FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27100

FusionGeneSummary for PICALM_MLLT10

check button Fusion gene summary
Fusion gene informationFusion gene name: PICALM_MLLT10
Fusion gene ID: 27100
HgeneTgene
Gene symbol

PICALM

MLLT10

Gene ID

8301

8028

Gene namephosphatidylinositol binding clathrin assembly proteinMLLT10, histone lysine methyltransferase DOT1L cofactor
SynonymsCALM|CLTH|LAPAF10
Cytomap

11q14.2

10p12.31

Type of geneprotein-codingprotein-coding
Descriptionphosphatidylinositol-binding clathrin assembly proteinclathrin assembly lymphoid myeloid leukemia proteinprotein AF-10ALL1-fused gene from chromosome 10 proteinmyeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10myeloid/lymphoid or mixed-lineage leukemia; translocated to, 10type I AF10 proteintype III AF10 prot
Modification date2018052320180522
UniProtAcc

Q13492

P55197

Ensembl transtripts involved in fusion geneENST00000532317, ENST00000526033, 
ENST00000393346, ENST00000528398, 
ENST00000356360, ENST00000528411, 
ENST00000446906, ENST00000377072, 
ENST00000307729, ENST00000377059, 
ENST00000495130, ENST00000377100, 
ENST00000377091, 
Fusion gene scores* DoF score10 X 10 X 5=5005 X 15 X 3=225
# samples 1520
** MAII scorelog2(15/500*10)=-1.73696559416621
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/225*10)=-0.169925001442312
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PICALM [Title/Abstract] AND MLLT10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePICALM

GO:0006898

receptor-mediated endocytosis

10436022

HgenePICALM

GO:0032880

regulation of protein localization

10436022

HgenePICALM

GO:0045893

positive regulation of transcription, DNA-templated

11425879

HgenePICALM

GO:0048261

negative regulation of receptor-mediated endocytosis

10436022

TgeneMLLT10

GO:0045944

positive regulation of transcription by RNA polymerase II

17868029


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLAMLTCGA-AB-2855-03APICALMchr11

85685751

-MLLT10chr10

21940602

+
TCGARVLAMLTCGA-AB-2849-03APICALMchr11

85685751

-MLLT10chr10

21940602

+
TCGALDLAMLTCGA-AB-2849-03APICALMchr11

85692172

-MLLT10chr10

21940602

+
TCGALDLAMLTCGA-AB-2855-03APICALMchr11

85685751

-MLLT10chr10

21949952

+
ChiTaRS3.1AF060932PICALMchr11

85692172

-MLLT10chr10

21875222

+
ChiTaRS3.1EF051633PICALMchr11

85685751

-MLLT10chr10

21959376

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000532317ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000532317ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000532317ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000532317ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000532317ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000532317ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000532317ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000526033ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000526033ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000526033ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000526033ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000526033ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000526033ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000526033ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000393346ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000393346ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000393346ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000393346ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000393346ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000393346ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000393346ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21940602

+
Frame-shitENST00000528398ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21940602

+
Frame-shitENST00000528398ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21940602

+
Frame-shitENST00000528398ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21940602

+
Frame-shitENST00000528398ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000528398ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000528398ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000528398ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000356360ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000356360ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000356360ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000356360ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000356360ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000356360ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21940602

+
5CDS-intronENST00000356360ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21940602

+
intron-3CDSENST00000528411ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21940602

+
intron-3CDSENST00000528411ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21940602

+
intron-3CDSENST00000528411ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21940602

+
intron-3CDSENST00000528411ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21940602

+
intron-intronENST00000528411ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21940602

+
intron-intronENST00000528411ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21940602

+
intron-intronENST00000528411ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21940602

+
In-frameENST00000532317ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000532317ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000532317ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000532317ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000532317ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000532317ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000532317ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000526033ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000526033ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000526033ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000526033ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000526033ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000526033ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000526033ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000393346ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000393346ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000393346ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000393346ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000393346ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000393346ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000393346ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21940602

+
Frame-shitENST00000528398ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21940602

+
Frame-shitENST00000528398ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21940602

+
Frame-shitENST00000528398ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21940602

+
Frame-shitENST00000528398ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000528398ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000528398ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000528398ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000356360ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000356360ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000356360ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21940602

+
In-frameENST00000356360ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000356360ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000356360ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000356360ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21940602

+
intron-3CDSENST00000528411ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21940602

+
intron-3CDSENST00000528411ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21940602

+
intron-3CDSENST00000528411ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21940602

+
intron-3CDSENST00000528411ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21940602

+
intron-intronENST00000528411ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21940602

+
intron-intronENST00000528411ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21940602

+
intron-intronENST00000528411ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21940602

+
5CDS-intronENST00000532317ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000532317ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000532317ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000532317ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000532317ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000532317ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000532317ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000526033ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000526033ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000526033ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000526033ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000526033ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000526033ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000526033ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000393346ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000393346ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000393346ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000393346ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000393346ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000393346ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000393346ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000528398ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000528398ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000528398ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000528398ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000528398ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000528398ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000528398ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000356360ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000356360ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000356360ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000356360ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000356360ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000356360ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21949952

+
5CDS-intronENST00000356360ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21949952

+
intron-intronENST00000528411ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21949952

+
intron-intronENST00000528411ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21949952

+
intron-intronENST00000528411ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21949952

+
intron-intronENST00000528411ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21949952

+
intron-intronENST00000528411ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21949952

+
intron-intronENST00000528411ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21949952

+
intron-intronENST00000528411ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21949952

+
In-frameENST00000532317ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000532317ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000532317ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000532317ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-3UTRENST00000532317ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000532317ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000532317ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000526033ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000526033ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000526033ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000526033ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-3UTRENST00000526033ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000526033ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000526033ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000393346ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000393346ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000393346ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000393346ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-3UTRENST00000393346ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000393346ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000393346ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21875222

+
Frame-shitENST00000528398ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21875222

+
Frame-shitENST00000528398ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21875222

+
Frame-shitENST00000528398ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21875222

+
Frame-shitENST00000528398ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-3UTRENST00000528398ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000528398ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000528398ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000356360ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000356360ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000356360ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000356360ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-3UTRENST00000356360ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000356360ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21875222

+
5CDS-intronENST00000356360ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21875222

+
intron-3CDSENST00000528411ENST00000446906PICALMchr11

85692172

-MLLT10chr10

21875222

+
intron-3CDSENST00000528411ENST00000377072PICALMchr11

85692172

-MLLT10chr10

21875222

+
intron-3CDSENST00000528411ENST00000307729PICALMchr11

85692172

-MLLT10chr10

21875222

+
intron-3CDSENST00000528411ENST00000377059PICALMchr11

85692172

-MLLT10chr10

21875222

+
intron-3UTRENST00000528411ENST00000495130PICALMchr11

85692172

-MLLT10chr10

21875222

+
intron-intronENST00000528411ENST00000377100PICALMchr11

85692172

-MLLT10chr10

21875222

+
intron-intronENST00000528411ENST00000377091PICALMchr11

85692172

-MLLT10chr10

21875222

+
In-frameENST00000532317ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000532317ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000532317ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000532317ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000532317ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000532317ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000532317ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000526033ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000526033ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000526033ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000526033ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000526033ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000526033ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000526033ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000393346ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000393346ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000393346ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000393346ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000393346ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000393346ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000393346ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21959376

+
Frame-shitENST00000528398ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21959376

+
Frame-shitENST00000528398ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21959376

+
Frame-shitENST00000528398ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21959376

+
Frame-shitENST00000528398ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000528398ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000528398ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000528398ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000356360ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000356360ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000356360ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21959376

+
In-frameENST00000356360ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000356360ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000356360ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21959376

+
5CDS-intronENST00000356360ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21959376

+
intron-3CDSENST00000528411ENST00000446906PICALMchr11

85685751

-MLLT10chr10

21959376

+
intron-3CDSENST00000528411ENST00000377072PICALMchr11

85685751

-MLLT10chr10

21959376

+
intron-3CDSENST00000528411ENST00000307729PICALMchr11

85685751

-MLLT10chr10

21959376

+
intron-3CDSENST00000528411ENST00000377059PICALMchr11

85685751

-MLLT10chr10

21959376

+
intron-intronENST00000528411ENST00000495130PICALMchr11

85685751

-MLLT10chr10

21959376

+
intron-intronENST00000528411ENST00000377100PICALMchr11

85685751

-MLLT10chr10

21959376

+
intron-intronENST00000528411ENST00000377091PICALMchr11

85685751

-MLLT10chr10

21959376

+

Top

FusionProtFeatures for PICALM_MLLT10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PICALM

