FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26837

FusionGeneSummary for PGPEP1_KDM4C

check button Fusion gene summary
Fusion gene informationFusion gene name: PGPEP1_KDM4C
Fusion gene ID: 26837
HgeneTgene
Gene symbol

PGPEP1

KDM4C

Gene ID

54858

23081

Gene namepyroglutamyl-peptidase Ilysine demethylase 4C
SynonymsPAP-I|PGI|PGP|PGP-I|PGPI|PcpGASC1|JHDM3C|JMJD2C|TDRD14C
Cytomap

19p13.11

9p24.1

Type of geneprotein-codingprotein-coding
Descriptionpyroglutamyl-peptidase 15-oxoprolyl-peptidasepGlu-peptidase Ipyroglutamyl aminopeptidase Ipyrrolidone-carboxylate peptidaselysine-specific demethylase 4CJmjC domain-containing histone demethylation protein 3Cgene amplified in squamous cell carcinoma 1 proteinjumonji domain-containing protein 2Clysine (K)-specific demethylase 4Ctudor domain containing 14C
Modification date2018052320180523
UniProtAcc

Q9NXJ5

Q9H3R0

Ensembl transtripts involved in fusion geneENST00000269919, ENST00000604499, 
ENST00000595066, ENST00000252813, 
ENST00000597431, 
ENST00000535193, 
ENST00000543771, ENST00000381306, 
ENST00000381309, ENST00000442236, 
ENST00000489243, ENST00000536108, 
ENST00000428870, ENST00000401787, 
Fusion gene scores* DoF score4 X 4 X 4=645 X 4 X 4=80
# samples 55
** MAII scorelog2(5/64*10)=-0.356143810225275
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PGPEP1 [Title/Abstract] AND KDM4C [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneKDM4C

GO:0006357

regulation of transcription by RNA polymerase II

17277772

TgeneKDM4C

GO:0033169

histone H3-K9 demethylation

18066052|21914792

TgeneKDM4C

GO:0070544

histone H3-K36 demethylation

21914792


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AQ-A04L-01BPGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000269919ENST00000535193PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000269919ENST00000543771PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000269919ENST00000381306PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000269919ENST00000381309PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000269919ENST00000442236PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000269919ENST00000489243PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000269919ENST00000536108PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000269919ENST00000428870PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000269919ENST00000401787PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000604499ENST00000535193PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000604499ENST00000543771PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000604499ENST00000381306PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000604499ENST00000381309PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000604499ENST00000442236PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000604499ENST00000489243PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000604499ENST00000536108PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000604499ENST00000428870PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000604499ENST00000401787PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
In-frameENST00000595066ENST00000535193PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
In-frameENST00000595066ENST00000543771PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
In-frameENST00000595066ENST00000381306PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
In-frameENST00000595066ENST00000381309PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
In-frameENST00000595066ENST00000442236PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000595066ENST00000489243PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000595066ENST00000536108PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000595066ENST00000428870PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000595066ENST00000401787PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000252813ENST00000535193PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000252813ENST00000543771PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000252813ENST00000381306PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000252813ENST00000381309PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
Frame-shitENST00000252813ENST00000442236PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000252813ENST00000489243PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000252813ENST00000536108PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000252813ENST00000428870PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
5CDS-intronENST00000252813ENST00000401787PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
intron-3CDSENST00000597431ENST00000535193PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
intron-3CDSENST00000597431ENST00000543771PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
intron-3CDSENST00000597431ENST00000381306PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
intron-3CDSENST00000597431ENST00000381309PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
intron-3CDSENST00000597431ENST00000442236PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
intron-intronENST00000597431ENST00000489243PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
intron-intronENST00000597431ENST00000536108PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
intron-intronENST00000597431ENST00000428870PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+
intron-intronENST00000597431ENST00000401787PGPEP1chr19

18468425

+KDM4Cchr9

7011698

+

Top

FusionProtFeatures for PGPEP1_KDM4C


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PGPEP1

Q9NXJ5

KDM4C

Q9H3R0

Removes 5-oxoproline from various penultimate amino acidresidues except L-proline. {ECO:0000269|PubMed:12651114}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PGPEP1_KDM4C


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000535193_chr9_7011698_+_445aa
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHN
KGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGR_GPVGWE_VGISLLHPLSLV_NKPSVLTLASLDQ
ALSVY_AQSQVFVRSRCRWFCSWDSWICPLLPTITVPTKAPSISHLELPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAAEQETNATVA
RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFITSEENIETSPPNAFLEEDGTSLLISCAKCCVRVHASC

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000543771_chr9_7011698_+_445aa
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHN
KGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGR_GPVGWE_VGISLLHPLSLV_NKPSVLTLASLDQ
ALSVY_AQSQVFVRSRCRWFCSWDSWICPLLPTITVPTKAPSISHLELPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAAEQETNATVA
RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFITSEENIETSPPNAFLEEDGTSLLISCAKCCVRVHASC

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000381306_chr9_7011698_+_679aa
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHN
KGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGR_GPVGWE_VGISLLHPLSLV_NKPSVLTLASLDQ
ALSVY_AQSQVFVRSRCRWFCSWDSWICPLLPTITVPTKAPSISHLELPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAAEQETNATVA
RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFITSEENIETSPPNAFLEEDGTSLLISCAKCCVRVHASC
TGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKR
VSGACIQCSYGRCPASFHVTCAHAAGVLMEPDDWPTVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRTYSCRVMAVTSQTFTE
VMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLTGAKTFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFV

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000381309_chr9_7011698_+_688aa
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHN
KGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGR_GPVGWE_VGISLLHPLSLV_NKPSVLTLASLDQ
ALSVY_AQSQVFVRSRCRWFCSWDSWICPLLPTITVPTKAPSISHLELPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAAEQETNATVA
RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFITSEENIETSPPNAFLEEDGTSLLISCAKCCVRVHASC
TGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKR
VSGACIQCSYGRCPASFHVTCAHAAGVLMEPDDWPTVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRTYSCRVMAVTSQTFTE
VMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLTGAKTFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFS

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000442236_chr9_7011698_+_688aa
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHN
KGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGR_GPVGWE_VGISLLHPLSLV_NKPSVLTLASLDQ
ALSVY_AQSQVFVRSRCRWFCSWDSWICPLLPTITVPTKAPSISHLELPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAAEQETNATVA
RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFITSEENIETSPPNAFLEEDGTSLLISCAKCCVRVHASC
TGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKR
VSGACIQCSYGRCPASFHVTCAHAAGVLMEPDDWPTVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRTYSCRVMAVTSQTFTE
VMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLTGAKTFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000535193_chr9_7011698_+_1335nt
ATGGAGCAGCCGAGGAAGGCGGTGGTAGTGACGGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAG
CTAGAAAAGCTAGGCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCC
CTGTGGGAGAAGCACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAAC
AAGGGCTACAAGGGGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATC
GACATGGATGCTGTGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTG
GGGTGGGAGTGAGTGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAA
GCACTCAGTGTATACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTT
CTCCCCACCATCACGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAA
ACAGAGTCTTGGGCGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCC
AGGATGAAGCCACACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAG
ACAAAATTAGATGAAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAA
TATTCTCCACCCAATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGT
TATGGTATTCCTTCTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAAT
TTGAGAGGAGGTGCTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAAT

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000543771_chr9_7011698_+_1335nt
ATGGAGCAGCCGAGGAAGGCGGTGGTAGTGACGGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAG
CTAGAAAAGCTAGGCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCC
CTGTGGGAGAAGCACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAAC
AAGGGCTACAAGGGGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATC
GACATGGATGCTGTGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTG
GGGTGGGAGTGAGTGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAA
GCACTCAGTGTATACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTT
CTCCCCACCATCACGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAA
ACAGAGTCTTGGGCGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCC
AGGATGAAGCCACACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAG
ACAAAATTAGATGAAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAA
TATTCTCCACCCAATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGT
TATGGTATTCCTTCTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAAT
TTGAGAGGAGGTGCTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAAT

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000381306_chr9_7011698_+_2037nt
ATGGAGCAGCCGAGGAAGGCGGTGGTAGTGACGGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAG
CTAGAAAAGCTAGGCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCC
CTGTGGGAGAAGCACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAAC
AAGGGCTACAAGGGGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATC
GACATGGATGCTGTGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTG
GGGTGGGAGTGAGTGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAA
GCACTCAGTGTATACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTT
CTCCCCACCATCACGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAA
ACAGAGTCTTGGGCGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCC
AGGATGAAGCCACACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAG
ACAAAATTAGATGAAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAA
TATTCTCCACCCAATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGT
TATGGTATTCCTTCTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAAT
TTGAGAGGAGGTGCTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAAT
GTCCCAGAAAGGACACAAATAGATGTAGGCAGAATACCTTTACAGAGGTTAAAATTGAAATGCATCTTCTGCAGACACCGGGTTAAGAGG
GTCTCTGGAGCCTGCATCCAGTGTTCCTACGGTCGCTGCCCGGCCTCCTTCCATGTCACTTGTGCCCATGCTGCTGGGGTACTGATGGAG
CCTGATGACTGGCCTTATGTGGTGAACATTACATGCTTTCGACATAAGGTCAACCCCAACGTGAAGTCCAAGGCTTGCGAGAAGGTCATT
TCCGTGGGTCAAACGGTCATCACGAAGCATCGGAACACCCGGTATTACAGTTGCAGAGTGATGGCTGTGACATCGCAGACCTTCTATGAG
GTCATGTTTGATGATGGCTCCTTTAGCAGAGACACATTTCCTGAGGATATCGTGAGCCGAGACTGTCTGAAGCTGGGCCCACCTGCTGAG
GGAGAAGTCGTCCAAGTCAAGTGGCCCGATGGCAAACTCTATGGAGCAAAATATTTTGGATCAAATATTGCCCACATGTACCAGGTTGAG
TTTGAAGATGGATCCCAGATAGCAATGAAGAGAGAGGACATCTACACTTTAGATGAAGAGTTACCCAAGAGAGTGAAAGCTCGATTTGTA
AGTGCTGGCAGATGCCACTTGGGGACCTGCCAAGTGAATTCCTTGTCCTCACCTCATGTTTCCCAAGCCCAGCAGGAAACATACTTGGGC

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000381309_chr9_7011698_+_2064nt
ATGGAGCAGCCGAGGAAGGCGGTGGTAGTGACGGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAG
CTAGAAAAGCTAGGCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCC
CTGTGGGAGAAGCACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAAC
AAGGGCTACAAGGGGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATC
GACATGGATGCTGTGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTG
GGGTGGGAGTGAGTGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAA
GCACTCAGTGTATACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTT
CTCCCCACCATCACGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAA
ACAGAGTCTTGGGCGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCC
AGGATGAAGCCACACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAG
ACAAAATTAGATGAAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAA
TATTCTCCACCCAATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGT
TATGGTATTCCTTCTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAAT
TTGAGAGGAGGTGCTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAAT
GTCCCAGAAAGGACACAAATAGATGTAGGCAGAATACCTTTACAGAGGTTAAAATTGAAATGCATCTTCTGCAGACACCGGGTTAAGAGG
GTCTCTGGAGCCTGCATCCAGTGTTCCTACGGTCGCTGCCCGGCCTCCTTCCATGTCACTTGTGCCCATGCTGCTGGGGTACTGATGGAG
CCTGATGACTGGCCTTATGTGGTGAACATTACATGCTTTCGACATAAGGTCAACCCCAACGTGAAGTCCAAGGCTTGCGAGAAGGTCATT
TCCGTGGGTCAAACGGTCATCACGAAGCATCGGAACACCCGGTATTACAGTTGCAGAGTGATGGCTGTGACATCGCAGACCTTCTATGAG
GTCATGTTTGATGATGGCTCCTTTAGCAGAGACACATTTCCTGAGGATATCGTGAGCCGAGACTGTCTGAAGCTGGGCCCACCTGCTGAG
GGAGAAGTCGTCCAAGTCAAGTGGCCCGATGGCAAACTCTATGGAGCAAAATATTTTGGATCAAATATTGCCCACATGTACCAGGTTGAG
TTTGAAGATGGATCCCAGATAGCAATGAAGAGAGAGGACATCTACACTTTAGATGAAGAGTTACCCAAGAGAGTGAAAGCTCGATTTTCC
ACAGCCTCTGACATGCGATTTGAAGACACGTTTTATGGAGCAGACATTATCCAAGGGGAGAGAAAGAGACAAAGAGTGCTGAGCTCCAGG

