGTTTCTTCAAGAGAAATAAGAAAGATCATTATGATGCCACAT
ATCACAAGGCTGAGATCCATGCTCAGCCATCTGATAAAGAGAGGCTTACTTCTGATGCATAGTATTGATCTACTTCTGTAATTGTGTGGA
TTCTTTAAACGCTCTAGGTACGATGACAGTGTTCCCCGATACCATGCTGTAAGGATCCGGAAAGAAGAGCGAGAGATCAAAGATGAAAAG
TATATTGATAACCTTGAAAAAAAACAGTGGATCACAAAGTGGAACGAAAATGAAAGCTACTCATAGCGGGGGCCTAAAAAAAAAAAGCTT
CACAGTACCCAAACTGCTTTTTCCAACTCAGAAATTCAATTTGGATTTAAAAGCCTGCTCAATCCCTGAGGACTGATTTCAGAGTGACTA
CACACAGTACGAACCTACAGTTTTAACTGTGGATATTGTTACGTAGCCTAAGGCTCCTGTTTTGCACAGCCAAATTTAAAACTGTTGGAA

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000264107_chr2_173351992_+_4384nt
GAAGGAAAAAGAGCAACAGATCCAGGGAGCATTCACCTGCCCTGTCTCCAAACAGCCTTGTGCCTCACCTACCCCCAACCTCCCAGAGGG
AGCAGCTATTTAAGGGGAGCAGGAGTGCAGAACAAACAAGACGGCCTGGGGATACAACTCTGGAGTCCTCTGAGAGAGCCACCAAGGAGG
AGCAGGGGAGCGACGGCCGGGGCAGAAGTTGAGACCACCCAGCAGAGGAGCTAGGCCAGTCCATCTGCATTTGTCACCCAAGAACTCTTA
CCATGAAGACCCTCCTACTGTTGGCAGTGATCATGATCTTTGGCCTACTGCAGGCCCATGGGAATTTGGTGAATTTCCACAGAATGATCA
AGTTGACGACAGGAAAGGAAGCCGCACTCAGTTATGGCTTCTACGGCTGCCACTGTGGCGTGGGTGGCAGAGGATCCCCCAAGGATGCAA
CGGATCGCTGCTGTGTCACTCATGACTGTTGCTACAAACGTCTGGAGAAACGTGGATGTGGCACCAAATTTCTGAGCTACAAGTTTAGCA
ACTCGGGGAGCAGAATCACCTGTGCAAAACAGGACTCCTGCAGAAGTCAACTGTGTGAGTGTGATAAGGCTGCTGCCACCTGTTTTGCTA
GAAACAAGACGACCTACAATAAAAAGTACCAGTACTATTCCAATAAACACTGCAGAGGGAGCACCCCTCGTTGCTGAGTCCCCTCTTCCC
TGGAAACCTTCCACCCAGTGCTGAATTTCCCTCTCTCATACCCTCCCTCCCTACCCTAACCAAGTTCCTTGGCCATGCAGAAAGCATCCC
TCACCCATCCTAGAGGCCAGGCAGGAGCCCTTCTATACCCACCCAGAATGAGACATCCAGCAGATTTCCAGCCTTCTACTGCTCTCCTCC
ACCTCAACTCCGTGCTTAACCAAAGAAGCTGTACTCCGGGGGGTCTCTTCTGAATAAAGCAATTAGCAAATCAAAAAGGTGTACCAGAAC
TAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATG
ACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGT
TGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGG
TTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTC
CAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAG
TTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTA
CAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCA
AAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAA
TTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACT
GTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGG
AATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAG
GCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGATCATCCTAGTGGCTATTCTCG
CTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGTTTCTTCAAGAGAAATAAGAAAGATCATTATGATGCCACAT
ATCACAAGGCTGAGATCCATGCTCAGCCATCTGATAAAGAGAGGCTTACTTCTGATGCATAGTATTGATCTACTTCTGTAATTGTGTGGA
TTCTTTAAACGCTCTAGGTACGATGACAGTGTTCCCCGATACCATGCTGTAAGGATCCGGAAAGAAGAGCGAGAGATCAAAGATGAAAAG
TATATTGATAACCTTGAAAAAAAACAGTGGATCACAAAGTGGAACGAAAATGAAAGCTACTCATAGCGGGGGCCTAAAAAAAAAAAGCTT
CACAGTACCCAAACTGCTTTTTCCAACTCAGAAATTCAATTTGGATTTAAAAGCCTGCTCAATCCCTGAGGACTGATTTCAGAGTGACTA
CACACAGTACGAACCTACAGTTTTAACTGTGGATATTGTTACGTAGCCTAAGGCTCCTGTTTTGCACAGCCAAATTTAAAACTGTTGGAA
TGGATTTTTCTTTAACTGCCGTAATTTAACTTTCTGGGTTGCCTTTATTTTTGGCGTGGCTGACTTACATCATGTGTTGGGGAAGGGCCT