Q13492

MLLT10

P55197

Assembly protein recruiting clathrin and adapter proteincomplex 2 (AP2) to cell membranes at sites of coated-pit formationand clathrin-vesicle assembly. May be required to determine theamount of membrane to be recycled, possibly by regulating the sizeof the clathrin cage. Involved in AP2-dependent clathrin-mediatedendocytosis at the neuromuscular junction.{ECO:0000269|PubMed:10436022}. Probably involved in transcriptional regulation. Invitro or as fusion protein with KMT2A/MLL1 has transactivationactivity. Binds to cruciform DNA. In cells, binding to unmodifiedhistone H3 regulates DOT1L functions including histone H3 'Lys-79'dimethylation (H3K79me2) and gene activation (PubMed:26439302).{ECO:0000269|PubMed:17868029, ECO:0000269|PubMed:26439302}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePICALMchr11:85685751chr10:21940602ENST00000356360-181914_145628633DomainENTH
HgenePICALMchr11:85685751chr10:21940602ENST00000393346-192014_145648653DomainENTH
HgenePICALMchr11:85685751chr10:21940602ENST00000526033-192014_145641646DomainENTH
HgenePICALMchr11:85685751chr10:21940602ENST00000528398-181914_145547552DomainENTH
HgenePICALMchr11:85685751chr10:21940602ENST00000532317-192014_145606611DomainENTH
HgenePICALMchr11:85685751chr10:21959376ENST00000356360-181914_145628633DomainENTH
HgenePICALMchr11:85685751chr10:21959376ENST00000393346-192014_145648653DomainENTH
HgenePICALMchr11:85685751chr10:21959376ENST00000526033-192014_145641646DomainENTH
HgenePICALMchr11:85685751chr10:21959376ENST00000528398-181914_145547552DomainENTH
HgenePICALMchr11:85685751chr10:21959376ENST00000532317-192014_145606611DomainENTH
HgenePICALMchr11:85692172chr10:21875222ENST00000356360-171914_145593633DomainENTH
HgenePICALMchr11:85692172chr10:21875222ENST00000393346-172014_145593653DomainENTH
HgenePICALMchr11:85692172chr10:21875222ENST00000526033-172014_145586646DomainENTH
HgenePICALMchr11:85692172chr10:21875222ENST00000528398-161914_145492552DomainENTH
HgenePICALMchr11:85692172chr10:21875222ENST00000532317-162014_145543611DomainENTH
HgenePICALMchr11:85692172chr10:21940602ENST00000356360-171914_145593633DomainENTH
HgenePICALMchr11:85692172chr10:21940602ENST00000393346-172014_145593653DomainENTH
HgenePICALMchr11:85692172chr10:21940602ENST00000526033-172014_145586646DomainENTH
HgenePICALMchr11:85692172chr10:21940602ENST00000528398-161914_145492552DomainENTH
HgenePICALMchr11:85692172chr10:21940602ENST00000532317-162014_145543611DomainENTH
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377091+05229_240-59127Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377100+04229_240-119180Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377091+05229_240-59127Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377100+04229_240-119180Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85692172chr10:21875222ENST00000307729+223229_240801069Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377072+224229_240801476Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377091+05229_240-59127Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377100+04229_240-119180Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377091+05229_240-59127Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377100+04229_240-119180Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85685751chr10:21940602ENST00000307729+723311_6742331069RegionNote=DNA-binding
TgeneMLLT10chr11:85685751chr10:21940602ENST00000307729+723703_7842331069RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85685751chr10:21940602ENST00000307729+723750_7782331069RegionNote=Leucine-zipper
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377072+724311_6742331476RegionNote=DNA-binding
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377072+724703_7842331476RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377072+724750_7782331476RegionNote=Leucine-zipper
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377091+05311_674-59127RegionNote=DNA-binding
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377091+05703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377091+05750_778-59127RegionNote=Leucine-zipper
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377091+0580_287-59127RegionNote=Self-association
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377100+04311_674-119180RegionNote=DNA-binding
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377100+04703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377100+04750_778-119180RegionNote=Leucine-zipper
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377100+0480_287-119180RegionNote=Self-association
TgeneMLLT10chr11:85685751chr10:21959376ENST00000307729+823311_6742651069RegionNote=DNA-binding
TgeneMLLT10chr11:85685751chr10:21959376ENST00000307729+823703_7842651069RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85685751chr10:21959376ENST00000307729+823750_7782651069RegionNote=Leucine-zipper
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377072+824311_6742651476RegionNote=DNA-binding
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377072+824703_7842651476RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377072+824750_7782651476RegionNote=Leucine-zipper
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377091+05311_674-59127RegionNote=DNA-binding
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377091+05703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377091+05750_778-59127RegionNote=Leucine-zipper
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377091+0580_287-59127RegionNote=Self-association
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377100+04311_674-119180RegionNote=DNA-binding
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377100+04703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377100+04750_778-119180RegionNote=Leucine-zipper
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377100+0480_287-119180RegionNote=Self-association
TgeneMLLT10chr11:85692172chr10:21875222ENST00000307729+223311_674801069RegionNote=DNA-binding
TgeneMLLT10chr11:85692172chr10:21875222ENST00000307729+223703_784801069RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85692172chr10:21875222ENST00000307729+223750_778801069RegionNote=Leucine-zipper
TgeneMLLT10chr11:85692172chr10:21875222ENST00000307729+22380_287801069RegionNote=Self-association
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377072+224311_674801476RegionNote=DNA-binding
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377072+224703_784801476RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377072+224750_778801476RegionNote=Leucine-zipper
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377072+22480_287801476RegionNote=Self-association
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377091+05311_674-59127RegionNote=DNA-binding
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377091+05703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377091+05750_778-59127RegionNote=Leucine-zipper
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377091+0580_287-59127RegionNote=Self-association
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377100+04311_674-119180RegionNote=DNA-binding
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377100+04703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377100+04750_778-119180RegionNote=Leucine-zipper
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377100+0480_287-119180RegionNote=Self-association
TgeneMLLT10chr11:85692172chr10:21940602ENST00000307729+723311_6742331069RegionNote=DNA-binding
TgeneMLLT10chr11:85692172chr10:21940602ENST00000307729+723703_7842331069RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85692172chr10:21940602ENST00000307729+723750_7782331069RegionNote=Leucine-zipper
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377072+724311_6742331476RegionNote=DNA-binding
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377072+724703_7842331476RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377072+724750_7782331476RegionNote=Leucine-zipper
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377091+05311_674-59127RegionNote=DNA-binding
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377091+05703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377091+05750_778-59127RegionNote=Leucine-zipper
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377091+0580_287-59127RegionNote=Self-association
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377100+04311_674-119180RegionNote=DNA-binding
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377100+04703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377100+04750_778-119180RegionNote=Leucine-zipper
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377100+0480_287-119180RegionNote=Self-association
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377091+05135_198-59127Zinc fingerPHD-type 2
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377091+0522_74-59127Zinc fingerPHD-type 1
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377091+0579_112-59127Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377100+04135_198-119180Zinc fingerPHD-type 2
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377100+0422_74-119180Zinc fingerPHD-type 1
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377100+0479_112-119180Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377091+05135_198-59127Zinc fingerPHD-type 2
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377091+0522_74-59127Zinc fingerPHD-type 1
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377091+0579_112-59127Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377100+04135_198-119180Zinc fingerPHD-type 2
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377100+0422_74-119180Zinc fingerPHD-type 1
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377100+0479_112-119180Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85692172chr10:21875222ENST00000307729+223135_198801069Zinc fingerPHD-type 2
TgeneMLLT10chr11:85692172chr10:21875222ENST00000307729+22379_112801069Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377072+224135_198801476Zinc fingerPHD-type 2
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377072+22479_112801476Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377091+05135_198-59127Zinc fingerPHD-type 2
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377091+0522_74-59127Zinc fingerPHD-type 1
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377091+0579_112-59127Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377100+04135_198-119180Zinc fingerPHD-type 2
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377100+0422_74-119180Zinc fingerPHD-type 1
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377100+0479_112-119180Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377091+05135_198-59127Zinc fingerPHD-type 2
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377091+0522_74-59127Zinc fingerPHD-type 1
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377091+0579_112-59127Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377100+04135_198-119180Zinc fingerPHD-type 2
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377100+0422_74-119180Zinc fingerPHD-type 1
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377100+0479_112-119180Zinc fingerC2HC pre-PHD-type

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMLLT10chr11:85685751chr10:21940602ENST00000307729+723229_2402331069Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377072+724229_2402331476Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85685751chr10:21959376ENST00000307729+823229_2402651069Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377072+824229_2402651476Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85692172chr10:21940602ENST00000307729+723229_2402331069Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377072+724229_2402331476Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:85685751chr10:21940602ENST00000307729+72380_2872331069RegionNote=Self-association
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377072+72480_2872331476RegionNote=Self-association
TgeneMLLT10chr11:85685751chr10:21959376ENST00000307729+82380_2872651069RegionNote=Self-association
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377072+82480_2872651476RegionNote=Self-association
TgeneMLLT10chr11:85692172chr10:21940602ENST00000307729+72380_2872331069RegionNote=Self-association
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377072+72480_2872331476RegionNote=Self-association
TgeneMLLT10chr11:85685751chr10:21940602ENST00000307729+723135_1982331069Zinc fingerPHD-type 2
TgeneMLLT10chr11:85685751chr10:21940602ENST00000307729+72322_742331069Zinc fingerPHD-type 1
TgeneMLLT10chr11:85685751chr10:21940602ENST00000307729+72379_1122331069Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377072+724135_1982331476Zinc fingerPHD-type 2
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377072+72422_742331476Zinc fingerPHD-type 1
TgeneMLLT10chr11:85685751chr10:21940602ENST00000377072+72479_1122331476Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85685751chr10:21959376ENST00000307729+823135_1982651069Zinc fingerPHD-type 2
TgeneMLLT10chr11:85685751chr10:21959376ENST00000307729+82322_742651069Zinc fingerPHD-type 1
TgeneMLLT10chr11:85685751chr10:21959376ENST00000307729+82379_1122651069Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377072+824135_1982651476Zinc fingerPHD-type 2
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377072+82422_742651476Zinc fingerPHD-type 1
TgeneMLLT10chr11:85685751chr10:21959376ENST00000377072+82479_1122651476Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85692172chr10:21875222ENST00000307729+22322_74801069Zinc fingerPHD-type 1
TgeneMLLT10chr11:85692172chr10:21875222ENST00000377072+22422_74801476Zinc fingerPHD-type 1
TgeneMLLT10chr11:85692172chr10:21940602ENST00000307729+723135_1982331069Zinc fingerPHD-type 2
TgeneMLLT10chr11:85692172chr10:21940602ENST00000307729+72322_742331069Zinc fingerPHD-type 1
TgeneMLLT10chr11:85692172chr10:21940602ENST00000307729+72379_1122331069Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377072+724135_1982331476Zinc fingerPHD-type 2
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377072+72422_742331476Zinc fingerPHD-type 1
TgeneMLLT10chr11:85692172chr10:21940602ENST00000377072+72479_1122331476Zinc fingerC2HC pre-PHD-type


Top

FusionGeneSequence for PICALM_MLLT10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_1385aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNV
IVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNA
ATMNGMHFPQYAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVP
SLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASP
FPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSP
GDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGS
LQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSS
AAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLE
NLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHT
FSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTS
TIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQL

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_1401aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNV
IVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNA
ATMNGMHFPQYAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVP
SLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASP
FPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSP
GDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGS
LQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSS
GHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPV
SSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVP
FPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVN
GVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLS

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_1442aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNV
IVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNA
ATMNGMHFPQYAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVP
SLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASP
FPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSP
GDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGS
LQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSS
AAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLE
NLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHT
FSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTS
TIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQL
LNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIPGPTQIPINNLLAGTQAPPLHTATTNPFLTIHGDNASQKVARLSDKTGPVAQEK

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_1385aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNV
IVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNA
ATMNGMHFPQYAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVP
SLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASP
FPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSP
GDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGS
LQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSS
AAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLE
NLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHT
FSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTS
TIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQL

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_1420aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVST
FTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANL
VGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRP
PNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRG
SEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKG
ESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSH
LSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVV
SGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSR
NLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIK
NLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPP
AGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNA

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_1436aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVST
FTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANL
VGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRP
PNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRG
SEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKG
ESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSH
LSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFI
GITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIA
QSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKS
LHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTS
SGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTM

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_1477aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVST
FTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANL
VGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRP
PNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRG
SEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKG
ESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSH
LSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVV
SGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSR
NLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIK
NLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPP
AGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNA
THPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIPGPTQIPINNLLAGTQAPP

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_1420aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVST
FTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANL
VGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRP
PNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRG
SEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKG
ESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSH
LSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVV
SGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSR
NLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIK
NLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPP
AGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_1427aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIY
SQPVMRPPNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGK
DVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSA
TKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNK
NQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVA
VSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQ
DLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENR
RLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSS
ALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTH

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_1443aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIY
SQPVMRPPNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGK
DVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSA
TKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNK
NQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLT
KQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNS
SMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSD
ILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPV
LNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGV
MQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPSMEIMQV

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_1484aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIY
SQPVMRPPNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGK
DVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSA
TKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNK
NQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVA
VSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQ
DLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENR
RLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSS
ALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTH
TTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIPGPTQIPINNLL

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_1427aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIY
SQPVMRPPNPFGPVSGAQKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGK
DVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSA
TKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNK
NQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVA
VSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQ
DLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENR
RLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSS
ALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTH

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_1407aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQKT
KEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSS
GQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFS
TLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVA
SAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSH
LPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSL
SPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLN
AQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVS
GVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSAS

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_1423aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQKT
KEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSS
GQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFS
TLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVA
SAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFP
NVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGD
NSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEE
QIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALST
PPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVP

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_1464aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQKT
KEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSS
GQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFS
TLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVA
SAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSH
LPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSL
SPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLN
AQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVS
GVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSAS
GLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIPGPTQIPINNLLAGTQAPPLHTATTNPFLTIH

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_1407aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQKT
KEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSS
GQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFS
TLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVA
SAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSH
LPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSL
SPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLN
AQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVS
GVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSAS

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_1322aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNV
IVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNA
ATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKS
SAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGG
VNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASP
TSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTP
VSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSS
PRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKER
LQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQ
GSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATL

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_1338aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNV
IVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNA
ATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKS
SAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGG
VNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASP
TSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDV
AVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTD
QDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVEN
RRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSS
SALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLT

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_1379aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNV
IVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNA
ATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKS
SAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGG
VNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASP
TSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTP
VSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSS
PRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKER
LQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQ
GSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATL
TNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIPGPTQIPINNLLAGTQAPPLHTATTNP

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_1322aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNV
IVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNA
ATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKS
SAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGG
VNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASP
TSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTP
VSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSS
PRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKER
LQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQ
GSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATL

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_1365aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVST
FTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANL
VGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISG
SLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSS
VQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSG
IEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTR
HDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQ
APSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEG
QQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHI
GNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQL
AINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPP

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_1381aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVST
FTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANL
VGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISG
SLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSS
VQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSG
IEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTR
HDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_1422aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVST
FTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANL
VGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISG
SLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSS
VQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSG
IEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTR
HDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQ
APSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEG
QQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHI
GNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQL
AINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQ

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_1365aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVST
FTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANL
VGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISG
SLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSS
VQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSG
IEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTR
HDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQ
APSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEG
QQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHI
GNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQL
AINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPP

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_1372aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHP

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_1388aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSA
VSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNS
SLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQ
IHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQP
VTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQF

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_1429aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQA

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_1372aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHP

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_1372aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHP

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_1388aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSA
VSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNS
SLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQ
IHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQP
VTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQF

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_1429aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQA

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_1372aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVTGN
ERFIQTLASRNTLFNLSNFLDKSGLQGTDMSTFIRRTSRTLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKTFDMKKNQCKEGLDITKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQA
PSSLLDALEQHLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLS
ISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHP

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_932aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_948aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHL
QQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSL
QIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPT
ITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVT
VGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQ

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_989aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_932aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_932aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_948aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHL
QQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSL
QIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPT
ITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVT
VGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQ

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_989aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_932aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_932aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_948aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHL
QQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSL
QIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPT
ITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVT
VGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQ

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_989aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_932aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_932aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_948aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHL
QQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSL
QIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPT
ITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVT
VGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQ

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_989aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_932aa
RCELCPHKDGALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLT
VTTEKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDL
GNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQS
LSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAP
AVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLP
PVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSA
QTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIP
AVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_747aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_763aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGA
LSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTD
QPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANP
SPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALA
SGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILI

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_804aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_747aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_747aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_763aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGA
LSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTD
QPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANP
SPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALA
SGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILI

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_804aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_747aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_747aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_763aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGA
LSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTD
QPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANP
SPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALA
SGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILI

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_804aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_747aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_747aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_763aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGA
LSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTD
QPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANP
SPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALA
SGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILI

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_804aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_747aa
TTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSG
TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSL
PTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGS
SPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATT
QANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAAS
IEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPT
TDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAV
GGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_4155nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGA
TTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTT
ATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTC
CCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAAT
GATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCT
GCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGA
ATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGC
CCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCA
TCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCA
CGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGG
AAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCT
TTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTT
ACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAG
GAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCT
GGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAA
AGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCT
GCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGT
TTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTC
TCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCT
AGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCT
GCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCA
AATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGA
GGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAA
AATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCT
AGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAA
AAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACA
TTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTT
CCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCG
GCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCC
ACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAAT
GGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCA
GCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTG
TTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATG

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_4203nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGA
TTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTT
ATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTC
CCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAAT
GATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCT
GCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGA
ATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGC
CCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCA
TCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCA
CGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGG
AAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCT
TTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTT
ACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAG
GAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCT
GGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAA
AGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCT
GCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGT
TTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTC
TCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGC
AATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCT
GGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCT
GGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAAT
CAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTA
AGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAG
AGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAA
GTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCT
TTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGC
AGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACC
AGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAAT
GGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCT
TTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACC
CCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCT
GACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCAC

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_4326nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGA
TTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTT
ATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTC
CCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAAT
GATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCT
GCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGA
ATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGC
CCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCA
TCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCA
CGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGG
AAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCT
TTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTT
ACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAG
GAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCT
GGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAA
AGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCT
GCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGT
TTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTC
TCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCT
AGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCT
GCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCA
AATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGA
GGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAA
AATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCT
AGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAA
AAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACA
TTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTT
CCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCG
GCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCC
ACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAAT
GGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCA
GCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTG
TTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAA
CTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACC
ACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAA

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_4155nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGA
TTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTT
ATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTC
CCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAAT
GATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCT
GCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGA
ATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGC
CCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCA
TCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCA
CGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGG
AAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCT
TTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTT
ACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAG
GAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCT
GGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAA
AGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCT
GCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGT
TTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTC
TCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCT
AGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCT
GCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCA
AATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGA
GGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAA
AATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCT
AGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAA
AAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACA
TTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTT
CCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCG
GCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCC
ACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAAT
GGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCA
GCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTG
TTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATG

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_4260nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
GCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACT
TTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTT
GACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACA
GTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTT
GTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAAC
TGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCA
CCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTG
GAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGG
TCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTG
TCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAG
GATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGA
GAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGC
TTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACT
GTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCAT
CTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTG
CTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGC
CCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTA
TCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCC
TCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATG
TATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGC
AACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGC
AACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTA
GAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAA
AACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCT
CATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTA
CCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCT
GCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATG
CAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATT
GTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCA
ACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAG
CAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCA

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_4308nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
GCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACT
TTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTT
GACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACA
GTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTT
GTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAAC
TGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCA
CCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTG
GAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGG
TCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTG
TCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAG
GATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGA
GAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGC
TTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACT
GTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCAT
CTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTG
CTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGC
CCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATA
GGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTA
CCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAG
GCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCT
CAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCG
CCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATA
GAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCA
TTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCA
CAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACT
GATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCC
AGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGA
GTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGT
GGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATG
TCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGA
CTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTA

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_4431nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
GCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACT
TTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTT
GACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACA
GTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTT
GTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAAC
TGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCA
CCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTG
GAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGG
TCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTG
TCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAG
GATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGA
GAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGC
TTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACT
GTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCAT
CTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTG
CTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGC
CCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTA
TCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCC
TCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATG
TATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGC
AACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGC
AACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTA
GAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAA
AACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCT
CATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTA
CCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCT
GCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATG
CAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATT
GTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCA
ACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAG
CAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAG
CACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCA
CTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCT

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_4260nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
GCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACT
TTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTT
GACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACA
GTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTT
GTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAAC
TGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCA
CCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTG
GAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGG
TCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTG
TCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAG
GATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGA
GAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGC
TTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACT
GTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCAT
CTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTG
CTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGC
CCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTA
TCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCC
TCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATG
TATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGC
AACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGC
AACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTA
GAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAA
AACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCT
CATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTA
CCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCT
GCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATG
CAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATT
GTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCA
ACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAG
CAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_4281nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTAT
CCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATAC
AGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACAC
AAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATA
TCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAA
GATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGA
AGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGA
AGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCA
ACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCT
GTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACT
TCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAA
AATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGT
CTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAG
TATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCA
GTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAA
CAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTC
AGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAA
GATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAG
ATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGT
GAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGA
AGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATA
ACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCT
CATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCA
GCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTG
GGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAAC
CAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCAC
ACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGA
CAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_4329nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTAT
CCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATAC
AGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACAC
AAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATA
TCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAA
GATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGA
AGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGA
AGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCA
ACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCT
GTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACT
TCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAA
AATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGT
CTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAG
TATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACA
AAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACT
CCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCC
CCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCA
TCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGC
TCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTG
CCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGAC
ATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAA
CGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCA
GCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTA
TTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAA
CAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATT
CCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTT
ATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACA
CTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAAT
TCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTC

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_4452nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTAT
CCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATAC
AGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACAC
AAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATA
TCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAA
GATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGA
AGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGA
AGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCA
ACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCT
GTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACT
TCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAA
AATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGT
CTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAG
TATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCA
GTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAA
CAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTC
AGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAA
GATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAG
ATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGT
GAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGA
AGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATA
ACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCT
CATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCA
GCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTG
GGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAAC
CAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCAC
ACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGA
CAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTA
ATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTT
GCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_4281nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTAT
CCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATAC
AGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACAC
AAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATA
TCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAA
GATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGA
AGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGA
AGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCA
ACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCT
GTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACT
TCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAA
AATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGT
CTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAG
TATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCA
GTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAA
CAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTC
AGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAA
GATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAG
ATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGT
GAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGA
AGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATA
ACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCT
CATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCA
GCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTG
GGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAAC
CAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCAC
ACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGA
CAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_4221nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATAT
AAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAA
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_4269nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATAT
AAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAA
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCA
AATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCG
CTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCA
TCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGAC
AATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGAT
CAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAA
TTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAA
CAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCT
AGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAAC
AGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACC
CCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCT
AGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATT
AATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCA
CCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATT
CATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCAT

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_4392nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATAT
AAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAA
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA
GAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGA
CCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCAT

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_4221nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATAT
AAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAA
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_3966nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGA
TTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTT
ATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTC
CCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAAT
GATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCT
GCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_4014nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGA
TTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTT
ATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTC
CCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAAT
GATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCT
GCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTA
GCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTG
CAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCT
CTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGAT
CAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTA
CAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGG
AGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAAC
CGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACA
ATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGC
CCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCA
TCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACA
GTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGT
AACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACC
CACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAA
CGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAG

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_4137nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGA
TTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTT
ATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTC
CCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAAT
GATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCT
GCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAG
CTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCA

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_3966nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGA
TTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTT
ATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTC
CCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAAT
GATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCT
GCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_4095nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
GCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACT
TTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTT
GACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACA
GTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTT
GTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAAC
TGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAG
CAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGA
TCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTT
TCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAAT
CCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCA
GTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAA
GATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACT
TCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGC
ATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAA
GAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAG
AAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGG
CATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCG
TTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTA
GGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAG
GCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTT
GGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGC
TATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGA
CAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTA
GAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCA
AATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATA
GGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTT
TCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCA
CTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTG
GCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACC
GTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATA
CTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCA

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_4143nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
GCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACT
TTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTT
GACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACA
GTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTT
GTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAAC
TGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAG
CAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGA
TCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTT
TCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAAT
CCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCA
GTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAA
GATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACT
TCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGC
ATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAA
GAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAG
AAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGG
CATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAA
GAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_4266nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
GCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACT
TTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTT
GACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACA
GTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTT
GTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAAC
TGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAG
CAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGA
TCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTT
TCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAAT
CCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCA
GTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAA
GATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACT
TCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGC
ATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAA
GAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAG
AAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGG
CATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCG
TTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTA
GGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAG
GCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTT
GGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGC
TATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGA
CAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTA
GAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCA
AATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATA
GGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTT
TCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCA
CTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTG
GCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACC
GTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATA
CTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAA
CATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGT
ACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGT

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_4095nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
GCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACT
TTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTT
GACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACA
GTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTT
GTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAAC
TGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAG
CAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGA
TCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTT
TCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAAT
CCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCA
GTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAA
GATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACT
TCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGC
ATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAA
GAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAG
AAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGG
CATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCG
TTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTA
GGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAG
GCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTT
GGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGC
TATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGA
CAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTA
GAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCA
AATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATA
GGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTT
TCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCA
CTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTG
GCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACC
GTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATA
CTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCA

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_4116nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCC

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_4164nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGAC
AGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATG

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_4287nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCC
TTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCC
ATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGT

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_4116nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCC

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_4116nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCC

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_4164nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGAC
AGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATG

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_4287nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCC
TTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCC
ATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGT

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_4116nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCC

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_2796nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_2844nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTA
GCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTG
CAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCT
CTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGAT
CAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTA
CAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGG
AGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAAC
CGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACA
ATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGC
CCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCA
TCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACA
GTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGT
AACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACC
CACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAA
CGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAG

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_2967nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAG
CTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCA

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_2796nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_2796nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_2844nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTA
GCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTG
CAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCT
CTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGAT
CAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTA
CAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGG
AGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAAC
CGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACA
ATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGC
CCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCA
TCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACA
GTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGT
AACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACC
CACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAA
CGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAG

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_2967nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAG
CTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCA

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_2796nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_2796nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_2844nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTA
GCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTG
CAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCT
CTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGAT
CAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTA
CAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGG
AGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAAC
CGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACA
ATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGC
CCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCA
TCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACA
GTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGT
AACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACC
CACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAA
CGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAG

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_2967nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAG
CTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCA

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_2796nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_2796nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_2844nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTA
GCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTG
CAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCT
CTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGAT
CAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTA
CAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGG
AGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAAC
CGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACA
ATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGC
CCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCA
TCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACA
GTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGT
AACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACC
CACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAA
CGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAG

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_2967nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAG
CTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCA

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_2796nt
AGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCA
GAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGT
GATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGC
GCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAG
CTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAA
GAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACT
GTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACA
AATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCT
TCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAA
GGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCA
GATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGG
GTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTG
GGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGA
AATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCA
ACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGC
CTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTG
CTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCT
GTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCT
GCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCA
ATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCA
CCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCT
CCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATT
TTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGG
CTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCA
CAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTA
AATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAA
GGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCT
GCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATG
CAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTG
ACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCT
CAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGA

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_2241nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_2289nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCA
AATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCG
CTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCA
TCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGAC
AATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGAT
CAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAA
TTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAA
CAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCT
AGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAAC
AGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACC
CCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCT
AGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATT
AATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCA
CCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATT
CATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCAT

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_2412nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA
GAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGA
CCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCAT

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_2241nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_2241nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_2289nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCA
AATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCG
CTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCA
TCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGAC
AATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGAT
CAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAA
TTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAA
CAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCT
AGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAAC
AGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACC
CCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCT
AGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATT
AATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCA
CCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATT
CATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCAT

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_2412nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA
GAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGA
CCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCAT

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_2241nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_2241nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_2289nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCA
AATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCG
CTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCA
TCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGAC
AATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGAT
CAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAA
TTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAA
CAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCT
AGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAAC
AGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACC
CCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCT
AGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATT
AATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCA
CCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATT
CATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCAT

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_2412nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA
GAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGA
CCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCAT

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_2241nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_2241nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_2289nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCA
AATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCG
CTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCA
TCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGAC
AATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGAT
CAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAA
TTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAA
CAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCT
AGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAAC
AGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACC
CCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCT
AGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATT
AATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCA
CCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATT
CATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCAT

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_2412nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA
GAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGA
CCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCAT

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_2241nt
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_6123nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCA
TTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGAT
ACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAG
GGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCA
GCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTC
CTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCT
GGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAA
AATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAG
GAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCA
GTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGG
AATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACA
ACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATG
GAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGA
AATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAAT
GCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCA
TGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATC
AACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTAC
AAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAAT
TTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTT
TCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCT
TTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAA
TACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACA
GCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTG
TGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGA
GATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCC
TTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGT
GTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTT
GGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTG
ATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCA
AATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGG
TAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATAAT

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_6176nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCA
TTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGAT
ACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAG
GGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCA
GCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTC
CTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCT
GGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAA
AATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAG
GAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCA
GTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGG
AATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACA
ACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATT
TATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAG
CAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAAT
ACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCT
GAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGA
TCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAG
CTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACAC
CAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTT
TCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCC
TTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGA
CAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAG
CAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATA
ATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAG
AACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGA
TTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGG
CACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAA
CTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTT
TGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGG
CTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAA
ATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTT
TATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTT
GTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATAT
AGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGG
TAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTT
AAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGG
GTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCC
CGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATT
TATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAA
AGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCA
GAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCC
ACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAA
GTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGA
AAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTT
ACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTC

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_6252nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCA
TTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGAT
ACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAG
GGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCA
GCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTC
CTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCT
GGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAA
AATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAG
GAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCA
GTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGG
AATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACA
ACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCAC
CAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCAC
ACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCT
CAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTAC
TACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTT
CTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTT
TAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGAT
GCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGT
ATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGG
GACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCT
GCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAG
GCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATC
AAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCC
TTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAG
TCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGA
GTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCA
CTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGC
TGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTG
TTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAAT
TTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCA
CTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAA

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_6123nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCA
TTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGAT
ACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAG
GGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCA
GCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTC
CTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCT
GGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAA
AATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAG
GAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCA
GTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGG
AATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACA
ACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATG
GAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGA
AATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAAT
GCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCA
TGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATC
AACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTAC
AAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAAT
TTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTT
TCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCT
TTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAA
TACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACA
GCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTG
TGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGA
GATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCC
TTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGT
GTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTT
GGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTG
ATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCA
AATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGG
TAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATAAT

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_6266nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTG
TAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAG
AGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTT
ATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAG
TCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTC
AAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTC
CAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTT
ACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCT
TAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTA
CAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATG
GGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAG
CTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTC
CAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACG
GTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTAC
CTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGG
CAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTC
AGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGC
CACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAG
AACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCAT
TACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCAC
AGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTG
ATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCA
GTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAG
TTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTG
GAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGT
CCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGAC
TAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTAC
ACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGA
TAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCT
GCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTG
TAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAA
AGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTT
TTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCT
CTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAA
TATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAG
GATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTT
GAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTG
GTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAAT
CATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGG
GTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCA
TTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTA
CCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGA
CCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAA
ATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTA
ATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTT
ATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAA

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_6319nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTG
TAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAG
AGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTT
ATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAG
TCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTC
AAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTC
CAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTT
ACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCT
TAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTA
CAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATG
GGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAG
CTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTC
CAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACG
ACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATG
TAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCT
CTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTC
ATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATA
GCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAAC
CAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTT
TACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAA
TTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTC
CGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCT
TTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCAC
CTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTG
GAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATG
GCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTA
ATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATC
AACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCT
CACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAG
AAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACA
AGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAA
TGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCA
ATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTT
GCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCC
AAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAA
AAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAG
AATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAAT
TCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAG
GGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTC
AGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTG
GTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTG
TATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTC
TTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCA
ATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATA
AGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAA
TTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTT
TGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAA

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_6395nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTG
TAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAG
AGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTT
ATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAG
TCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTC
AAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTC
CAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTT
ACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCT
TAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTA
CAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATG
GGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAG
CTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTC
CAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACG
GTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTAC
CTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGG
CAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTC
AGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGC
CACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAG
AACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCAT
TACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCAC
AGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTG
ATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCA
GTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAG
TTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTG
GAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGT
CCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGAC
TAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAAC
AACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAA
CACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAG
ATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAAT
TGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCA
CAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGC
CCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAAC
TCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAA
CTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTC
TTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCT
AATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTA
GTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATAC
TTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCA
GGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGC
CACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGAT
TTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTC
CACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTG
AATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGT
TAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATA
TTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAAT
CTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAA
ATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATAATGTT

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_6266nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTG
TAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATATAAAG
AGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTT
ATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAG
TCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTC
AAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTC
CAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTT
ACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCT
TAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTA
CAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATG
GGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAG
CTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTC
CAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACG
GTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTAC
CTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGG
CAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTC
AGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGC
CACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAG
AACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCAT
TACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCAC
AGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTG
ATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCA
GTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAG
TTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTG
GAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGT
CCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGAC
TAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTAC
ACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGA
TAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCT
GCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTG
TAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAA
AGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTT
TTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCT
CTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAA
TATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAG
GATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTT
GAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTG
GTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAAT
CATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGG
GTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCA
TTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTA
CCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGA
CCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAA
ATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTA
ATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTT
ATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_6119nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGAT
ATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCT
TTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGG
TTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTA
CTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCA
AAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTA
GCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGA
GCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAA
GCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATT
CACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAA
AGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTT
CTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATG
GAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTA
CGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGG
GATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGT
CATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATA
GATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTG
GCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTT
TGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTA
CTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTG
CCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATAC
ACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATT
CTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGA
GTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAA
CTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTT
TAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAA
TGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGC
AGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGA
TAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATT
GCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCAC
AACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCC
CCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACT
CAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAAC
TACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCT
TCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTA
ATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAG
TGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACT
TCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAG
GGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCC
ACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATT
TGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCC
ACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGA
ATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTT
AAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATAT
TTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATC
TTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_6172nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGAT
ATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCT
TTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGG
TTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTA
CTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCA
AAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTA
GCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGA
GCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAA
GCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATT
CACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAA
AGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTT
CTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATG
GAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTA
CGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATA
ACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGT
CTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTC
TATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAA
ACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCC
CTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTT
TGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAAC
TTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAG
TGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGA
ACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAA
GTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGG
TCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTG
GAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACC
CTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTAC
TTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACC
CCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGG
GCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCA
GTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTT
GATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTT
AATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATA
AATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTT
GGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCA
CATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAAT
GTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGT
GAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTT
GCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTC
ACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATC
CACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCT
CACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGT
GATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTG
TGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTT
TGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAG
TAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTT
ATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_6248nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGAT
ATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCT
TTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGG
TTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTA
CTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCA
AAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTA
GCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGA
GCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAA
GCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATT
CACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAA
AGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTT
CTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATG
GAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTA
CGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGG
GATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGT
CATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATA
GATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTG
GCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTT
TGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTA
CTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTG
CCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATAC
ACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATT
CTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGA
GTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAA
CTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTT
TAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAA
TGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGC
AGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAAC
CTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAG
CTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAG
AGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACA
GCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTG
TTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAA
GTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAA
ATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGC
TTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACT
TGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTA
AAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTG
CTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGT
GCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCC
CATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCAC
AAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTC
CTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGA
GGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGA
AGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTT
GTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTAT
TTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGG
TTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_6119nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGAT
ATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCT
TTGGCCCTGTATCAGGAGCACAGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGG
TTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTA
CTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCA
AAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTA
GCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGA
GCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAA
GCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATT
CACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAA
AGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTT
CTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATG
GAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTA
CGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGG
GATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGT
CATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATA
GATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTG
GCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTT
TGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTA
CTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTG
CCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATAC
ACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATT
CTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGA
GTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAA
CTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTT
TAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAA
TGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGC
AGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGA
TAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATT
GCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCAC
AACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCC
CCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACT
CAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAAC
TACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCT
TCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTA
ATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAG
TGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACT
TCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAG
GGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCC
ACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATT
TGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCC
ACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGA
ATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTT
AAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATAT
TTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATC
TTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21940602_+_5910nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATAT
AAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAA
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA
GTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTA
GTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCT
GGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATT
CTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACAT
GGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACT
AGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATA
TGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTA
CAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAG
TTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAA
TCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGT
GCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAG
GAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTAC
CTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTG
ACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGAC
AGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAAT
TAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCT
GTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGA
TTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTG
GTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGAT

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21940602_+_5963nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATAT
AAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAA
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCA
AATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCG
CTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCA
TCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGAC
AATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGAT
CAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAA
TTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAA
CAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCT
AGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAAC
AGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACC
CCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCT
AGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATT
AATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCA
CCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATT
CATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCAT
TTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACC
TGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGC
AACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACT
GAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACA
TGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAAT
ACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAA
TTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTA
AAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTT
TGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGAT
CAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTG
CAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTT
ATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGA
TTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAA
CCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAA
ACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTC
TGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATT
CATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGG
GGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAAC
AGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21940602_+_6039nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATAT
AAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAA
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA
GAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGA
CCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCAT
GGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAG
AAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAA
TGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCC
ATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTAT
CAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTA
CAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAA
TTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCT
TTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTC
TTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAA
ATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGAC
AGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCT
GTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAG
AGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCC
CTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTG
TGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCT
TGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATT
GATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTC
AAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATG
GTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATAA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21940602_+_5910nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGAAATAT
AAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAA
ACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAG
GAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCA
GGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGA
ACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGAC
AGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGT
ACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTT
CCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAG
CATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCA
TCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCA
TCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACAC
AACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCAC
TTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACT
CAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATA
GCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTC
TCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGC
ATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAG
TCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAAT
GCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACT
ACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACC
TCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGT
GGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTG
GGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACA
ATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCA
GGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCA
GTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTA
GTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCT
GGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATT
CTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACAT
GGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACT
AGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATA
TGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTA
CAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAG
TTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAA
TCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGT
GCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAG
GAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTAC
CTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTG
ACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGAC
AGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAAT
TAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCT
GTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGA
TTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTG
GTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGAT

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_5934nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCA
TCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCA
CGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGG
AAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCT
TTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTT
ACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAG
GAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCT
GGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAA
AGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCT
GCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGT
TTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTC
TCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCT
AGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCT
GCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCA
AATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGA
GGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAA
AATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCT
AGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAA
AAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACA
TTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTT
CCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCG
GCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCC
ACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAAT
GGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCA
GCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTG
TTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATG
CAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTA
TCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAA
AGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTAC
CCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGA
ATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTT
GATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCC
TGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGG
ATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTA
AGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTT
CAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGG
GACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGT
AGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTT
TATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTT
GGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTAT
TAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACA
TTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGA
TTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTG
TAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTG

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_5987nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCA
TCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCA
CGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGG
AAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCT
TTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTT
ACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAG
GAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCT
GGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAA
AGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCT
GCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGT
TTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTC
TCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGC
AATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCT
GGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCT
GGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAAT
CAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTA
AGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAG
AGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAA
GTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCT
TTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGC
AGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACC
AGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAAT
GGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCT
TTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACC
CCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCT
GACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCAC
TTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTG
TAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCT
TTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTA
GTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAA
CTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTG
GAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTT
ACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCA
CCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTG
CATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTT
CTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCT
TGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTG
CAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTA
ATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCA
CTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTC
CCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTAC
TTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGA
ATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAA
TTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTA
ACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTAT

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_6063nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCA
TCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCA
CGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGG
AAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCT
TTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTT
ACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAG
GAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCT
GGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAA
AGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCT
GCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGT
TTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTC
TCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCT
AGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCT
GCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCA
AATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGA
GGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAA
AATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCT
AGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAA
AAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACA
TTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTT
CCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCG
GCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCC
ACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAAT
GGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCA
GCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTG
TTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAA
CTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACC
ACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAA
AGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTAT
GAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCT
TTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGAC
ATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGC
AAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCT
CTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCA
ATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGT
AATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGG
GGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTC
CATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGC
TTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAA
AAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAA
ACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATG
TCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAAC
ATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATT
GTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTA
TATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTT
ATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAA

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_5934nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCA
TCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCA
CGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGG
AAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCT
TTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTT
ACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAG
GAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCT
GGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAA
AGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCT
GCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGT
TTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTC
TCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCT
AGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCT
GCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCA
AATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGA
GGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAA
AATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCT
AGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAA
AAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACA
TTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTT
CCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCG
GCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCC
ACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAAT
GGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCA
GCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTG
TTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATG
CAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTA
TCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAA
AGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTAC
CCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGA
ATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTT
GATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCC
TGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGG
ATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTA
AGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTT
CAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGG
GACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGT
AGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTT
TATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTT
GGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTAT
TAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACA
TTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGA
TTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTG
TAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTG

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_6101nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTA
CTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATG
CAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAG
CTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCA
GTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATC
TGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAA
ATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTA
ATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATA
AACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACAT
CATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCA
GTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGA
ATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCT
CCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTG
TTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGG
CAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCC
GAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAG
TAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAG
GAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTC
AGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGA
CTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATC
AGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCT
CAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCG
TGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGA
CTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTA
ACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAAC
AGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGT
AGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTA
GCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCT
GCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGT
TTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTT
GGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTAC
AAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTG
ATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTT
TGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATA
TTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCA
CTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCT
CCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGC
AAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACT
TCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCT
TTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGAC
CCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTT
ACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTC
TAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAA
AAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTAT

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_6154nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTA
CTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATG
CAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAG
CTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCA
GTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATC
TGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAA
ATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTA
ATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATA
AACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACAT
CATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCA
GTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGA
ATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAG
TATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAAC
AAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCA
GTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAG
ATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGA
TTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTG
AAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAA
GATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAA
CAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTC
ATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAG
CTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGG
GGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACC
AACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACA
CAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGAC
AAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTAC
CACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAA
AAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTA
TGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGC
TTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGA
CATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAG
CAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGC
TCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGC
AATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGG
TAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGG
GGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCT
CCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATG
CTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGA
AAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGA
AACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGAT
GTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAA
CATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTAT
TGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTT
ATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGT
TATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAA

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_6230nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTA
CTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATG
CAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAG
CTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCA
GTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATC
TGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAA
ATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTA
ATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATA
AACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACAT
CATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCA
GTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGA
ATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCT
CCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTG
TTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGG
CAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCC
GAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAG
TAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAG
GAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTC
AGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGA
CTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATC
AGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCT
CAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCG
TGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGA
CTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTA
ACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAAC
AGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGC
AGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTC
TCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGA
GAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAAC
AAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAA
ATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGC
AATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACT
TGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTC
CAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAA
AAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGA
GAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAA
TTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAA
GGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATT
CAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTT
GGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCT
GTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACT
CTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGC
AATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCAT
AAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGA
ATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGT
TTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATA

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_6101nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTA
CTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATG
CAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAG
CTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCA
GTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATC
TGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAA
ATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTA
ATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATA
AACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACAT
CATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCA
GTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGA
ATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCT
CCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTG
TTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGG
CAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCC
GAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAG
TAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAG
GAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTC
AGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGA
CTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATC
AGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCT
CAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCG
TGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGA
CTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTA
ACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAAC
AGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGT
AGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTA
GCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCT
GCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGT
TTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTT
GGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTAC
AAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTG
ATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTT
TGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATA
TTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCA
CTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCT
CCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGC
AAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACT
TCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCT
TTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGAC
CCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTT
ACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTC
TAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAA
AAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTAT

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_5954nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAAC
CATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGC
GCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTA
GAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAA
CTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTC
CCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATA
AAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTA
AAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAG
AAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTT
CTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTA
CATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAG
CTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATG
TAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCT
CTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTC
ATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATA
GCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAAC
CAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTT
TACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAA
TTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTC
CGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCT
TTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCAC
CTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTG
GAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATG
GCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTA
ATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATC
AACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCT
CACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAG
AAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACA
AGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAA
TGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCA
ATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTT
GCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCC
AAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAA
AAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAG
AATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAAT
TCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAG
GGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTC
AGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTG
GTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTG
TATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTC
TTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCA
ATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATA
AGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAA
TTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTT
TGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAA

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_6007nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAAC
CATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGC
GCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTA
GAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAA
CTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTC
CCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATA
AAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTA
AAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAG
AAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTT
CTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTA
CATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAG
CTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAAT
TCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTC
ACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAA
CTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTA
TAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTC
TCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCA
GCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGA
AGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGA
ATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTA
CTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAA
CCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGA
GTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAG
TGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCA
CAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCT
CAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACAC
CAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACT
TAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCAT
CTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACA
TTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAAC
ATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAA
CTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAA
TATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTAT
TACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGA
AGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGA
AATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAA
GTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGC
AGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATT
ACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTAC
TGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTG
ACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTA
ATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTT
CTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTA
GATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTG
TGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAG

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_6083nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAAC
CATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGC
GCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTA
GAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAA
CTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTC
CCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATA
AAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTA
AAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAG
AAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTT
CTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTA
CATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAG
CTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATG
TAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCT
CTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTC
ATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATA
GCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAAC
CAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTT
TACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAA
TTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTC
CGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCT
TTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCAC
CTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTG
GAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATG
GCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTA
ATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATC
AACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACC
AGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCAC
CCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTG
GGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGC
AGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTT
TGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATT
TAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTAT
AAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTT
TGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGC
ACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAA
TGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAG
TGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTT
TGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGT
CACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTAT
CCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGC
TCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAG
TGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACT
GTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTT
TTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAA
GTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACT
TATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCAC

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_5954nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAAC
CATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGC
GCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTA
GAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAA
CTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTC
CCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATA
AAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTA
AAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAG
AAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTT
CTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTA
CATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAG
CTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATG
TAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCT
CTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTC
ATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATA
GCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAAC
CAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTT
TACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAA
TTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTC
CGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCT
TTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCAC
CTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTG
GAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATG
GCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTA
ATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATC
AACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCT
CACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAG
AAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACA
AGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAA
TGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCA
ATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTT
GCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCC
AAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAA
AAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAG
AATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAAT
TCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAG
GGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTC
AGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTG
GTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTG
TATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTC
TTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCA
ATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATA
AGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAA
TTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTT
TGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAA

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21940602_+_5805nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCC
CACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGC
CTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGT
CCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGA
TTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAA
TAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAA
TTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGG
GTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACA
TCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGT
CTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGA
GTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGC
CCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCAC
CTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCA
CTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCA
CCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGA
TTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTG
TACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTG
TGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTA
AAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTAT
TTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATG

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21940602_+_5858nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGAC
AGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATG
GAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGA
AATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAAT
GCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCA
TGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATC
AACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTAC
AAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAAT
TTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTT
TCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCT
TTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAA
TACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACA
GCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTG
TGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGA
GATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCC
TTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGT
GTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTT
GGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTG
ATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCA
AATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGG
TAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATAAT

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21940602_+_5934nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCC
TTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCC
ATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGT
CAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTG
CTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGAT
TAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTT
ACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTA
ATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTT
TATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAG
TTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTG
GCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACC
TACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAA
AGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAG
TCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATA
GCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTT
AAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGA
GCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTG
GAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCA
CAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGT
AATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGAT
AATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGT

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21940602_+_5805nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCC
CACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGC
CTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGT
CCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGA
TTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAA
TAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAA
TTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGG
GTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACA
TCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGT
CTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGA
GTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGC
CCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCAC
CTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCA
CTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCA
CCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGA
TTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTG
TACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTG
TGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTA
AAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTAT
TTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATG

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_6393nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTT
TGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAAT
AAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAG
GCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGT
AAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAG
GATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCA
TTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGAT
ACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAG
GGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCA
GCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTC
CTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCT
GGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAA
AATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAG
GAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCA
GTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGG
AATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACA
ACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATG
GAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGA
AATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAAT
GCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCA
TGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATC
AACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTAC
AAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAAT
TTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTT
TCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCT
TTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAA
TACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACA
GCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTG
TGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGA
GATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCC
TTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGT
GTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTT
GGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTG
ATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCA
AATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGG
TAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATAAT

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_6446nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTT
TGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAAT
AAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAG
GCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGT
AAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAG
GATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCA
TTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGAT
ACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAG
GGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCA
GCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTC
CTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCT
GGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAA
AATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAG
GAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCA
GTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGG
AATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACA
ACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATT
TATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAG
CAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAAT
ACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCT
GAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGA
TCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAG
CTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACAC
CAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTT
TCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCC
TTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGA
CAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAG
CAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATA
ATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAG
AACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGA
TTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGG
CACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAA
CTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTT
TGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGG
CTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAA
ATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTT
TATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTT
GTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATAT
AGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGG
TAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTT
AAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGG
GTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCC
CGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATT
TATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAA
AGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCA
GAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCC
ACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAA
GTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGA
AAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTT
ACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTC

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_6522nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTT
TGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAAT
AAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAG
GCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGT
AAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAG
GATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCA
TTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGAT
ACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAG
GGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCA
GCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTC
CTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCT
GGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAA
AATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAG
GAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCA
GTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGG
AATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACA
ACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCAC
CAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCAC
ACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCT
CAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTAC
TACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTT
CTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTT
TAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGAT
GCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGT
ATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGG
GACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCT
GCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAG
GCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATC
AAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCC
TTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAG
TCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGA
GTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCA
CTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGC
TGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTG
TTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAAT
TTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCA
CTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAA

>In-frame_PICALM_ENST00000532317_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_6393nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTT
TGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAAT
AAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAG
GCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGT
AAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAG
GATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCA
TTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGAT
ACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAG
GGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCA
GCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTC
CTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCT
GGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAA
AATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAG
GAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCA
GTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGG
AATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACA
ACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATG
GAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGA
AATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAAT
GCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCA
TGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATC
AACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTAC
AAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAAT
TTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTT
TCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCT
TTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAA
TACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACA
GCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTG
TGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGA
GATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCC
TTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGT
GTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTT
GGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTG
ATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCA
AATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGG
TAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATAAT

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_6560nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATA
TTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACA
TTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAA
CATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTA
GTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATG
AGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCT
TGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGAT
TTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGA
AATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTC
CTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAG
ACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAG
GGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAG
ATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGA
AAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTT
CACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTAC
AGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAG
AGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTA
CTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAG
CCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATT
CATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAA
GCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATC
TGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTG
ACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGG
AACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTT
CAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTG
TATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTC
AACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCA
TTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGG
TTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTA
CACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAA
ATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAG
TCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCT
GCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGA
TTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCT
TACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTT
AATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATT
TTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGA
GTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTT
GGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGAC
CTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGA
AAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACA
GTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGAT
AGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATT
TAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGG
AGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGT
GGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGC
ACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTG
TAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGA
TAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATG

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_6613nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATA
TTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACA
TTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAA
CATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTA
GTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATG
AGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCT
TGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGAT
TTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGA
AATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTC
CTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAG
ACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAG
GGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAG
ATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGA
AAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTT
CACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTAC
AGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAG
AGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATG
ATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGC
ATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGAT
CTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAA
CAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCA
GCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGC
AGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTG
AAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTC
CAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTA
AGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCA
GCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCG
TGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGC
CAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTC
TCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACC
AGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCA
CACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGC
TCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTA
CTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTT
TCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTT
TTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGA
TGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAG
TATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTG
GGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATC
TGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGA
GGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGAT
CAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGC
CTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGA
GTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAG
AGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCC
ACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAG
CTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCT
GTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAA
TTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCC
ACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAA

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_6689nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATA
TTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACA
TTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAA
CATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTA
GTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATG
AGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCT
TGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGAT
TTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGA
AATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTC
CTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAG
ACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAG
GGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAG
ATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGA
AAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTT
CACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTAC
AGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAG
AGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTA
CTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAG
CCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATT
CATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAA
GCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATC
TGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTG
ACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGG
AACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTT
CAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTG
TATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTC
AACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCA
TTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGG
TTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTA
CACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAA
ATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTC
AGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCA
ACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTT
GACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAG
AAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGT
TGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAA
TTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAA
CTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAA
GTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCT
TTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATT
TTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAA
CCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATT
GTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCC
GCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGG
AGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAG
GTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCAT
CATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGT
TAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGA
CAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATG
TTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTC
TGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTT

>In-frame_PICALM_ENST00000526033_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_6560nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATA
TTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACA
TTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAA
CATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTA
GTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATG
AGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCT
TGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGAT
TTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGA
AATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTC
CTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAG
ACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAG
GGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAG
ATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGA
AAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTT
CACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTAC
AGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAG
AGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTA
CTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAG
CCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATT
CATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAA
GCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATC
TGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTG
ACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGG
AACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTT
CAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTG
TATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTC
AACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCA
TTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGG
TTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTA
CACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAA
ATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAG
TCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCT
GCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGA
TTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCT
TACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTT
AATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATT
TTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGA
GTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTT
GGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGAC
CTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGA
AAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACA
GTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGAT
AGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATT
TAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGG
AGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGT
GGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGC
ACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTG
TAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGA
TAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATG

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_6413nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATG
GGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTG
TTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTA
ATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATG
TCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTG
ATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGC
AGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGAT
CATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTT
CAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATC
CAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAG
TGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAG
ATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTT
CACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCA
TAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAG
AGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGA
AATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGC
ATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGT
TTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAG
GAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGG
CACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTG
GAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCT
ATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGAC
AGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAG
AGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAA
ATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAG
GAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTT
CTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCAC
TAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGG
CAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCG
TACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATAC
TTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAA
CCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTG
ACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGA
AACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTT
GCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAAT
TTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAAC
TAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAG
TCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTT
TGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTT
TCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAAC
CAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTG
TGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCG
CCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGA
GTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGG
TGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATC
ATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTT
AATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGAC
AAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGT
TCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCT
GTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTT

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_6466nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATG
GGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTG
TTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTA
ATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATG
TCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTG
ATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGC
AGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGAT
CATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTT
CAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATC
CAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAG
TGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAG
ATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTT
CACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCA
TAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAG
AGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGA
AATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGC
ATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAG
AACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCT
CCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTG
TTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGG
CAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCC
GAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAG
TAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAG
GAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTC
AGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGA
CTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATC
AGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCT
CAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCG
TGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGA
CTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTA
ACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAAC
AGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGT
AGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTA
GCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCT
GCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGT
TTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTT
GGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTAC
AAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTG
ATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTT
TGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATA
TTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCA
CTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCT
CCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGC
AAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACT
TCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCT
TTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGAC
CCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTT
ACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTC
TAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAA
AAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTAT

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_6542nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATG
GGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTG
TTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTA
ATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATG
TCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTG
ATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGC
AGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGAT
CATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTT
CAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATC
CAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAG
TGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAG
ATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTT
CACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCA
TAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAG
AGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGA
AATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGC
ATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGT
TTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAG
GAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGG
CACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTG
GAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCT
ATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGAC
AGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAG
AGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAA
ATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAG
GAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTT
CTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCAC
TAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGG
CAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCG
TACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATAC
TTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAAC
ATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTA
CACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTG
ATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGC
TGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTT
GTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGA
AAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGT
TTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGC
TCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAA
ATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTA
GGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCT
TGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCT
GGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAA
TCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTG
GGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACC
ATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGT
ACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAG
ACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTA
AATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTT
AATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTT
TATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTA

>In-frame_PICALM_ENST00000393346_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_6413nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATG
GGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTG
TTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTA
ATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATG
TCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTG
ATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGC
AGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCTATATCTGGAT
CATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTT
CAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATC
CAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAG
TGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAG
ATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTT
CACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCA
TAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAG
AGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGA
AATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGC
ATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGT
TTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAG
GAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGG
CACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTG
GAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCT
ATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGAC
AGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAG
AGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAA
ATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAG
GAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTT
CTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCAC
TAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGG
CAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCG
TACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATAC
TTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAA
CCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTG
ACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGA
AACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTT
GCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAAT
TTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAAC
TAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAG
TCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTT
TGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTT
TCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAAC
CAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTG
TGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCG
CCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGA
GTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGG
TGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATC
ATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTT
AATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGAC
AAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGT
TCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCT
GTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTT

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000446906_chr10_21875222_+_6264nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCAT
AAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTT
TCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGC
AAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTT
TGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGA
TCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAG
AAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTAT
ACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTC
TCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAA
AGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCA
GGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTAC
TCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTA
ATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACA
GCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGG
CCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCT
GCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCA
GTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGT
ATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCT
CAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCA
AATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAG
TCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCA
CGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAA
CAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTA
CACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAG
CTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGAT
TCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGT
GGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTT
CAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGA
ATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCC
CAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTA
GGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACAC
AGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATA
AAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGC
CTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTA
AGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAG
AAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTT
GTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCT
TTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATA
TATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGA
TGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGA
GTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGT
GGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCA
TCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGT
ATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATT
AAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACC
GCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACC
TCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAAT
AAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAAT
TGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTAT
TTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAA

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377072_chr10_21875222_+_6317nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCAT
AAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTT
TCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGC
AAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTT
TGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGA
TCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAG
AAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTAT
ACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTC
TCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAA
AGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCA
GGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTAC
TCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTA
ATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACA
GCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGG
CCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCT
GCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCA
GTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGAC
AGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTA
GTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCT
CCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCAT
ATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGC
CGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCA
GGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTA
CTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATT
AAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCG
TCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTT
TTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCT
CCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGA
ATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGC
ATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAAT
GCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAA
CAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCA
CCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAA
ACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAG
AAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATG
GAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAAT
ATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGC
TCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAA
GGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAA
AATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAA
TTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTC
AAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGG
CTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAG
AACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGT
AAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTA
TGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTT
CTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAAT
ATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAG
ATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATT
TTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTG
TATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAA

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000307729_chr10_21875222_+_6393nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCAT
AAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTT
TCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGC
AAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTT
TGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGA
TCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAG
AAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTAT
ACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTC
TCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAA
AGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCA
GGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTAC
TCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTA
ATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACA
GCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGG
CCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCT
GCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCA
GTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGT
ATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCT
CAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCA
AATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAG
TCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCA
CGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAA
CAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTA
CACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAG
CTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGAT
TCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGT
GGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTT
CAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGA
ATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCC
CAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTA
GGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAA
CATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACA
CAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGAT
AATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTG
CCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACA
ACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCC
CTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTC
AAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACT
ACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTT
CTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAA
TGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGT
GTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTT
CTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGG
GTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCA
CTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTT
GTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCA
CTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAA
TTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTA
AACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATT
TTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCT
TTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAAT
TTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATAATGTTTA

>In-frame_PICALM_ENST00000356360_chr11_85692172_-_MLLT10_ENST00000377059_chr10_21875222_+_6264nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAGATGTGAACTTTGTCCCCAT
AAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTT
TCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGC
AAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTT
TGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGA
TCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAG
AAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTAT
ACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTC
TCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAA
AGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCA
GGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTAC
TCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTA
ATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACA
GCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGG
CCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCT
GCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCA
GTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGT
ATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCT
CAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCA
AATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAG
TCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCA
CGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAA
CAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTA
CACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAG
CTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGAT
TCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGT
GGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTT
CAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGA
ATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCC
CAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTA
GGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACAC
AGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATA
AAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGC
CTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTA
AGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAG
AAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTT
GTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCT
TTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATA
TATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGA
TGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGA
GTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGT
GGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCA
TCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGT
ATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATT
AAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACC
GCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACC
TCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAAT
AAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAAT
TGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTAT
TTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAA

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_6027nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACT
GCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAA
GGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGC
CCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGC
TTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGC
CAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCA
CCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAG
AAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCT
TCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGA
AGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACG
TTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGA
TCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCA
TCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGA
TCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGC
AGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTG
GAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACT
CCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCC
AAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACAC
ACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCT
CTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGT
CCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACT
TCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTA
AATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATG
CCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAG
TTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATA
ATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGC
CTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAA
CAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCC
TACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCA
AGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTA
CTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTC
TCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAAT
GGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTG
TTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTC
TTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGG
TGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCAC
TGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTG
TTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCAC
TTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAAT
TATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAA
ACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTT
TGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTT
TTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATT

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_6080nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACT
GCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAA
GGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGC
CCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGC
TTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGC
CAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCA
CCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAG
AAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCT
TCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGA
AGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACG
TTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCC
CACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGC
CTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGT
CCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGA
TTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAA
TAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAA
TTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGG
GTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACA
TCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGT
CTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGA
GTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGC
CCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCAC
CTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCA
CTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCA
CCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGA
TTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTG
TACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTG
TGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTA
AAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTAT
TTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATG

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_6156nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACT
GCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAA
GGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGC
CCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGC
TTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGC
CAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCA
CCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAG
AAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCT
TCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGA
AGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACG
TTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGA
TCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCA
TCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGA
TCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGC
AGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTG
GAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACT
CCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCC
AAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACAC
ACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCT
CTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGT
CCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACT
TCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTA
AATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATG
CCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAG
TTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCT
GAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCT
ACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAG
AAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGC
TATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTT
GCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGT
GACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAAT
AGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTT
GCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTG
GCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAA
GGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCT
GGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGC
CTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCA
TGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAA
GAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCT
GAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGG
ATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAG
AACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGT
ATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTT
TTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTT
GTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACA

>In-frame_PICALM_ENST00000532317_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_6027nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCA
CAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTG
TATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGA
TATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAA
GTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCA
CTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTG
TTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTAT
AAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTT
TCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGC
AGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCA
TTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCA
GCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCA
AAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACA
TGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCT
ACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTT
GCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACC
ACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCT
TGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACT
GCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAA
GGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGC
CCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGC
TTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGC
CAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCA
CCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAG
AAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCT
TCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGA
AGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACG
TTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGA
TCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCA
TCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGA
TCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGC
AGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTG
GAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACT
CCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCC
AAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACAC
ACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCT
CTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGT
CCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACT
TCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTA
AATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATG
CCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAG
TTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATA
ATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGC
CTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAA
CAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCC
TACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCA
AGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTA
CTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTC
TCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAAT
GGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTG
TTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTC
TTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGG
TGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCAC
TGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTG
TTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCAC
TTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAAT
TATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAA
ACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTT
TGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTT
TTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATT

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_6170nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTG
TAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGACTTATACAA
GCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTG
CACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGG
GAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCA
GTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTC
ACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTG
GCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAG
GATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTG
GCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAG
GAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTG
GTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTT
ATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGC
AGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATA
CTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTG
AAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGAT
CCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGC
TTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACC
AACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTT
CAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCT
TGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGAC
AAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGC
AGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAA
TTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGA
ACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGAT
TACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGC
ACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAAC
TGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTT
GCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGC
TTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAA
TTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTT
ATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTG
TTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATA
GCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGT
AATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTA
AGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGG
TTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCC
GTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTT
ATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAA
GCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAG
AGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCA
CTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAG
TTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAA
AAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTA
CTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCC

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_6223nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTG
TAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGACTTATACAA
GCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTG
CACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGG
GAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCA
GTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTC
ACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTG
GCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAG
GATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTG
GCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAG
GAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTG
GTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAG
GTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTAT
CTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCT
CAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGT
ATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCA
ACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCA
ACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAG
AACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAA
ACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTC
ATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTAC
CTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTG
CTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGC
AGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTG
TAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAA
CACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGC
AGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCAT
CCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACAT
CTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAAC
TCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAAT
TCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGT
TTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCA
TTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAA
CTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATT
TCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGC
TTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAG
CTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGT
AGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACT
TTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGA
ATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGAC
AGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTT
GGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGT
TTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAA
CATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAA
AGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATA
AATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTA

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_6299nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTG
TAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGACTTATACAA
GCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTG
CACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGG
GAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCA
GTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTC
ACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTG
GCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAG
GATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTG
GCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAG
GAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTG
GTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTT
ATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGC
AGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATA
CTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTG
AAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGAT
CCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGC
TTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACC
AACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTT
CAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCT
TGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGAC
AAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGC
AGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAA
TTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGA
ACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGAT
TACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATC
AAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAA
TACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATG
CAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTA
TCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAA
AGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTAC
CCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGA
ATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTT
GATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCC
TGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGG
ATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTA
AGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTT
CAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGG
GACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGT
AGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTT
TATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTT
GGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTAT
TAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACA
TTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGA
TTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTG
TAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTG

>In-frame_PICALM_ENST00000526033_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_6170nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACT
TAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGG
TCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTA
ACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAG
CAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCC
TAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATG
CTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATA
TGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAG
AGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCT
TGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTAT
CTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAG
AACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTG
ACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTG
TACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAA
AAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCA
CTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTG
TAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCAC
CTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATG
TAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAA
CAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTG
TAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGACTTATACAA
GCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTG
CACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGG
GAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCA
GTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTC
ACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTG
GCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAG
GATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTG
GCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAG
GAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTG
GTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTT
ATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGC
AGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATA
CTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTG
AAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGAT
CCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGC
TTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACC
AACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTT
CAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCT
TGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGAC
AAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGC
AGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAA
TTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGA
ACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGAT
TACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGC
ACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAAC
TGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTT
GCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGC
TTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAA
TTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTT
ATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTG
TTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATA
GCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGT
AATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTA
AGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGG
TTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCC
GTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTT
ATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAA
GCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAG
AGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCA
CTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAG
TTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAA
AAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTA
CTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCC

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_6023nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGAT
ATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCT
TTGGCCCTGTATCAGGAGCACAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCAC
GATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGA
AGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTT
TTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTA
CAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGG
AAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTG
GAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAA
GGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTG
CTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTT
TACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCT
CAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTA
GTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTG
CAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAA
ATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAG
GAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAA
ATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTA
GTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAA
AGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACAT
TTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTC
CTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGG
CTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCA
CCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATG
GGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAG
CTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGT
TAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGC
AAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTAT
CCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAA
GGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACC
CCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAA
TTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTG
ATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCT
GGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGA
TTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAA
GACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTC
AGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGG
ACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTA
GATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTT
ATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTG
GGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATT
AGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACAT
TGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGAT
TTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGT
AGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGA

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_6076nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGAT
ATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCT
TTGGCCCTGTATCAGGAGCACAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCAC
GATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGA
AGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTT
TTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTA
CAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGG
AAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTG
GAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAA
GGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTG
CTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTT
TACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCT
CAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCA
ATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTG
GGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTG
GATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATC
AAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAA
GCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGA
GGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAG
TTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTT
TTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCA
GTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCA
GCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATG
GCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTT
TGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCC
CTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTG
ACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACT
TCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGT
AGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTT
TTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAG
TTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAAC
TTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGG
AGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTA
CAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCAC
CTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGC
ATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTC
TGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTT
GATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGC
AGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAA
TGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCAC
TAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCC
CCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACT
TAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAA
TCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAAT
TAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAA
CCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATT

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_6152nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGAT
ATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCT
TTGGCCCTGTATCAGGAGCACAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCAC
GATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGA
AGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTT
TTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTA
CAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGG
AAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTG
GAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAA
GGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTG
CTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTT
TACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCT
CAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTA
GTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTG
CAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAA
ATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAG
GAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAA
ATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTA
GTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAA
AGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACAT
TTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTC
CTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGG
CTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCA
CCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATG
GGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAG
CTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGT
TAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAAC
TTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCA
CCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAA
GTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATG
AAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTT
TGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACA
TAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCA
AAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTC
TAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAA
TCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTA
ATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGG
GAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCC
ATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCT
TCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAA
AGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAA
CAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGT
CATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACA
TGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTG
TGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTAT
ATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTA
TTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAAT

>In-frame_PICALM_ENST00000393346_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_6023nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGTA
GTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTATTCAGTATTTGGCTTCAAGAA
ACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATT
TAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACA
CAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGAACTTACAAATG
GGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCATACAATGAAGGAATTATTAATTTGTTGGAAA
AATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCC
TCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAAC
ATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAA
GCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAAC
AGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTG
CACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTT
TTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATG
ATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTA
GGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAAT
CTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTC
AGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATC
TTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAA
AGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGAT
ATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCT
TTGGCCCTGTATCAGGAGCACAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCAC
GATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGA
AGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTT
TTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTA
CAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGG
AAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTG
GAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAA
GGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTG
CTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTT
TACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCT
CAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTA
GTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTG
CAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAA
ATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAG
GAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAA
ATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTA
GTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAA
AGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACAT
TTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTC
CTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGG
CTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCA
CCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATG
GGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAG
CTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGT
TAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGC
AAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTAT
CCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAA
GGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACC
CCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAA
TTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTG
ATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCT
GGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGA
TTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAA
GACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTC
AGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGG
ACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTA
GATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTT
ATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTG
GGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATT
AGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACAT
TGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGAT
TTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGT
AGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000446906_chr10_21959376_+_5814nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGACTTAT
ACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTC
TCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAA
AGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCA
GGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTAC
TCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTA
ATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACA
GCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGG
CCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCT
GCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCA
GTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGT
ATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCT
CAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCA
AATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAG
TCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCA
CGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAA
CAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTA
CACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAG
CTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGAT
TCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGT
GGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTT
CAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGA
ATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCC
CAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTA
GGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACAC
AGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATA
AAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGC
CTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTA
AGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAG
AAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTT
GTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCT
TTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATA
TATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGA
TGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGA
GTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGT
GGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCA
TCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGT
ATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATT
AAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACC
GCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACC
TCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAAT
AAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAAT
TGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTAT
TTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377072_chr10_21959376_+_5867nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGACTTAT
ACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTC
TCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAA
AGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCA
GGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTAC
TCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTA
ATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACA
GCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGG
CCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCT
GCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCA
GTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGAC
AGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTA
GTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCT
CCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCAT
ATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGC
CGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCA
GGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTA
CTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATT
AAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCG
TCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTT
TTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCT
CCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGA
ATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGC
ATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAAT
GCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAA
CAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCA
CCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAA
ACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAG
AAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATG
GAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAAT
ATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGC
TCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAA
GGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAA
AATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAA
TTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTC
AAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGG
CTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAG
AACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGT
AAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTA
TGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTT
CTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAAT
ATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAG
ATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATT
TTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTG
TATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000307729_chr10_21959376_+_5943nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGACTTAT
ACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTC
TCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAA
AGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCA
GGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTAC
TCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTA
ATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACA
GCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGG
CCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCT
GCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCA
GTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGT
ATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCT
CAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCA
AATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAG
TCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCA
CGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAA
CAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTA
CACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAG
CTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGAT
TCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGT
GGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTT
CAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGA
ATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCC
CAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTA
GGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAA
CATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACA
CAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGAT
AATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTG
CCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACA
ACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCC
CTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTC
AAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACT
ACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTT
CTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAA
TGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGT
GTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTT
CTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGG
GTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCA
CTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTT
GTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCA
CTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAA
TTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTA
AACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATT
TTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCT
TTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAAT
TTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATAATGTTTA

>In-frame_PICALM_ENST00000356360_chr11_85685751_-_MLLT10_ENST00000377059_chr10_21959376_+_5814nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCAGTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCA
GACAGTTTATTTGAAAGAACTACTAATAGTAGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAAT
GAGCGTTTTATTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGGATATGACATG
TCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAAGTTGCATTTGATTTCACAAAAGTGAAGAGA
GGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAACTCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGAT
TTTAATGTTAATAGCAATGAACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTCTTGACATCTATAAGAAGTTC
CTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCC
CCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACT
ACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAA
GAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCT
GTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCC
AATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCC
ATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACAC
CCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTA
GGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTG
GATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAG
AAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTT
CCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGACTTAT
ACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTC
TCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAA
AGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCA
GGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTAC
TCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTA
ATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAG