FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27082

FusionGeneSummary for PIAS3_BZRAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: PIAS3_BZRAP1
Fusion gene ID: 27082
HgeneTgene
Gene symbol

PIAS3

BZRAP1

Gene ID

10401

9256

Gene nameprotein inhibitor of activated STAT 3TSPO associated protein 1
SynonymsZMIZ5BZRAP1|PBR-IP|PRAX-1|PRAX1|RIM-BP1|RIMBP1
Cytomap

1q21.1

17q22

Type of geneprotein-codingprotein-coding
DescriptionE3 SUMO-protein ligase PIAS3E3 SUMO-protein transferase PIAS3protein inhibitor of activated STAT protein 3zinc finger, MIZ-type containing 5peripheral-type benzodiazepine receptor-associated protein 1RIMS-binding protein 1benzodiazapine receptor peripheral-associated protein 1benzodiazepine receptor (peripheral) associated protein 1peripheral benzodiazepine receptor-interacting protein
Modification date2018051920180523
UniProtAcc

Q9Y6X2

Ensembl transtripts involved in fusion geneENST00000369299, ENST00000393045, 
ENST00000369298, 
ENST00000268893, 
ENST00000355701, ENST00000343736, 
Fusion gene scores* DoF score4 X 4 X 3=481 X 1 X 1=1
# samples 41
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: PIAS3 [Title/Abstract] AND BZRAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePIAS3

GO:0033234

negative regulation of protein sumoylation

24651376

HgenePIAS3

GO:0033235

positive regulation of protein sumoylation

17696781|21965678


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-AB3A-01APIAS3chr1

145584836

+BZRAP1chr17

56384329

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000369299ENST00000268893PIAS3chr1

145584836

+BZRAP1chr17

56384329

-
intron-3CDSENST00000369299ENST00000355701PIAS3chr1

145584836

+BZRAP1chr17

56384329

-
intron-3CDSENST00000369299ENST00000343736PIAS3chr1

145584836

+BZRAP1chr17

56384329

-
In-frameENST00000393045ENST00000268893PIAS3chr1

145584836

+BZRAP1chr17

56384329

-
In-frameENST00000393045ENST00000355701PIAS3chr1

145584836

+BZRAP1chr17

56384329

-
In-frameENST00000393045ENST00000343736PIAS3chr1

145584836

+BZRAP1chr17

56384329

-
In-frameENST00000369298ENST00000268893PIAS3chr1

145584836

+BZRAP1chr17

56384329

-
In-frameENST00000369298ENST00000355701PIAS3chr1

145584836

+BZRAP1chr17

56384329

-
In-frameENST00000369298ENST00000343736PIAS3chr1

145584836

+BZRAP1chr17

56384329

-

Top

FusionProtFeatures for PIAS3_BZRAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PIAS3

Q9Y6X2

BZRAP1

Functions as an E3-type small ubiquitin-like modifier(SUMO) ligase, stabilizing the interaction between UBE2I and thesubstrate, and as a SUMO-tethering factor. Plays a crucial role asa transcriptional coregulation in various cellular pathways,including the STAT pathway and the steroid hormone signalingpathway. Involved in regulating STAT3 signaling via inhibitingSTAT3 DNA-binding and suppressing cell growth. Enhances thesumoylation of MTA1 and may participate in its paralog-selectivesumoylation (PubMed:21965678, PubMed:9388184). Sumoylates CCAR2which promotes its interaction with SIRT1 (PubMed:25406032).Diminishes the sumoylation of ZFHX3 by preventing thecolocalization of ZFHX3 with SUMO1 in the nucleus(PubMed:24651376). {ECO:0000269|PubMed:21965678,ECO:0000269|PubMed:24651376, ECO:0000269|PubMed:25406032,ECO:0000269|PubMed:9388184}. Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PIAS3_BZRAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PIAS3_ENST00000393045_chr1_145584836_+_BZRAP1_ENST00000268893_chr17_56384329_-_737aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPVGSP
GPLAPIPPTLLAPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFTEVTGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDTTIQVQLRFCLCETSCPQEDTFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNY
SLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALTLQMNEK
KPTWTCPVCDKKAPTESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGTGLDGLQYSPVQGGDPSENKKKVEVIDL
TIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
VFGDKDADGFYQGEGGGRTGYIPCNMVAEVAVDSPAGRQQLLQRGTLSPDILLEGSGNGPFVYSTAHTTGPPPKPRRSKKAESEGPAQPC
PGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDVEAELPFRAGDVITVFGGMDDDGFYTGELNGQRGLVPSNFLEGPGPEAGGLDREPR

>In-frame_PIAS3_ENST00000393045_chr1_145584836_+_BZRAP1_ENST00000355701_chr17_56384329_-_787aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPVGSP
GPLAPIPPTLLAPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFTEVTGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDTTIQVQLRFCLCETSCPQEDTFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNY
SLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALTLQMNEK
KPTWTCPVCDKKAPTESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGTGLDGLQYSPVQGGDPSENKKKVEVIDL
TIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
VFGDKDADGFYQGEGGGRTGYIPCNMVAEVAVDSPAGRQQLLQRGTLSPDILLEGSGNGPFVYSTAHTTGPPPKPRRSKKAESEGPAQPC
PGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDVEAELPFRAGDVITVFGGMDDDGFYTGELNGQRGLVPSNFLEGPGPEAGGLDREPR

>In-frame_PIAS3_ENST00000393045_chr1_145584836_+_BZRAP1_ENST00000343736_chr17_56384329_-_737aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPVGSP
GPLAPIPPTLLAPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFTEVTGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDTTIQVQLRFCLCETSCPQEDTFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNY
SLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALTLQMNEK
KPTWTCPVCDKKAPTESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGTGLDGLQYSPVQGGDPSENKKKVEVIDL
TIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
VFGDKDADGFYQGEGGGRTGYIPCNMVAEVAVDSPAGRQQLLQRGTLSPDILLEGSGNGPFVYSTAHTTGPPPKPRRSKKAESEGPAQPC
PGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDVEAELPFRAGDVITVFGGMDDDGFYTGELNGQRGLVPSNFLEGPGPEAGGLDREPR

>In-frame_PIAS3_ENST00000369298_chr1_145584836_+_BZRAP1_ENST00000268893_chr17_56384329_-_702aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPPVHP
DVTMKPLPFTEVTGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDTTIQVQLRFCLCETSCPQEDTFPPNLFVKV
NGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIK
EKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALTLQMNEKKPTWTCPVCDKKAPTESLIIDGLFMEILSSCSDCD
EIQFMEDGSWCPMKPKKEASEVCPPPGTGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVL
TSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQVFGDKDADGFYQGEGGGRTGYIPCNMVAEVAVDSP
AGRQQLLQRGTLSPDILLEGSGNGPFVYSTAHTTGPPPKPRRSKKAESEGPAQPCPGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDV

>In-frame_PIAS3_ENST00000369298_chr1_145584836_+_BZRAP1_ENST00000355701_chr17_56384329_-_752aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPPVHP
DVTMKPLPFTEVTGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDTTIQVQLRFCLCETSCPQEDTFPPNLFVKV
NGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIK
EKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALTLQMNEKKPTWTCPVCDKKAPTESLIIDGLFMEILSSCSDCD
EIQFMEDGSWCPMKPKKEASEVCPPPGTGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVL
TSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQVFGDKDADGFYQGEGGGRTGYIPCNMVAEVAVDSP
AGRQQLLQRGTLSPDILLEGSGNGPFVYSTAHTTGPPPKPRRSKKAESEGPAQPCPGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDV
EAELPFRAGDVITVFGGMDDDGFYTGELNGQRGLVPSNFLEGPGPEAGGLDREPRTPQAESQDWGCTTQGSPGPPGGPCTPSSGSAPRIE

>In-frame_PIAS3_ENST00000369298_chr1_145584836_+_BZRAP1_ENST00000343736_chr17_56384329_-_702aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPPVHP
DVTMKPLPFTEVTGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDTTIQVQLRFCLCETSCPQEDTFPPNLFVKV
NGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIK
EKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALTLQMNEKKPTWTCPVCDKKAPTESLIIDGLFMEILSSCSDCD
EIQFMEDGSWCPMKPKKEASEVCPPPGTGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVL
TSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQVFGDKDADGFYQGEGGGRTGYIPCNMVAEVAVDSP
AGRQQLLQRGTLSPDILLEGSGNGPFVYSTAHTTGPPPKPRRSKKAESEGPAQPCPGPPKLVPSADLKAPHSMVAAFDYNPQESSPNMDV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PIAS3_ENST00000393045_chr1_145584836_+_BZRAP1_ENST00000268893_chr17_56384329_-_2211nt
ATGGCGGAGCTGGGCGAATTAAAGCACATGGTGATGAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAG
AGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCTGCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTT
TACCGACGACGCTTTCCCCGGAAGACCCTGGGGCCCTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTGTAGGCTCCCCT
GGTCCTCTAGCTCCCATTCCCCCAACGCTGTTGGCCCCTGGCACCCTGCTGGGCCCCAAGCGTGAGGTGGACATGCACCCCCCTCTGCCC
CAGCCTGTGCACCCTGATGTCACCATGAAACCATTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACT
TCTAGCCAGCGGTTTGAGGAAGCGCACTTTACCTTTGCCCTCACACCCCAGCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCA
GGAGCCAAATGTGATTATACCATACAGGTGCAGCTAAGGTTCTGTCTCTGTGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAAC
CTCTTTGTCAAGGTCAATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCCCCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGC
CCCATCAACATCACACCCCTGGCTCGACTCTCAGCCACTGTTCCCAACACCATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTAC
TCCTTGTCTGTGTACCTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACAAAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCG
CGGGCACTGATCAAGGAGAAATTGACTGCTGACCCTGACAGTGAGGTGGCCACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGG
AAGATGCGCCTGACTGTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCAGAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAG
AAGCCTACATGGACATGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATCTCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCC
TGTTCAGATTGTGATGAGATCCAATTCATGGAAGATGGATCCTGGTGCCCAATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCG
CCAGGGTATGGGCTGGATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGATCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTG
ACAATAGAAAGCTCATCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCACTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGA
AGCAAAGGAGTCCTGACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAGCCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGT
CTCCCACTACATGAGTACCCACCTGCCTTCCCACTGGGAGCCGACATCCAAGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAG
GTGTTTGGGGACAAGGATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGGCCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTG
GCTGTGGACAGCCCTGCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTTGTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCG
TTTGTGTACTCCACAGCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCGCTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGT
CCAGGCCCCCCTAAGCTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTCCATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCC
CCCAATATGGACGTGGAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCATTACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTAT
GGGGAATTAAATGGACAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGGCCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGG

>In-frame_PIAS3_ENST00000393045_chr1_145584836_+_BZRAP1_ENST00000355701_chr17_56384329_-_2361nt
ATGGCGGAGCTGGGCGAATTAAAGCACATGGTGATGAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAG
AGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCTGCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTT
TACCGACGACGCTTTCCCCGGAAGACCCTGGGGCCCTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTGTAGGCTCCCCT
GGTCCTCTAGCTCCCATTCCCCCAACGCTGTTGGCCCCTGGCACCCTGCTGGGCCCCAAGCGTGAGGTGGACATGCACCCCCCTCTGCCC
CAGCCTGTGCACCCTGATGTCACCATGAAACCATTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACT
TCTAGCCAGCGGTTTGAGGAAGCGCACTTTACCTTTGCCCTCACACCCCAGCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCA
GGAGCCAAATGTGATTATACCATACAGGTGCAGCTAAGGTTCTGTCTCTGTGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAAC
CTCTTTGTCAAGGTCAATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCCCCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGC
CCCATCAACATCACACCCCTGGCTCGACTCTCAGCCACTGTTCCCAACACCATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTAC
TCCTTGTCTGTGTACCTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACAAAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCG
CGGGCACTGATCAAGGAGAAATTGACTGCTGACCCTGACAGTGAGGTGGCCACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGG
AAGATGCGCCTGACTGTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCAGAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAG
AAGCCTACATGGACATGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATCTCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCC
TGTTCAGATTGTGATGAGATCCAATTCATGGAAGATGGATCCTGGTGCCCAATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCG
CCAGGGTATGGGCTGGATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGATCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTG
ACAATAGAAAGCTCATCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCACTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGA
AGCAAAGGAGTCCTGACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAGCCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGT
CTCCCACTACATGAGTACCCACCTGCCTTCCCACTGGGAGCCGACATCCAAGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAG
GTGTTTGGGGACAAGGATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGGCCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTG
GCTGTGGACAGCCCTGCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTTGTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCG
TTTGTGTACTCCACAGCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCGCTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGT
CCAGGCCCCCCTAAGCTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTCCATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCC
CCCAATATGGACGTGGAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCATTACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTAT
GGGGAATTAAATGGACAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGGCCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGG
ACACCCCAGGCTGAGAGTCAGGACTGGGGCTGCACCACACAAGGGTCCCCAGGGCCCCCAGGTGGGCCTTGTACCCCCAGCTCTGGCAGC
GCCCCCAGGATTGAACGTGGGGAGCCCCAGGGCAGAAGCGAGAAGGTGTGGGGTTTCTTCTCCAAGGGGAAGCAGCTCCTCAGGAGGCTG

>In-frame_PIAS3_ENST00000393045_chr1_145584836_+_BZRAP1_ENST00000343736_chr17_56384329_-_2211nt
ATGGCGGAGCTGGGCGAATTAAAGCACATGGTGATGAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAG
AGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCTGCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTT
TACCGACGACGCTTTCCCCGGAAGACCCTGGGGCCCTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTGTAGGCTCCCCT
GGTCCTCTAGCTCCCATTCCCCCAACGCTGTTGGCCCCTGGCACCCTGCTGGGCCCCAAGCGTGAGGTGGACATGCACCCCCCTCTGCCC
CAGCCTGTGCACCCTGATGTCACCATGAAACCATTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACT
TCTAGCCAGCGGTTTGAGGAAGCGCACTTTACCTTTGCCCTCACACCCCAGCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCA
GGAGCCAAATGTGATTATACCATACAGGTGCAGCTAAGGTTCTGTCTCTGTGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAAC
CTCTTTGTCAAGGTCAATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCCCCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGC
CCCATCAACATCACACCCCTGGCTCGACTCTCAGCCACTGTTCCCAACACCATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTAC
TCCTTGTCTGTGTACCTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACAAAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCG
CGGGCACTGATCAAGGAGAAATTGACTGCTGACCCTGACAGTGAGGTGGCCACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGG
AAGATGCGCCTGACTGTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCAGAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAG
AAGCCTACATGGACATGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATCTCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCC
TGTTCAGATTGTGATGAGATCCAATTCATGGAAGATGGATCCTGGTGCCCAATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCG
CCAGGGTATGGGCTGGATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGATCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTG
ACAATAGAAAGCTCATCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCACTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGA
AGCAAAGGAGTCCTGACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAGCCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGT
CTCCCACTACATGAGTACCCACCTGCCTTCCCACTGGGAGCCGACATCCAAGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAG
GTGTTTGGGGACAAGGATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGGCCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTG
GCTGTGGACAGCCCTGCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTTGTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCG
TTTGTGTACTCCACAGCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCGCTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGT
CCAGGCCCCCCTAAGCTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTCCATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCC
CCCAATATGGACGTGGAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCATTACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTAT
GGGGAATTAAATGGACAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGGCCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGG

>In-frame_PIAS3_ENST00000369298_chr1_145584836_+_BZRAP1_ENST00000268893_chr17_56384329_-_2106nt
ATGGCGGAGCTGGGCGAATTAAAGCACATGGTGATGAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAG
AGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCTGCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTT
TACCGACGACGCTTTCCCCGGAAGACCCTGGGGCCCTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTCCTGTGCACCCT
GATGTCACCATGAAACCATTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACTTCTAGCCAGCGGTTT
GAGGAAGCGCACTTTACCTTTGCCCTCACACCCCAGCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCAGGAGCCAAATGTGAT
TATACCATACAGGTGCAGCTAAGGTTCTGTCTCTGTGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAACCTCTTTGTCAAGGTC
AATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCCCCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGCCCCATCAACATCACA
CCCCTGGCTCGACTCTCAGCCACTGTTCCCAACACCATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTACTCCTTGTCTGTGTAC
CTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACAAAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCGCGGGCACTGATCAAG
GAGAAATTGACTGCTGACCCTGACAGTGAGGTGGCCACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGGAAGATGCGCCTGACT
GTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCAGAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAGAAGCCTACATGGACA
TGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATCTCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCCTGTTCAGATTGTGAT
GAGATCCAATTCATGGAAGATGGATCCTGGTGCCCAATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCGCCAGGGTATGGGCTG
GATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGATCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTGACAATAGAAAGCTCA
TCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCACTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGAAGCAAAGGAGTCCTG
ACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAGCCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGTCTCCCACTACATGAG
TACCCACCTGCCTTCCCACTGGGAGCCGACATCCAAGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAGGTGTTTGGGGACAAG
GATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGGCCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTGGCTGTGGACAGCCCT
GCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTTGTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCGTTTGTGTACTCCACA
GCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCGCTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGTCCAGGCCCCCCTAAG
CTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTCCATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCCCCCAATATGGACGTG
GAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCATTACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTATGGGGAATTAAATGGA
CAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGGCCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGGACACCCCAGGCTGAG

>In-frame_PIAS3_ENST00000369298_chr1_145584836_+_BZRAP1_ENST00000355701_chr17_56384329_-_2256nt
ATGGCGGAGCTGGGCGAATTAAAGCACATGGTGATGAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAG
AGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCTGCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTT
TACCGACGACGCTTTCCCCGGAAGACCCTGGGGCCCTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTCCTGTGCACCCT
GATGTCACCATGAAACCATTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACTTCTAGCCAGCGGTTT
GAGGAAGCGCACTTTACCTTTGCCCTCACACCCCAGCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCAGGAGCCAAATGTGAT
TATACCATACAGGTGCAGCTAAGGTTCTGTCTCTGTGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAACCTCTTTGTCAAGGTC
AATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCCCCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGCCCCATCAACATCACA
CCCCTGGCTCGACTCTCAGCCACTGTTCCCAACACCATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTACTCCTTGTCTGTGTAC
CTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACAAAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCGCGGGCACTGATCAAG
GAGAAATTGACTGCTGACCCTGACAGTGAGGTGGCCACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGGAAGATGCGCCTGACT
GTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCAGAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAGAAGCCTACATGGACA
TGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATCTCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCCTGTTCAGATTGTGAT
GAGATCCAATTCATGGAAGATGGATCCTGGTGCCCAATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCGCCAGGGTATGGGCTG
GATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGATCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTGACAATAGAAAGCTCA
TCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCACTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGAAGCAAAGGAGTCCTG
ACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAGCCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGTCTCCCACTACATGAG
TACCCACCTGCCTTCCCACTGGGAGCCGACATCCAAGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAGGTGTTTGGGGACAAG
GATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGGCCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTGGCTGTGGACAGCCCT
GCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTTGTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCGTTTGTGTACTCCACA
GCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCGCTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGTCCAGGCCCCCCTAAG
CTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTCCATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCCCCCAATATGGACGTG
GAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCATTACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTATGGGGAATTAAATGGA
CAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGGCCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGGACACCCCAGGCTGAG
AGTCAGGACTGGGGCTGCACCACACAAGGGTCCCCAGGGCCCCCAGGTGGGCCTTGTACCCCCAGCTCTGGCAGCGCCCCCAGGATTGAA
CGTGGGGAGCCCCAGGGCAGAAGCGAGAAGGTGTGGGGTTTCTTCTCCAAGGGGAAGCAGCTCCTCAGGAGGCTGGGCTCTGGGAAGAAG

>In-frame_PIAS3_ENST00000369298_chr1_145584836_+_BZRAP1_ENST00000343736_chr17_56384329_-_2106nt
ATGGCGGAGCTGGGCGAATTAAAGCACATGGTGATGAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAG
AGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCTGCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTT
TACCGACGACGCTTTCCCCGGAAGACCCTGGGGCCCTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTCCTGTGCACCCT
GATGTCACCATGAAACCATTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACTTCTAGCCAGCGGTTT
GAGGAAGCGCACTTTACCTTTGCCCTCACACCCCAGCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCAGGAGCCAAATGTGAT
TATACCATACAGGTGCAGCTAAGGTTCTGTCTCTGTGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAACCTCTTTGTCAAGGTC
AATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCCCCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGCCCCATCAACATCACA
CCCCTGGCTCGACTCTCAGCCACTGTTCCCAACACCATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTACTCCTTGTCTGTGTAC
CTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACAAAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCGCGGGCACTGATCAAG
GAGAAATTGACTGCTGACCCTGACAGTGAGGTGGCCACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGGAAGATGCGCCTGACT
GTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCAGAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAGAAGCCTACATGGACA
TGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATCTCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCCTGTTCAGATTGTGAT
GAGATCCAATTCATGGAAGATGGATCCTGGTGCCCAATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCGCCAGGGTATGGGCTG
GATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGATCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTGACAATAGAAAGCTCA
TCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCACTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGAAGCAAAGGAGTCCTG
ACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAGCCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGTCTCCCACTACATGAG
TACCCACCTGCCTTCCCACTGGGAGCCGACATCCAAGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAGGTGTTTGGGGACAAG
GATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGGCCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTGGCTGTGGACAGCCCT
GCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTTGTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCGTTTGTGTACTCCACA
GCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCGCTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGTCCAGGCCCCCCTAAG
CTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTCCATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCCCCCAATATGGACGTG
GAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCATTACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTATGGGGAATTAAATGGA
CAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGGCCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGGACACCCCAGGCTGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PIAS3_ENST00000393045_chr1_145584836_+_BZRAP1_ENST00000268893_chr17_56384329_-_3550nt
GCATTTGCGGCCGGCGCCAGGGTGGAGAGTTGTGCGCCGGTCCCTGGGCCTGAGCTCCGGCTCCGGCTGGGGCGCCTGCGATGTCTCAAG
ATGGCGGAGCTGGGCGAATTAAAGCACATGGTGATGAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAG
AGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCTGCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTT
TACCGACGACGCTTTCCCCGGAAGACCCTGGGGCCCTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTGTAGGCTCCCCT
GGTCCTCTAGCTCCCATTCCCCCAACGCTGTTGGCCCCTGGCACCCTGCTGGGCCCCAAGCGTGAGGTGGACATGCACCCCCCTCTGCCC
CAGCCTGTGCACCCTGATGTCACCATGAAACCATTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACT
TCTAGCCAGCGGTTTGAGGAAGCGCACTTTACCTTTGCCCTCACACCCCAGCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCA
GGAGCCAAATGTGATTATACCATACAGGTGCAGCTAAGGTTCTGTCTCTGTGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAAC
CTCTTTGTCAAGGTCAATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCCCCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGC
CCCATCAACATCACACCCCTGGCTCGACTCTCAGCCACTGTTCCCAACACCATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTAC
TCCTTGTCTGTGTACCTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACAAAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCG
CGGGCACTGATCAAGGAGAAATTGACTGCTGACCCTGACAGTGAGGTGGCCACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGG
AAGATGCGCCTGACTGTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCAGAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAG
AAGCCTACATGGACATGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATCTCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCC
TGTTCAGATTGTGATGAGATCCAATTCATGGAAGATGGATCCTGGTGCCCAATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCG
CCAGGGTATGGGCTGGATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGATCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTG
ACAATAGAAAGCTCATCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCACTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGA
AGCAAAGGAGTCCTGACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAGCCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGT
CTCCCACTACATGAGTACCCACCTGCCTTCCCACTGGGAGCCGACATCCAAGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAG
GTGTTTGGGGACAAGGATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGGCCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTG
GCTGTGGACAGCCCTGCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTTGTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCG
TTTGTGTACTCCACAGCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCGCTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGT
CCAGGCCCCCCTAAGCTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTCCATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCC
CCCAATATGGACGTGGAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCATTACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTAT
GGGGAATTAAATGGACAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGGCCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGG
ACACCCCAGGCTGAGAGTCAGAGAACGAGGAGGAGAAGAGTCCAGTGCTAGATGGAGATAGATATATGTAGAGAGAGCAACATGACTGGG
GCTGCACCACACAAGGGTCCCCAGGGCCCCCAGGTGGGCCTTGTACCCCCAGCTCTGGCAGCGCCCCCAGGATTGAACGTGGGGAGCCCC
AGGGCAGAAGCGAGAAGGTGTGGGGTTTCTTCTCCAAGGGGAAGCAGCTCCTCAGGAGGCTGGGCTCTGGGAAGAAGGAGTGAAGCTGTG
GCCCATCCTGCAGGCAGAAGAGGCCCTGAGAGGCCCCCAGATCACTGTCTCTGCTGAGCAGGGAAGGCTCAGACTGGGCCCAGAGCCCCC
GTTCTTCTGCGTTAACACTGTGGCATTCAGAGGGAATCAAAGAGCCTTGGTGAAGGTCAGAGCTAAATGGCTCCTTAAGGATGAACTCTC
TAGAGAAGCACCTTCCTCCTACAGGAGGGGAAACTGAGCCCACAGTGAGTATGTAACTTGACCAAGGTCACTGAGCCAGGACTGGACCCA
GGACCCTCGCGTCCTGGTCCACCCACCTCGTCTACTAGTGTCCCACAGTGCTGCGCTAGTCCCTTCTGCCACCCTTCCCAGTCCCAGGAC
GGGCCCTGGAGGGAGAAAGGAGCCTGTGCCCCCTGATGGCTCTGGCTGTCCTGATCCTGTCTTCCCTCCCCTGAAGGAAAGTTTGCACTG
GATTTTATTGGAGCCCCATCTCCCCAGCGGGCAGGCGGGCGGAGCCTGTATATATGTATATACTCAGTGCCTCAGTTCAGCTTCCTCCAC
CTCGCTTCCACTGCACAGGCCCAGGAAGGAGAAAGGCCAAGCCAAAGTGGGCCCCACCCTGCCCCCGTCGTGCTCCATCCTTCCCTGCCG
GGGCCTGCTGGCCCCTGTAAGGTCCCGCCCCCAAAGACCCTGGGGCCAGCGGGGCCGAAAGCGGAGTTGGGTTTGCCTTATTTTGCTCAT
TGGATTCAAGTTCTTTTGCATAGTTTTCTTCTAACCCCTGTTGGAGTCCAGGGGCTGGAGAAAAGGACAGATTTATGCAGCTATTTTCAT
ACATTCCCTGTTCAGAGTGGGGTAGGGGTTCTCCGCCGTTACCCGATCCACTCCATCCCCCACCCTCTGAGGGGTGAGTGTGTCTTTGCA
TGTTTCCTTTGCTGTGGTGGGAGATAGTTTGACTGAACCCCCACCTTGACCTTGGTCTCCAGGGGTGTGGAATGGTGGGGGAATTTGTTT