GCCCAGTTGCACTCAGGTGACATCCTCCAGATAGTGTAGCTGAGGAGGCACCTACACTCACCTGCACTAACAGAGTGGCCGTCCTAACCT
CGGGCCTGCTGCGCAGACGTCCATCACGTTAGCTGTCCCACATCACAAGACTATGCCATTGGGGTAGTTGTGTTTCAACGGAAAGTGCTG
TCTTAAACTAAATGTGCAATAGAAGGTGATGTTGCCATCCTACCGTCTTTTCCTGTTTCCTAGCTGTGTGAATACCTGCTCACGTCAAAT
GCATACAAGTTTCATTCTCCCTTTCACTAAAACACACAGGTGCAACAGACTTGAATGCTAGTTATACTTATTTGTATATGGTATTTATTT
TTTCTTTTCTTTACAAACCATTTTGTTATTGACTAACAGGCCAAAGAGTCTCCAGTTTACCCTTCAGGTTGGTTTAATCAATCAGAATTA
GAGCATGGGAGGTCATCACTTTGACCTAAATTATTTACTGCAAAAAGAAAATCTTTATAAATGTACCAGAGAGAGTTGTTTTAATAACTT
ATCTATAAACTATAACCTCTCCTTCATGACAGCCTCCACCCCACAACCCAAAAGGTTTAAGAAATAGAATTATAACTGTAAAGATGTTTA
TTTCAGGCATTGGATATTTTTTACTTTAGAAGCCTGCATAATGTTTCTGGATTTCATACTGTAACATTCAGGAATTCTTGGAGAAAATGG
GTTTATTCACTGAACTCTAGTGCGGTTTACTCACTGCTGCAAATACTGTATATTCAGGACTTGAAAGAAATGGTGAATGCCTATGGTGGA
TCCAAACTGATCCAGTATAAGACTACTGAATCTGCTACCAAAACAGTTAATCAGTGAGTCGATGTTCTATTTTTTGTTTTGTTTCCTCCC
CTATCTGTATTCCCAAAAATTACTTTGGGGCTAATTTAACAAGAACTTTAAATTGTGTTTTAATTGTAAAAATGGCAGGGGGTGGAATTA
TTACTCTATACATTCAACAGAGACTGAATAGATATGAAAGCTGATTTTTTTTAATTACCATGCTTCACAATGTTAAGTTATATGGGGAGC
AACAGCAAACAGGTGCTAATTTGTTTTGGATATAGTATAAGCAGTGTCTGTGTTTTGAAAGAATAGAACACAGTTTGTAGTGCCACTGTT
GTTTTGGGGGGGCTTTTTTCTTTTCGGAAATCTTAAACCTTAAGATACTAAGGACGTTGTTTTGGTTGTACTTTGGAATTCTTAGTCACA
AAATATATTTTGTTTACAAAAATTTCTGTAAAACAGGTTATAACAGTGTTTAAAGTCTCAGTTTCTTGCTTGGGGAACTTGTGTCCCTAA
TGTGTTTAGATTGCTAGATTGCTAAGGAGCTGATACTTTGACAGTGTTTTTAGACCTGTGTTACTAAAAAAAAGATGAATGTCCTGAAAA
GGGTGTTGGGAGGGTGGTTCAACAAAGAAACAAAGATGTTATGGTGTTTAGATTTATGGTTGTTAAAAATGTCATCTCAAGTCAAGTCAC
TGGTCTGTTTGCATTTGATACATTTTTGTACTAACTAGCATTGTAAAATTATTTCATGATTAGAAATTACCTGTGGATATTTGTATAAAA

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000343713_chr2_173351992_+_4607nt
GAAGGAAAAAGAGCAACAGATCCAGGGAGCATTCACCTGCCCTGTCTCCAAACAGCCTTGTGCCTCACCTACCCCCAACCTCCCAGAGGG
AGCAGCTATTTAAGGGGAGCAGGAGTGCAGAACAAACAAGACGGCCTGGGGATACAACTCTGGAGTCCTCTGAGAGAGCCACCAAGGAGG
AGCAGGGGAGCGACGGCCGGGGCAGAAGTTGAGACCACCCAGCAGAGGAGCTAGGCCAGTCCATCTGCATTTGTCACCCAAGAACTCTTA
CCATGAAGACCCTCCTACTGTTGGCAGTGATCATGATCTTTGGCCTACTGCAGGCCCATGGGAATTTGGTGAATTTCCACAGAATGATCA
AGTTGACGACAGGAAAGGAAGCCGCACTCAGTTATGGCTTCTACGGCTGCCACTGTGGCGTGGGTGGCAGAGGATCCCCCAAGGATGCAA
CGGATCGCTGCTGTGTCACTCATGACTGTTGCTACAAACGTCTGGAGAAACGTGGATGTGGCACCAAATTTCTGAGCTACAAGTTTAGCA
ACTCGGGGAGCAGAATCACCTGTGCAAAACAGGACTCCTGCAGAAGTCAACTGTGTGAGTGTGATAAGGCTGCTGCCACCTGTTTTGCTA
GAAACAAGACGACCTACAATAAAAAGTACCAGTACTATTCCAATAAACACTGCAGAGGGAGCACCCCTCGTTGCTGAGTCCCCTCTTCCC
TGGAAACCTTCCACCCAGTGCTGAATTTCCCTCTCTCATACCCTCCCTCCCTACCCTAACCAAGTTCCTTGGCCATGCAGAAAGCATCCC
TCACCCATCCTAGAGGCCAGGCAGGAGCCCTTCTATACCCACCCAGAATGAGACATCCAGCAGATTTCCAGCCTTCTACTGCTCTCCTCC
ACCTCAACTCCGTGCTTAACCAAAGAAGCTGTACTCCGGGGGGTCTCTTCTGAATAAAGCAATTAGCAAATCAAAAAGGTGTACCAGAAC
TAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATG
ACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGT
TGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGG
TTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTC
CAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAG
TTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTA
CAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCA
AAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAA
TTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACT
GTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGG
AATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAG
GCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGATCATCCTAGTGGCTATTCTCG
CTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGTTTCTTCAAGAGAAATAAGAAAGATCATTATGATGCCACAT
ATCACAAGGCTGAGATCCATGCTCAGCCATCTGATAAAGAGAGGCTTACTTCTGATGCATAGTATTGATCTACTTCTGTAATTGTGTGGA
TTCTTTAAACGCTCTAGGTACGATGACAGTGTTCCCCGATACCATGCTGTAAGGATCCGGAAAGAAGAGCGAGAGATCAAAGATGAAAAG
TATATTGATAACCTTGAAAAAAAACAGTGGATCACAAAGTGGAACGAAAATGAAAGCTACTCATAGCGGGGGCCTAAAAAAAAAAAGCTT
CACAGTACCCAAACTGCTTTTTCCAACTCAGAAATTCAATTTGGATTTAAAAGCCTGCTCAATCCCTGAGGACTGATTTCAGAGTGACTA
CACACAGTACGAACCTACAGTTTTAACTGTGGATATTGTTACGTAGCCTAAGGCTCCTGTTTTGCACAGCCAAATTTAAAACTGTTGGAA
TGGATTTTTCTTTAACTGCCGTAATTTAACTTTCTGGGTTGCCTTTATTTTTGGCGTGGCTGACTTACATCATGTGTTGGGGAAGGGCCT
GCCCAGTTGCACTCAGGTGACATCCTCCAGATAGTGTAGCTGAGGAGGCACCTACACTCACCTGCACTAACAGAGTGGCCGTCCTAACCT
CGGGCCTGCTGCGCAGACGTCCATCACGTTAGCTGTCCCACATCACAAGACTATGCCATTGGGGTAGTTGTGTTTCAACGGAAAGTGCTG
TCTTAAACTAAATGTGCAATAGAAGGTGATGTTGCCATCCTACCGTCTTTTCCTGTTTCCTAGCTGTGTGAATACCTGCTCACGTCAAAT
GCATACAAGTTTCATTCTCCCTTTCACTAAAACACACAGGTGCAACAGACTTGAATGCTAGTTATACTTATTTGTATATGGTATTTATTT
TTTCTTTTCTTTACAAACCATTTTGTTATTGACTAACAGGCCAAAGAGTCTCCAGTTTACCCTTCAGGTTGGTTTAATCAATCAGAATTA
GAGCATGGGAGGTCATCACTTTGACCTAAATTATTTACTGCAAAAAGAAAATCTTTATAAATGTACCAGAGAGAGTTGTTTTAATAACTT
ATCTATAAACTATAACCTCTCCTTCATGACAGCCTCCACCCCACAACCCAAAAGGTTTAAGAAATAGAATTATAACTGTAAAGATGTTTA
TTTCAGGCATTGGATATTTTTTACTTTAGAAGCCTGCATAATGTTTCTGGATTTCATACTGTAACATTCAGGAATTCTTGGAGAAAATGG
GTTTATTCACTGAACTCTAGTGCGGTTTACTCACTGCTGCAAATACTGTATATTCAGGACTTGAAAGAAATGGTGAATGCCTATGGTGGA
TCCAAACTGATCCAGTATAAGACTACTGAATCTGCTACCAAAACAGTTAATCAGTGAGTCGATGTTCTATTTTTTGTTTTGTTTCCTCCC
CTATCTGTATTCCCAAAAATTACTTTGGGGCTAATTTAACAAGAACTTTAAATTGTGTTTTAATTGTAAAAATGGCAGGGGGTGGAATTA
TTACTCTATACATTCAACAGAGACTGAATAGATATGAAAGCTGATTTTTTTTAATTACCATGCTTCACAATGTTAAGTTATATGGGGAGC
AACAGCAAACAGGTGCTAATTTGTTTTGGATATAGTATAAGCAGTGTCTGTGTTTTGAAAGAATAGAACACAGTTTGTAGTGCCACTGTT
GTTTTGGGGGGGCTTTTTTCTTTTCGGAAATCTTAAACCTTAAGATACTAAGGACGTTGTTTTGGTTGTACTTTGGAATTCTTAGTCACA
AAATATATTTTGTTTACAAAAATTTCTGTAAAACAGGTTATAACAGTGTTTAAAGTCTCAGTTTCTTGCTTGGGGAACTTGTGTCCCTAA
TGTGTTTAGATTGCTAGATTGCTAAGGAGCTGATACTTTGACAGTGTTTTTAGACCTGTGTTACTAAAAAAAAGATGAATGTCCTGAAAA
GGGTGTTGGGAGGGTGGTTCAACAAAGAAACAAAGATGTTATGGTGTTTAGATTTATGGTTGTTAAAAATGTCATCTCAAGTCAAGTCAC
TGGTCTGTTTGCATTTGATACATTTTTGTACTAACTAGCATTGTAAAATTATTTCATGATTAGAAATTACCTGTGGATATTTGTATAAAA
GTGTGAAATAAATTTTTTATAAAAGTGTTCATTGTTTCGTAACACAGCATTGTATATGTGAAGCAAACTCTAAAATTATAAATGACAACC