>In-frame_PIAS3_ENST00000393045_chr1_145584836_+_BZRAP1_ENST00000355701_chr17_56384329_-_3482nt
GCATTTGCGGCCGGCGCCAGGGTGGAGAGTTGTGCGCCGGTCCCTGGGCCTGAGCTCCGGCTCCGGCTGGGGCGCCTGCGATGTCTCAAG
ATGGCGGAGCTGGGCGAATTAAAGCACATGGTGATGAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAG
AGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCTGCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTT
TACCGACGACGCTTTCCCCGGAAGACCCTGGGGCCCTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTGTAGGCTCCCCT
GGTCCTCTAGCTCCCATTCCCCCAACGCTGTTGGCCCCTGGCACCCTGCTGGGCCCCAAGCGTGAGGTGGACATGCACCCCCCTCTGCCC
CAGCCTGTGCACCCTGATGTCACCATGAAACCATTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACT
TCTAGCCAGCGGTTTGAGGAAGCGCACTTTACCTTTGCCCTCACACCCCAGCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCA
GGAGCCAAATGTGATTATACCATACAGGTGCAGCTAAGGTTCTGTCTCTGTGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAAC
CTCTTTGTCAAGGTCAATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCCCCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGC
CCCATCAACATCACACCCCTGGCTCGACTCTCAGCCACTGTTCCCAACACCATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTAC
TCCTTGTCTGTGTACCTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACAAAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCG
CGGGCACTGATCAAGGAGAAATTGACTGCTGACCCTGACAGTGAGGTGGCCACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGG
AAGATGCGCCTGACTGTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCAGAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAG
AAGCCTACATGGACATGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATCTCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCC
TGTTCAGATTGTGATGAGATCCAATTCATGGAAGATGGATCCTGGTGCCCAATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCG
CCAGGGTATGGGCTGGATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGATCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTG
ACAATAGAAAGCTCATCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCACTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGA
AGCAAAGGAGTCCTGACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAGCCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGT
CTCCCACTACATGAGTACCCACCTGCCTTCCCACTGGGAGCCGACATCCAAGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAG
GTGTTTGGGGACAAGGATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGGCCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTG
GCTGTGGACAGCCCTGCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTTGTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCG
TTTGTGTACTCCACAGCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCGCTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGT
CCAGGCCCCCCTAAGCTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTCCATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCC
CCCAATATGGACGTGGAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCATTACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTAT
GGGGAATTAAATGGACAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGGCCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGG
ACACCCCAGGCTGAGAGTCAGGACTGGGGCTGCACCACACAAGGGTCCCCAGGGCCCCCAGGTGGGCCTTGTACCCCCAGCTCTGGCAGC
GCCCCCAGGATTGAACGTGGGGAGCCCCAGGGCAGAAGCGAGAAGGTGTGGGGTTTCTTCTCCAAGGGGAAGCAGCTCCTCAGGAGGCTG
GGCTCTGGGAAGAAGGAGTGAAGCTGTGGCCCATCCTGCAGGCAGAAGAGGCCCTGAGAGGCCCCCAGATCACTGTCTCTGCTGAGCAGG
GAAGGCTCAGACTGGGCCCAGAGCCCCCGTTCTTCTGCGTTAACACTGTGGCATTCAGAGGGAATCAAAGAGCCTTGGTGAAGGTCAGAG
CTAAATGGCTCCTTAAGGATGAACTCTCTAGAGAAGCACCTTCCTCCTACAGGAGGGGAAACTGAGCCCACAGTGAGTATGTAACTTGAC
CAAGGTCACTGAGCCAGGACTGGACCCAGGACCCTCGCGTCCTGGTCCACCCACCTCGTCTACTAGTGTCCCACAGTGCTGCGCTAGTCC
CTTCTGCCACCCTTCCCAGTCCCAGGACGGGCCCTGGAGGGAGAAAGGAGCCTGTGCCCCCTGATGGCTCTGGCTGTCCTGATCCTGTCT
TCCCTCCCCTGAAGGAAAGTTTGCACTGGATTTTATTGGAGCCCCATCTCCCCAGCGGGCAGGCGGGCGGAGCCTGTATATATGTATATA
CTCAGTGCCTCAGTTCAGCTTCCTCCACCTCGCTTCCACTGCACAGGCCCAGGAAGGAGAAAGGCCAAGCCAAAGTGGGCCCCACCCTGC
CCCCGTCGTGCTCCATCCTTCCCTGCCGGGGCCTGCTGGCCCCTGTAAGGTCCCGCCCCCAAAGACCCTGGGGCCAGCGGGGCCGAAAGC
GGAGTTGGGTTTGCCTTATTTTGCTCATTGGATTCAAGTTCTTTTGCATAGTTTTCTTCTAACCCCTGTTGGAGTCCAGGGGCTGGAGAA
AAGGACAGATTTATGCAGCTATTTTCATACATTCCCTGTTCAGAGTGGGGTAGGGGTTCTCCGCCGTTACCCGATCCACTCCATCCCCCA
CCCTCTGAGGGGTGAGTGTGTCTTTGCATGTTTCCTTTGCTGTGGTGGGAGATAGTTTGACTGAACCCCCACCTTGACCTTGGTCTCCAG

>In-frame_PIAS3_ENST00000393045_chr1_145584836_+_BZRAP1_ENST00000343736_chr17_56384329_-_2510nt
GCATTTGCGGCCGGCGCCAGGGTGGAGAGTTGTGCGCCGGTCCCTGGGCCTGAGCTCCGGCTCCGGCTGGGGCGCCTGCGATGTCTCAAG
ATGGCGGAGCTGGGCGAATTAAAGCACATGGTGATGAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAG
AGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCTGCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTT
TACCGACGACGCTTTCCCCGGAAGACCCTGGGGCCCTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTGTAGGCTCCCCT
GGTCCTCTAGCTCCCATTCCCCCAACGCTGTTGGCCCCTGGCACCCTGCTGGGCCCCAAGCGTGAGGTGGACATGCACCCCCCTCTGCCC
CAGCCTGTGCACCCTGATGTCACCATGAAACCATTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACT
TCTAGCCAGCGGTTTGAGGAAGCGCACTTTACCTTTGCCCTCACACCCCAGCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCA
GGAGCCAAATGTGATTATACCATACAGGTGCAGCTAAGGTTCTGTCTCTGTGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAAC
CTCTTTGTCAAGGTCAATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCCCCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGC
CCCATCAACATCACACCCCTGGCTCGACTCTCAGCCACTGTTCCCAACACCATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTAC
TCCTTGTCTGTGTACCTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACAAAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCG
CGGGCACTGATCAAGGAGAAATTGACTGCTGACCCTGACAGTGAGGTGGCCACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGG
AAGATGCGCCTGACTGTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCAGAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAG
AAGCCTACATGGACATGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATCTCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCC
TGTTCAGATTGTGATGAGATCCAATTCATGGAAGATGGATCCTGGTGCCCAATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCG
CCAGGGTATGGGCTGGATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGATCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTG
ACAATAGAAAGCTCATCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCACTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGA
AGCAAAGGAGTCCTGACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAGCCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGT
CTCCCACTACATGAGTACCCACCTGCCTTCCCACTGGGAGCCGACATCCAAGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAG
GTGTTTGGGGACAAGGATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGGCCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTG
GCTGTGGACAGCCCTGCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTTGTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCG
TTTGTGTACTCCACAGCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCGCTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGT
CCAGGCCCCCCTAAGCTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTCCATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCC
CCCAATATGGACGTGGAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCATTACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTAT
GGGGAATTAAATGGACAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGGCCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGG
ACACCCCAGGCTGAGAGTCAGAGAACGAGGAGGAGAAGAGTCCAGTGCTAGATGGAGATAGATATATGTAGAGAGAGCAACATGACTGGG
GCTGCACCACACAAGGGTCCCCAGGGCCCCCAGGTGGGCCTTGTACCCCCAGCTCTGGCAGCGCCCCCAGGATTGAACGTGGGGAGCCCC

>In-frame_PIAS3_ENST00000369298_chr1_145584836_+_BZRAP1_ENST00000268893_chr17_56384329_-_3410nt
GCCGGTCCCTGGGCCTGAGCTCCGGCTCCGGCTGGGGCGCCTGCGATGTCTCAAGATGGCGGAGCTGGGCGAATTAAAGCACATGGTGAT
GAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAGAGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCT
GCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTTTACCGACGACGCTTTCCCCGGAAGACCCTGGGGCC
CTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTCCTGTGCACCCTGATGTCACCATGAAACCATTGCCCTTCTATGAAGT
CTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACTTCTAGCCAGCGGTTTGAGGAAGCGCACTTTACCTTTGCCCTCACACCCCA
GCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCAGGAGCCAAATGTGATTATACCATACAGGTGCAGCTAAGGTTCTGTCTCTG
TGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAACCTCTTTGTCAAGGTCAATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCC
CCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGCCCCATCAACATCACACCCCTGGCTCGACTCTCAGCCACTGTTCCCAACAC
CATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTACTCCTTGTCTGTGTACCTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACA
AAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCGCGGGCACTGATCAAGGAGAAATTGACTGCTGACCCTGACAGTGAGGTGGC
CACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGGAAGATGCGCCTGACTGTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCA
GAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAGAAGCCTACATGGACATGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATC
TCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCCTGTTCAGATTGTGATGAGATCCAATTCATGGAAGATGGATCCTGGTGCCC
AATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCGCCAGGGTATGGGCTGGATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGA
TCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTGACAATAGAAAGCTCATCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCA
CTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGAAGCAAAGGAGTCCTGACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAG
CCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGTCTCCCACTACATGAGTACCCACCTGCCTTCCCACTGGGAGCCGACATCCA
AGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAGGTGTTTGGGGACAAGGATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGG
CCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTGGCTGTGGACAGCCCTGCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTT
GTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCGTTTGTGTACTCCACAGCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCG
CTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGTCCAGGCCCCCCTAAGCTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTC
CATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCCCCCAATATGGACGTGGAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCAT
TACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTATGGGGAATTAAATGGACAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGG
CCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGGACACCCCAGGCTGAGAGTCAGAGAACGAGGAGGAGAAGAGTCCAGTGCTA
GATGGAGATAGATATATGTAGAGAGAGCAACATGACTGGGGCTGCACCACACAAGGGTCCCCAGGGCCCCCAGGTGGGCCTTGTACCCCC
AGCTCTGGCAGCGCCCCCAGGATTGAACGTGGGGAGCCCCAGGGCAGAAGCGAGAAGGTGTGGGGTTTCTTCTCCAAGGGGAAGCAGCTC
CTCAGGAGGCTGGGCTCTGGGAAGAAGGAGTGAAGCTGTGGCCCATCCTGCAGGCAGAAGAGGCCCTGAGAGGCCCCCAGATCACTGTCT
CTGCTGAGCAGGGAAGGCTCAGACTGGGCCCAGAGCCCCCGTTCTTCTGCGTTAACACTGTGGCATTCAGAGGGAATCAAAGAGCCTTGG
TGAAGGTCAGAGCTAAATGGCTCCTTAAGGATGAACTCTCTAGAGAAGCACCTTCCTCCTACAGGAGGGGAAACTGAGCCCACAGTGAGT
ATGTAACTTGACCAAGGTCACTGAGCCAGGACTGGACCCAGGACCCTCGCGTCCTGGTCCACCCACCTCGTCTACTAGTGTCCCACAGTG
CTGCGCTAGTCCCTTCTGCCACCCTTCCCAGTCCCAGGACGGGCCCTGGAGGGAGAAAGGAGCCTGTGCCCCCTGATGGCTCTGGCTGTC
CTGATCCTGTCTTCCCTCCCCTGAAGGAAAGTTTGCACTGGATTTTATTGGAGCCCCATCTCCCCAGCGGGCAGGCGGGCGGAGCCTGTA
TATATGTATATACTCAGTGCCTCAGTTCAGCTTCCTCCACCTCGCTTCCACTGCACAGGCCCAGGAAGGAGAAAGGCCAAGCCAAAGTGG
GCCCCACCCTGCCCCCGTCGTGCTCCATCCTTCCCTGCCGGGGCCTGCTGGCCCCTGTAAGGTCCCGCCCCCAAAGACCCTGGGGCCAGC
GGGGCCGAAAGCGGAGTTGGGTTTGCCTTATTTTGCTCATTGGATTCAAGTTCTTTTGCATAGTTTTCTTCTAACCCCTGTTGGAGTCCA
GGGGCTGGAGAAAAGGACAGATTTATGCAGCTATTTTCATACATTCCCTGTTCAGAGTGGGGTAGGGGTTCTCCGCCGTTACCCGATCCA
CTCCATCCCCCACCCTCTGAGGGGTGAGTGTGTCTTTGCATGTTTCCTTTGCTGTGGTGGGAGATAGTTTGACTGAACCCCCACCTTGAC