TGAATTATCTATTTCATCAAACCAAAGTTCAGTGTTTTTATTTTTGGTGTCTCATGTAATCTCAGATCAGCCAAAGATACTAGTGCCAAA
GCAATGGGATTCGGGGTTTTTTTCTGTTTTCGCTCTATGTAGGTGATCCTCAAGTCTTTCATTTTCCTTCTTTATGATTAAAAGAAACCT

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000264106_chr2_173351992_+_4477nt
GAAGGAAAAAGAGCAACAGATCCAGGGAGCATTCACCTGCCCTGTCTCCAAACAGCCTTGTGCCTCACCTACCCCCAACCTCCCAGAGGG
AGCAGCTATTTAAGGGGAGCAGGAGTGCAGAACAAACAAGACGGCCTGGGGATACAACTCTGGAGTCCTCTGAGAGAGCCACCAAGGAGG
AGCAGGGGAGCGACGGCCGGGGCAGAAGTTGAGACCACCCAGCAGAGGAGCTAGGCCAGTCCATCTGCATTTGTCACCCAAGAACTCTTA
CCATGAAGACCCTCCTACTGTTGGCAGTGATCATGATCTTTGGCCTACTGCAGGCCCATGGGAATTTGGTGAATTTCCACAGAATGATCA
AGTTGACGACAGGAAAGGAAGCCGCACTCAGTTATGGCTTCTACGGCTGCCACTGTGGCGTGGGTGGCAGAGGATCCCCCAAGGATGCAA
CGGATCGCTGCTGTGTCACTCATGACTGTTGCTACAAACGTCTGGAGAAACGTGGATGTGGCACCAAATTTCTGAGCTACAAGTTTAGCA
ACTCGGGGAGCAGAATCACCTGTGCAAAACAGGACTCCTGCAGAAGTCAACTGTGTGAGTGTGATAAGGCTGCTGCCACCTGTTTTGCTA
GAAACAAGACGACCTACAATAAAAAGTACCAGTACTATTCCAATAAACACTGCAGAGGGAGCACCCCTCGTTGCTGAGTCCCCTCTTCCC
TGGAAACCTTCCACCCAGTGCTGAATTTCCCTCTCTCATACCCTCCCTCCCTACCCTAACCAAGTTCCTTGGCCATGCAGAAAGCATCCC
TCACCCATCCTAGAGGCCAGGCAGGAGCCCTTCTATACCCACCCAGAATGAGACATCCAGCAGATTTCCAGCCTTCTACTGCTCTCCTCC
ACCTCAACTCCGTGCTTAACCAAAGAAGCTGTACTCCGGGGGGTCTCTTCTGAATAAAGCAATTAGCAAATCAAAAAGGTGTACCAGAAC
TAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATG
ACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGT
TGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGG
TTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTC
CAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAG
TTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTA
CAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCA
AAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAA
TTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACT
GTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGG
AATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAG
GCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGATCATCCTAGTGGCTATTCTCG
CTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGATTCTTTAAACGCTCTAGGTACGATGACAGTGTTCCCCGAT
ACCATGCTGTAAGGATCCGGAAAGAAGAGCGAGAGATCAAAGATGAAAAGTATATTGATAACCTTGAAAAAAAACAGTGGATCACAAAGT
GGAACGAAAATGAAAGCTACTCATAGCGGGGGCCTAAAAAAAAAAAGCTTCACAGTACCCAAACTGCTTTTTCCAACTCAGAAATTCAAT
TTGGATTTAAAAGCCTGCTCAATCCCTGAGGACTGATTTCAGAGTGACTACACACAGTACGAACCTACAGTTTTAACTGTGGATATTGTT
ACGTAGCCTAAGGCTCCTGTTTTGCACAGCCAAATTTAAAACTGTTGGAATGGATTTTTCTTTAACTGCCGTAATTTAACTTTCTGGGTT
GCCTTTATTTTTGGCGTGGCTGACTTACATCATGTGTTGGGGAAGGGCCTGCCCAGTTGCACTCAGGTGACATCCTCCAGATAGTGTAGC
TGAGGAGGCACCTACACTCACCTGCACTAACAGAGTGGCCGTCCTAACCTCGGGCCTGCTGCGCAGACGTCCATCACGTTAGCTGTCCCA
CATCACAAGACTATGCCATTGGGGTAGTTGTGTTTCAACGGAAAGTGCTGTCTTAAACTAAATGTGCAATAGAAGGTGATGTTGCCATCC
TACCGTCTTTTCCTGTTTCCTAGCTGTGTGAATACCTGCTCACGTCAAATGCATACAAGTTTCATTCTCCCTTTCACTAAAACACACAGG
TGCAACAGACTTGAATGCTAGTTATACTTATTTGTATATGGTATTTATTTTTTCTTTTCTTTACAAACCATTTTGTTATTGACTAACAGG