>In-frame_PIAS3_ENST00000369298_chr1_145584836_+_BZRAP1_ENST00000355701_chr17_56384329_-_3342nt
GCCGGTCCCTGGGCCTGAGCTCCGGCTCCGGCTGGGGCGCCTGCGATGTCTCAAGATGGCGGAGCTGGGCGAATTAAAGCACATGGTGAT
GAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAGAGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCT
GCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTTTACCGACGACGCTTTCCCCGGAAGACCCTGGGGCC
CTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTCCTGTGCACCCTGATGTCACCATGAAACCATTGCCCTTCTATGAAGT
CTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACTTCTAGCCAGCGGTTTGAGGAAGCGCACTTTACCTTTGCCCTCACACCCCA
GCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCAGGAGCCAAATGTGATTATACCATACAGGTGCAGCTAAGGTTCTGTCTCTG
TGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAACCTCTTTGTCAAGGTCAATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCC
CCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGCCCCATCAACATCACACCCCTGGCTCGACTCTCAGCCACTGTTCCCAACAC
CATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTACTCCTTGTCTGTGTACCTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACA
AAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCGCGGGCACTGATCAAGGAGAAATTGACTGCTGACCCTGACAGTGAGGTGGC
CACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGGAAGATGCGCCTGACTGTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCA
GAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAGAAGCCTACATGGACATGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATC
TCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCCTGTTCAGATTGTGATGAGATCCAATTCATGGAAGATGGATCCTGGTGCCC
AATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCGCCAGGGTATGGGCTGGATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGA
TCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTGACAATAGAAAGCTCATCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCA
CTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGAAGCAAAGGAGTCCTGACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAG
CCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGTCTCCCACTACATGAGTACCCACCTGCCTTCCCACTGGGAGCCGACATCCA
AGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAGGTGTTTGGGGACAAGGATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGG
CCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTGGCTGTGGACAGCCCTGCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTT
GTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCGTTTGTGTACTCCACAGCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCG
CTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGTCCAGGCCCCCCTAAGCTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTC
CATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCCCCCAATATGGACGTGGAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCAT
TACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTATGGGGAATTAAATGGACAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGG
CCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGGACACCCCAGGCTGAGAGTCAGGACTGGGGCTGCACCACACAAGGGTCCCC
AGGGCCCCCAGGTGGGCCTTGTACCCCCAGCTCTGGCAGCGCCCCCAGGATTGAACGTGGGGAGCCCCAGGGCAGAAGCGAGAAGGTGTG
GGGTTTCTTCTCCAAGGGGAAGCAGCTCCTCAGGAGGCTGGGCTCTGGGAAGAAGGAGTGAAGCTGTGGCCCATCCTGCAGGCAGAAGAG
GCCCTGAGAGGCCCCCAGATCACTGTCTCTGCTGAGCAGGGAAGGCTCAGACTGGGCCCAGAGCCCCCGTTCTTCTGCGTTAACACTGTG
GCATTCAGAGGGAATCAAAGAGCCTTGGTGAAGGTCAGAGCTAAATGGCTCCTTAAGGATGAACTCTCTAGAGAAGCACCTTCCTCCTAC
AGGAGGGGAAACTGAGCCCACAGTGAGTATGTAACTTGACCAAGGTCACTGAGCCAGGACTGGACCCAGGACCCTCGCGTCCTGGTCCAC
CCACCTCGTCTACTAGTGTCCCACAGTGCTGCGCTAGTCCCTTCTGCCACCCTTCCCAGTCCCAGGACGGGCCCTGGAGGGAGAAAGGAG
CCTGTGCCCCCTGATGGCTCTGGCTGTCCTGATCCTGTCTTCCCTCCCCTGAAGGAAAGTTTGCACTGGATTTTATTGGAGCCCCATCTC
CCCAGCGGGCAGGCGGGCGGAGCCTGTATATATGTATATACTCAGTGCCTCAGTTCAGCTTCCTCCACCTCGCTTCCACTGCACAGGCCC
AGGAAGGAGAAAGGCCAAGCCAAAGTGGGCCCCACCCTGCCCCCGTCGTGCTCCATCCTTCCCTGCCGGGGCCTGCTGGCCCCTGTAAGG
TCCCGCCCCCAAAGACCCTGGGGCCAGCGGGGCCGAAAGCGGAGTTGGGTTTGCCTTATTTTGCTCATTGGATTCAAGTTCTTTTGCATA
GTTTTCTTCTAACCCCTGTTGGAGTCCAGGGGCTGGAGAAAAGGACAGATTTATGCAGCTATTTTCATACATTCCCTGTTCAGAGTGGGG
TAGGGGTTCTCCGCCGTTACCCGATCCACTCCATCCCCCACCCTCTGAGGGGTGAGTGTGTCTTTGCATGTTTCCTTTGCTGTGGTGGGA
GATAGTTTGACTGAACCCCCACCTTGACCTTGGTCTCCAGGGGTGTGGAATGGTGGGGGAATTTGTTTAAAAAGACATTTTATTATAATA

>In-frame_PIAS3_ENST00000369298_chr1_145584836_+_BZRAP1_ENST00000343736_chr17_56384329_-_2370nt
GCCGGTCCCTGGGCCTGAGCTCCGGCTCCGGCTGGGGCGCCTGCGATGTCTCAAGATGGCGGAGCTGGGCGAATTAAAGCACATGGTGAT
GAGTTTCCGGGTGTCTGAGCTCCAGGTGCTTCTTGGCTTTGCTGGCCGGAACAAGAGTGGACGGAAGCACGAGCTCCTGGCCAAGGCTCT
GCACCTCCTGAAGTCCAGCTGTGCCCCTAGTGTCCAGATGAAGATCAAAGAGCTTTACCGACGACGCTTTCCCCGGAAGACCCTGGGGCC
CTCTGATCTCTCCCTTCTCTCTTTGCCCCCTGGCACCTCTCCTCCTGTGCACCCTGATGTCACCATGAAACCATTGCCCTTCTATGAAGT
CTATGGGGAGCTCATCCGGCCCACCACCCTTGCATCCACTTCTAGCCAGCGGTTTGAGGAAGCGCACTTTACCTTTGCCCTCACACCCCA
GCAAGTGCAGCAGATTCTTACATCCAGAGAGGTTCTGCCAGGAGCCAAATGTGATTATACCATACAGGTGCAGCTAAGGTTCTGTCTCTG
TGAGACCAGCTGCCCCCAGGAAGATTATTTTCCCCCCAACCTCTTTGTCAAGGTCAATGGGAAACTGTGCCCCCTGCCGGGTTACCTTCC
CCCAACCAAGAATGGGGCCGAGCCCAAGAGGCCCAGCCGCCCCATCAACATCACACCCCTGGCTCGACTCTCAGCCACTGTTCCCAACAC
CATTGTGGTCAATTGGTCATCTGAGTTCGGACGGAATTACTCCTTGTCTGTGTACCTGGTGAGGCAGTTGACTGCAGGAACCCTTCTACA
AAAACTCAGAGCAAAGGGTATCCGGAACCCAGACCACTCGCGGGCACTGATCAAGGAGAAATTGACTGCTGACCCTGACAGTGAGGTGGC
CACTACAAGTCTCCGGGTGTCACTCATGTGCCCGCTAGGGAAGATGCGCCTGACTGTCCCTTGTCGTGCCCTCACCTGCGCCCACCTGCA
GAGCTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAGAAGCCTACATGGACATGTCCTGTGTGTGACAAGAAGGCTCCCTATGAATC
TCTTATCATTGATGGTTTATTTATGGAGATTCTTAGTTCCTGTTCAGATTGTGATGAGATCCAATTCATGGAAGATGGATCCTGGTGCCC
AATGAAACCCAAGAAGGAGGCATCTGAGGTTTGCCCCCCGCCAGGGTATGGGCTGGATGGCCTCCAGTACAGCCCAGTCCAGGGGGGAGA
TCCATCAGAGAATAAGAAGAAGGTCGAAGTTATTGACTTGACAATAGAAAGCTCATCAGATGAGGAGGATCTGCCCCCTACCAAGAAGCA
CTGTTCTGTCACCTCAGCTGCCATCCCGGCCCTACCTGGAAGCAAAGGAGTCCTGACATCTGGCCACCAGCCATCCTCGGTGCTAAGGAG
CCCTGCTATGGGCACGTTGGGTGGGGATTTCCTGTCCAGTCTCCCACTACATGAGTACCCACCTGCCTTCCCACTGGGAGCCGACATCCA
AGGTTTAGATTTATTTTCATTTCTTCAGACAGAGAGTCAGGTGTTTGGGGACAAGGATGCCGATGGCTTCTACCAGGGCGAAGGTGGGGG
CCGGACAGGCTACATTCCCTGCAACATGGTGGCTGAGGTGGCTGTGGACAGCCCTGCTGGGAGACAGCAACTGCTCCAGCGGGGTTATTT
GTCCCCAGATATTCTCCTTGAGGGCTCAGGGAATGGTCCGTTTGTGTACTCCACAGCCCACACAACTGGGCCTCCTCCCAAGCCCCGCCG
CTCCAAGAAAGCTGAGTCGGAAGGCCCTGCCCAGCCCTGTCCAGGCCCCCCTAAGCTGGTCCCCTCTGCTGACCTGAAAGCTCCCCACTC
CATGGTGGCTGCATTTGACTACAACCCCCAGGAGAGTTCCCCCAATATGGACGTGGAGGCAGAGCTGCCCTTCCGGGCAGGGGATGTCAT
TACTGTGTTTGGGGGCATGGACGATGACGGTTTCTACTATGGGGAATTAAATGGACAAAGGGGCCTGGTTCCATCCAACTTCCTGGAGGG
CCCTGGGCCTGAGGCAGGCGGCCTGGACAGGGAACCCAGGACACCCCAGGCTGAGAGTCAGAGAACGAGGAGGAGAAGAGTCCAGTGCTA
GATGGAGATAGATATATGTAGAGAGAGCAACATGACTGGGGCTGCACCACACAAGGGTCCCCAGGGCCCCCAGGTGGGCCTTGTACCCCC
AGCTCTGGCAGCGCCCCCAGGATTGAACGTGGGGAGCCCCAGGGCAGAAGCGAGAAGGTGTGGGGTTTCTTCTCCAAGGGGAAGCAGCTC


Top

FusionGenePPI for PIAS3_BZRAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PIAS3MITF, RELA, GFI1, SMAD2, SMAD3, SMAD4, EP300, CREBBP, HMGA2, STAT3, AR, TRIM32, SIAH2, SIAH1, ZMIZ2, ZMIZ1, UBE2I, SREBF2, GLUL, HABP4, TRIM27, SATB1, CARHSP1, UBA1, PSMC1, C19orf60, TRIM8, RAC1, PPP1CA, ELAVL1, ERBB4, SUMO1, SUMO2, SERBP1, HNRNPK, ZFHX3, PRPF40A, SKIL, NCOA2, CREM, SERPINA10, GEMIN4, SUMO3, CBS, TAB2, TRIM63, TRIM55, HIC1, BCL11A, SMURF2BZRAP1TSPO, CACNA1A, KHDRBS1, ANKRD11, ARNT2, BZRAP1, DISC1, DLX2, BEND5, CEP76, GPRASP2, REL, TCF4, TSC22D4, CADPS2, DLGAP2, KIF1A, MVP, NDE1, RAPGEF4, CD244


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PIAS3_BZRAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PIAS3_BZRAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePIAS3C0007873Uterine Cervical Neoplasm1CTD_human