CCAAAGAGTCTCCAGTTTACCCTTCAGGTTGGTTTAATCAATCAGAATTAGAGCATGGGAGGTCATCACTTTGACCTAAATTATTTACTG
CAAAAAGAAAATCTTTATAAATGTACCAGAGAGAGTTGTTTTAATAACTTATCTATAAACTATAACCTCTCCTTCATGACAGCCTCCACC
CCACAACCCAAAAGGTTTAAGAAATAGAATTATAACTGTAAAGATGTTTATTTCAGGCATTGGATATTTTTTACTTTAGAAGCCTGCATA
ATGTTTCTGGATTTCATACTGTAACATTCAGGAATTCTTGGAGAAAATGGGTTTATTCACTGAACTCTAGTGCGGTTTACTCACTGCTGC
AAATACTGTATATTCAGGACTTGAAAGAAATGGTGAATGCCTATGGTGGATCCAAACTGATCCAGTATAAGACTACTGAATCTGCTACCA
AAACAGTTAATCAGTGAGTCGATGTTCTATTTTTTGTTTTGTTTCCTCCCCTATCTGTATTCCCAAAAATTACTTTGGGGCTAATTTAAC
AAGAACTTTAAATTGTGTTTTAATTGTAAAAATGGCAGGGGGTGGAATTATTACTCTATACATTCAACAGAGACTGAATAGATATGAAAG
CTGATTTTTTTTAATTACCATGCTTCACAATGTTAAGTTATATGGGGAGCAACAGCAAACAGGTGCTAATTTGTTTTGGATATAGTATAA
GCAGTGTCTGTGTTTTGAAAGAATAGAACACAGTTTGTAGTGCCACTGTTGTTTTGGGGGGGCTTTTTTCTTTTCGGAAATCTTAAACCT
TAAGATACTAAGGACGTTGTTTTGGTTGTACTTTGGAATTCTTAGTCACAAAATATATTTTGTTTACAAAAATTTCTGTAAAACAGGTTA
TAACAGTGTTTAAAGTCTCAGTTTCTTGCTTGGGGAACTTGTGTCCCTAATGTGTTTAGATTGCTAGATTGCTAAGGAGCTGATACTTTG
ACAGTGTTTTTAGACCTGTGTTACTAAAAAAAAGATGAATGTCCTGAAAAGGGTGTTGGGAGGGTGGTTCAACAAAGAAACAAAGATGTT
ATGGTGTTTAGATTTATGGTTGTTAAAAATGTCATCTCAAGTCAAGTCACTGGTCTGTTTGCATTTGATACATTTTTGTACTAACTAGCA
TTGTAAAATTATTTCATGATTAGAAATTACCTGTGGATATTTGTATAAAAGTGTGAAATAAATTTTTTATAAAAGTGTTCATTGTTTCGT
AACACAGCATTGTATATGTGAAGCAAACTCTAAAATTATAAATGACAACCTGAATTATCTATTTCATCAAACCAAAGTTCAGTGTTTTTA
TTTTTGGTGTCTCATGTAATCTCAGATCAGCCAAAGATACTAGTGCCAAAGCAATGGGATTCGGGGTTTTTTTCTGTTTTCGCTCTATGT

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000375221_chr2_173351992_+_4607nt
GAAGGAAAAAGAGCAACAGATCCAGGGAGCATTCACCTGCCCTGTCTCCAAACAGCCTTGTGCCTCACCTACCCCCAACCTCCCAGAGGG
AGCAGCTATTTAAGGGGAGCAGGAGTGCAGAACAAACAAGACGGCCTGGGGATACAACTCTGGAGTCCTCTGAGAGAGCCACCAAGGAGG
AGCAGGGGAGCGACGGCCGGGGCAGAAGTTGAGACCACCCAGCAGAGGAGCTAGGCCAGTCCATCTGCATTTGTCACCCAAGAACTCTTA
CCATGAAGACCCTCCTACTGTTGGCAGTGATCATGATCTTTGGCCTACTGCAGGCCCATGGGAATTTGGTGAATTTCCACAGAATGATCA
AGTTGACGACAGGAAAGGAAGCCGCACTCAGTTATGGCTTCTACGGCTGCCACTGTGGCGTGGGTGGCAGAGGATCCCCCAAGGATGCAA
CGGATCGCTGCTGTGTCACTCATGACTGTTGCTACAAACGTCTGGAGAAACGTGGATGTGGCACCAAATTTCTGAGCTACAAGTTTAGCA
ACTCGGGGAGCAGAATCACCTGTGCAAAACAGGACTCCTGCAGAAGTCAACTGTGTGAGTGTGATAAGGCTGCTGCCACCTGTTTTGCTA
GAAACAAGACGACCTACAATAAAAAGTACCAGTACTATTCCAATAAACACTGCAGAGGGAGCACCCCTCGTTGCTGAGTCCCCTCTTCCC
TGGAAACCTTCCACCCAGTGCTGAATTTCCCTCTCTCATACCCTCCCTCCCTACCCTAACCAAGTTCCTTGGCCATGCAGAAAGCATCCC
TCACCCATCCTAGAGGCCAGGCAGGAGCCCTTCTATACCCACCCAGAATGAGACATCCAGCAGATTTCCAGCCTTCTACTGCTCTCCTCC
ACCTCAACTCCGTGCTTAACCAAAGAAGCTGTACTCCGGGGGGTCTCTTCTGAATAAAGCAATTAGCAAATCAAAAAGGTGTACCAGAAC
TAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATG
ACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGT
TGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGG
TTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTC
CAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAG
TTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTA
CAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCA
AAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAA
TTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACT
GTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGG
AATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAG
GCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGATCATCCTAGTGGCTATTCTCG
CTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGTTTCTTCAAGAGAAATAAGAAAGATCATTATGATGCCACAT
ATCACAAGGCTGAGATCCATGCTCAGCCATCTGATAAAGAGAGGCTTACTTCTGATGCATAGTATTGATCTACTTCTGTAATTGTGTGGA
TTCTTTAAACGCTCTAGGTACGATGACAGTGTTCCCCGATACCATGCTGTAAGGATCCGGAAAGAAGAGCGAGAGATCAAAGATGAAAAG
TATATTGATAACCTTGAAAAAAAACAGTGGATCACAAAGTGGAACGAAAATGAAAGCTACTCATAGCGGGGGCCTAAAAAAAAAAAGCTT
CACAGTACCCAAACTGCTTTTTCCAACTCAGAAATTCAATTTGGATTTAAAAGCCTGCTCAATCCCTGAGGACTGATTTCAGAGTGACTA
CACACAGTACGAACCTACAGTTTTAACTGTGGATATTGTTACGTAGCCTAAGGCTCCTGTTTTGCACAGCCAAATTTAAAACTGTTGGAA
TGGATTTTTCTTTAACTGCCGTAATTTAACTTTCTGGGTTGCCTTTATTTTTGGCGTGGCTGACTTACATCATGTGTTGGGGAAGGGCCT
GCCCAGTTGCACTCAGGTGACATCCTCCAGATAGTGTAGCTGAGGAGGCACCTACACTCACCTGCACTAACAGAGTGGCCGTCCTAACCT
CGGGCCTGCTGCGCAGACGTCCATCACGTTAGCTGTCCCACATCACAAGACTATGCCATTGGGGTAGTTGTGTTTCAACGGAAAGTGCTG
TCTTAAACTAAATGTGCAATAGAAGGTGATGTTGCCATCCTACCGTCTTTTCCTGTTTCCTAGCTGTGTGAATACCTGCTCACGTCAAAT
GCATACAAGTTTCATTCTCCCTTTCACTAAAACACACAGGTGCAACAGACTTGAATGCTAGTTATACTTATTTGTATATGGTATTTATTT
TTTCTTTTCTTTACAAACCATTTTGTTATTGACTAACAGGCCAAAGAGTCTCCAGTTTACCCTTCAGGTTGGTTTAATCAATCAGAATTA
GAGCATGGGAGGTCATCACTTTGACCTAAATTATTTACTGCAAAAAGAAAATCTTTATAAATGTACCAGAGAGAGTTGTTTTAATAACTT
ATCTATAAACTATAACCTCTCCTTCATGACAGCCTCCACCCCACAACCCAAAAGGTTTAAGAAATAGAATTATAACTGTAAAGATGTTTA
TTTCAGGCATTGGATATTTTTTACTTTAGAAGCCTGCATAATGTTTCTGGATTTCATACTGTAACATTCAGGAATTCTTGGAGAAAATGG
GTTTATTCACTGAACTCTAGTGCGGTTTACTCACTGCTGCAAATACTGTATATTCAGGACTTGAAAGAAATGGTGAATGCCTATGGTGGA
TCCAAACTGATCCAGTATAAGACTACTGAATCTGCTACCAAAACAGTTAATCAGTGAGTCGATGTTCTATTTTTTGTTTTGTTTCCTCCC
CTATCTGTATTCCCAAAAATTACTTTGGGGCTAATTTAACAAGAACTTTAAATTGTGTTTTAATTGTAAAAATGGCAGGGGGTGGAATTA
TTACTCTATACATTCAACAGAGACTGAATAGATATGAAAGCTGATTTTTTTTAATTACCATGCTTCACAATGTTAAGTTATATGGGGAGC
AACAGCAAACAGGTGCTAATTTGTTTTGGATATAGTATAAGCAGTGTCTGTGTTTTGAAAGAATAGAACACAGTTTGTAGTGCCACTGTT
GTTTTGGGGGGGCTTTTTTCTTTTCGGAAATCTTAAACCTTAAGATACTAAGGACGTTGTTTTGGTTGTACTTTGGAATTCTTAGTCACA
AAATATATTTTGTTTACAAAAATTTCTGTAAAACAGGTTATAACAGTGTTTAAAGTCTCAGTTTCTTGCTTGGGGAACTTGTGTCCCTAA
TGTGTTTAGATTGCTAGATTGCTAAGGAGCTGATACTTTGACAGTGTTTTTAGACCTGTGTTACTAAAAAAAAGATGAATGTCCTGAAAA
GGGTGTTGGGAGGGTGGTTCAACAAAGAAACAAAGATGTTATGGTGTTTAGATTTATGGTTGTTAAAAATGTCATCTCAAGTCAAGTCAC
TGGTCTGTTTGCATTTGATACATTTTTGTACTAACTAGCATTGTAAAATTATTTCATGATTAGAAATTACCTGTGGATATTTGTATAAAA
GTGTGAAATAAATTTTTTATAAAAGTGTTCATTGTTTCGTAACACAGCATTGTATATGTGAAGCAAACTCTAAAATTATAAATGACAACC
TGAATTATCTATTTCATCAAACCAAAGTTCAGTGTTTTTATTTTTGGTGTCTCATGTAATCTCAGATCAGCCAAAGATACTAGTGCCAAA
GCAATGGGATTCGGGGTTTTTTTCTGTTTTCGCTCTATGTAGGTGATCCTCAAGTCTTTCATTTTCCTTCTTTATGATTAAAAGAAACCT

>In-frame_PLA2G2A_ENST00000375111_chr1_20301931_-_ITGA6_ENST00000409080_chr2_173351992_+_4298nt
GAAGGAAAAAGAGCAACAGATCCAGGGAGCATTCACCTGCCCTGTCTCCAAACAGCCTTGTGCCTCACCTACCCCCAACCTCCCAGAGGG
AGCAGCTATTTAAGGGGAGCAGGAGTGCAGAACAAACAAGACGGCCTGGGGATACAACTCTGGAGTCCTCTGAGAGAGCCACCAAGGAGG
AGCAGGGGAGCGACGGCCGGGGCAGAAGTTGAGACCACCCAGCAGAGGAGCTAGGCCAGTCCATCTGCATTTGTCACCCAAGAACTCTTA
CCATGAAGACCCTCCTACTGTTGGCAGTGATCATGATCTTTGGCCTACTGCAGGCCCATGGGAATTTGGTGAATTTCCACAGAATGATCA
AGTTGACGACAGGAAAGGAAGCCGCACTCAGTTATGGCTTCTACGGCTGCCACTGTGGCGTGGGTGGCAGAGGATCCCCCAAGGATGCAA
CGGATCGCTGCTGTGTCACTCATGACTGTTGCTACAAACGTCTGGAGAAACGTGGATGTGGCACCAAATTTCTGAGCTACAAGTTTAGCA
ACTCGGGGAGCAGAATCACCTGTGCAAAACAGGACTCCTGCAGAAGTCAACTGTGTGAGTGTGATAAGGCTGCTGCCACCTGTTTTGCTA
GAAACAAGACGACCTACAATAAAAAGTACCAGTACTATTCCAATAAACACTGCAGAGGGAGCACCCCTCGTTGCTGAGTCCCCTCTTCCC
TGGAAACCTTCCACCCAGTGCTGAATTTCCCTCTCTCATACCCTCCCTCCCTACCCTAACCAAGTTCCTTGGCCATGCAGAAAGCATCCC
TCACCCATCCTAGAGGCCAGGCAGGAGCCCTTCTATACCCACCCAGAATGAGACATCCAGCAGATTTCCAGCCTTCTACTGCTCTCCTCC
ACCTCAACTCCGTGCTTAACCAAAGAAGCTGTACTCCGGGGGGTCTCTTCTGAATAAAGCAATTAGCAAATCAAAAAGGTGTACCAGAAC
TAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATG
ACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGT
TGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGG
TTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTC
CAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAG
TTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTA
CAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCA
AAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAA
TTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACT
GTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGG
AATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAG
GCACTCAGGTTCGAGTGACTGTGTTTCCCTCAAAGACTGTAGCTCAGTATTCGGGAGTACCTTGGTGGATCATCCTAGTGGCTATTCTCG
CTGGGATCTTGATGCTTGCTTTATTAGTGTTTATACTATGGAAGTGTGGATTCTTTAAACGCTCTAGGTACGATGACAGTGTTCCCCGAT
ACCATGCTGTAAGGATCCGGAAAGAAGAGCGAGAGATCAAAGATGAAAAGTATATTGATAACCTTGAAAAAAAACAGTGGATCACAAAGT
GGAACGAAAATGAAAGCTACTCATAGCGGGGGCCTAAAAAAAAAAAGCTTCACAGTACCCAAACTGCTTTTTCCAACTCAGAAATTCAAT
TTGGATTTAAAAGCCTGCTCAATCCCTGAGGACTGATTTCAGAGTGACTACACACAGTACGAACCTACAGTTTTAACTGTGGATATTGTT
ACGTAGCCTAAGGCTCCTGTTTTGCACAGCCAAATTTAAAACTGTTGGAATGGATTTTTCTTTAACTGCCGTAATTTAACTTTCTGGGTT
GCCTTTATTTTTGGCGTGGCTGACTTACATCATGTGTTGGGGAAGGGCCTGCCCAGTTGCACTCAGGTGACATCCTCCAGATAGTGTAGC
TGAGGAGGCACCTACACTCACCTGCACTAACAGAGTGGCCGTCCTAACCTCGGGCCTGCTGCGCAGACGTCCATCACGTTAGCTGTCCCA
CATCACAAGACTATGCCATTGGGGTAGTTGTGTTTCAACGGAAAGTGCTGTCTTAAACTAAATGTGCAATAGAAGGTGATGTTGCCATCC
TACCGTCTTTTCCTGTTTCCTAGCTGTGTGAATACCTGCTCACGTCAAATGCATACAAGTTTCATTCTCCCTTTCACTAAAACACACAGG
TGCAACAGACTTGAATGCTAGTTATACTTATTTGTATATGGTATTTATTTTTTCTTTTCTTTACAAACCATTTTGTTATTGACTAACAGG
CCAAAGAGTCTCCAGTTTACCCTTCAGGTTGGTTTAATCAATCAGAATTAGAGCATGGGAGGTCATCACTTTGACCTAAATTATTTACTG
CAAAAAGAAAATCTTTATAAATGTACCAGAGAGAGTTGTTTTAATAACTTATCTATAAACTATAACCTCTCCTTCATGACAGCCTCCACC
CCACAACCCAAAAGGTTTAAGAAATAGAATTATAACTGTAAAGATGTTTATTTCAGGCATTGGATATTTTTTACTTTAGAAGCCTGCATA
ATGTTTCTGGATTTCATACTGTAACATTCAGGAATTCTTGGAGAAAATGGGTTTATTCACTGAACTCTAGTGCGGTTTACTCACTGCTGC
AAATACTGTATATTCAGGACTTGAAAGAAATGGTGAATGCCTATGGTGGATCCAAACTGATCCAGTATAAGACTACTGAATCTGCTACCA
AAACAGTTAATCAGTGAGTCGATGTTCTATTTTTTGTTTTGTTTCCTCCCCTATCTGTATTCCCAAAAATTACTTTGGGGCTAATTTAAC
AAGAACTTTAAATTGTGTTTTAATTGTAAAAATGGCAGGGGGTGGAATTATTACTCTATACATTCAACAGAGACTGAATAGATATGAAAG
CTGATTTTTTTTAATTACCATGCTTCACAATGTTAAGTTATATGGGGAGCAACAGCAAACAGGTGCTAATTTGTTTTGGATATAGTATAA
GCAGTGTCTGTGTTTTGAAAGAATAGAACACAGTTTGTAGTGCCACTGTTGTTTTGGGGGGGCTTTTTTCTTTTCGGAAATCTTAAACCT
TAAGATACTAAGGACGTTGTTTTGGTTGTACTTTGGAATTCTTAGTCACAAAATATATTTTGTTTACAAAAATTTCTGTAAAACAGGTTA
TAACAGTGTTTAAAGTCTCAGTTTCTTGCTTGGGGAACTTGTGTCCCTAATGTGTTTAGATTGCTAGATTGCTAAGGAGCTGATACTTTG
ACAGTGTTTTTAGACCTGTGTTACTAAAAAAAAGATGAATGTCCTGAAAAGGGTGTTGGGAGGGTGGTTCAACAAAGAAACAAAGATGTT
ATGGTGTTTAGATTTATGGTTGTTAAAAATGTCATCTCAAGTCAAGTCACTGGTCTGTTTGCATTTGATACATTTTTGTACTAACTAGCA
TTGTAAAATTATTTCATGATTAGAAATTACCTGTGGATATTTGTATAAAAGTGTGAAATAAATTTTTTATAAAAGTGTTCATTGTTTCGT


Top

FusionGenePPI for PLA2G2A_ITGA6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PLA2G2APLA2G1B, DCN, CEP70, BAG6, PLA2G2A, VIM, UCHL5, UCHL3, USP8, USP7, USP5, USP47, USP4, USP28, USP20, USP2, USP15, UCHL1, SENP6, JOSD2, SENP8, KRAS, ALOX12, ITGAV, ITGB3, TGM2ITGA6GIPC1, TSPAN4, ITGB1, CD36, RABIF, BIN1, CALM1, APP, PDIA3, MOV10, NXF1, LGALS8, MCOLN3, HLA-C, B4GALT4, HLA-E, BTNL8, CANT1, PTCH1, PICK1, PON2, LGALS3BP, TMEM17, CDH1, CTDSPL, TSPAN11, PCDHGA5, TMPRSS11B, TMED6, HLA-DRB1, GML, PCDHB16, PCDH20, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PLA2G2A_ITGA6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePLA2G2AP14555DB00328IndomethacinPhospholipase A2, membrane associatedsmall moleculeapproved|investigational
HgenePLA2G2AP14555DB02325Isopropyl AlcoholPhospholipase A2, membrane associatedsmall moleculeapproved|investigational
HgenePLA2G2AP14555DB04786SuraminPhospholipase A2, membrane associatedsmall moleculeapproved|investigational
HgenePLA2G2AP14555DB01381Ginkgo bilobaPhospholipase A2, membrane associatedsmall moleculeapproved|investigational|nutraceutical
HgenePLA2G2AP14555DB00586DiclofenacPhospholipase A2, membrane associatedsmall moleculeapproved|vet_approved

Top

RelatedDiseases for PLA2G2A_ITGA6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePLA2G2AC0005586Bipolar Disorder2PSYGENET
HgenePLA2G2AC0004153Atherosclerosis1CTD_human
HgenePLA2G2AC0011581Depressive disorder1PSYGENET
HgenePLA2G2AC0014175Endometriosis1CTD_human
HgenePLA2G2AC0035126Reperfusion Injury1CTD_human
HgenePLA2G2AC0151744Myocardial Ischemia1CTD_human
HgenePLA2G2AC0349218Recurrent depressive disorder, unspecified1PSYGENET
HgenePLA2G2AC1839839MAJOR AFFECTIVE DISORDER 21PSYGENET
TgeneITGA6C0003873Rheumatoid Arthritis1CTD_human