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000442236_chr9_7011698_+_2064nt
ATGGAGCAGCCGAGGAAGGCGGTGGTAGTGACGGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAG
CTAGAAAAGCTAGGCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCC
CTGTGGGAGAAGCACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAAC
AAGGGCTACAAGGGGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATC
GACATGGATGCTGTGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTG
GGGTGGGAGTGAGTGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAA
GCACTCAGTGTATACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTT
CTCCCCACCATCACGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAA
ACAGAGTCTTGGGCGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCC
AGGATGAAGCCACACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAG
ACAAAATTAGATGAAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAA
TATTCTCCACCCAATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGT
TATGGTATTCCTTCTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAAT
TTGAGAGGAGGTGCTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAAT
GTCCCAGAAAGGACACAAATAGATGTAGGCAGAATACCTTTACAGAGGTTAAAATTGAAATGCATCTTCTGCAGACACCGGGTTAAGAGG
GTCTCTGGAGCCTGCATCCAGTGTTCCTACGGTCGCTGCCCGGCCTCCTTCCATGTCACTTGTGCCCATGCTGCTGGGGTACTGATGGAG
CCTGATGACTGGCCTTATGTGGTGAACATTACATGCTTTCGACATAAGGTCAACCCCAACGTGAAGTCCAAGGCTTGCGAGAAGGTCATT
TCCGTGGGTCAAACGGTCATCACGAAGCATCGGAACACCCGGTATTACAGTTGCAGAGTGATGGCTGTGACATCGCAGACCTTCTATGAG
GTCATGTTTGATGATGGCTCCTTTAGCAGAGACACATTTCCTGAGGATATCGTGAGCCGAGACTGTCTGAAGCTGGGCCCACCTGCTGAG
GGAGAAGTCGTCCAAGTCAAGTGGCCCGATGGCAAACTCTATGGAGCAAAATATTTTGGATCAAATATTGCCCACATGTACCAGGTTGAG
TTTGAAGATGGATCCCAGATAGCAATGAAGAGAGAGGACATCTACACTTTAGATGAAGAGTTACCCAAGAGAGTGAAAGCTCGATTTTCC
ACAGCCTCTGACATGCGATTTGAAGACACGTTTTATGGAGCAGACATTATCCAAGGGGAGAGAAAGAGACAAAGAGTGCTGAGCTCCAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000535193_chr9_7011698_+_2403nt
TGCTTTGCAGAAAAGGAGAAGCGCGCGGCTTCCTCCCGCCTCCTTCCCTCCTTTCTTCCCCCGCCCCTTCTGTTTCGCCAACCCCGACGC
GGCGCCTTCGCTGCCGCCCTGCGAGAGCGCGAGCGTGCTGCACCTCGGGAGCTGGCGGCTGAGCTGCCAGGAGCCCAGCCCAGCTGAATC
GAGCGGAGCCGGTGGAGCAGGGGCCTTGTGGGTACCCGGTTGGGCAGGGAGAGGTGCGGCTCTGCGACGGAAACAATCGCCAGAGATGCC
GGGGCTAGCCTTCCCCACCAGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAGCTAGAAAAGCTAG
GCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCCCTGTGGGAGAAGC
ACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAACAAGGGCTACAAGG
GGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATCGACATGGATGCTG
TGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTGGGGTGGGAGTGAG
TGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAAGCACTCAGTGTAT
ACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTTCTCCCCACCATCA
CGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAAACAGAGTCTTGGG
CGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCCAGGATGAAGCCAC
ACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAGACAAAATTAGATG
AAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAATATTCTCCACCCA
ATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGTTATGGTATTCCTT
CTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAATTTGAGAGGAGGTG
CTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAATGTCCCAGAAAGGA
CACAAATAGATGTAGGCAGAATACCTTTACAGAGGTTAAAATTGGGAAGGCTGGGAATCTAGACACAGCAACAGTAACAACAACAACAAT
AACAATGAAGGCTCACTGTGAAAACATCAATTCATTAGGAAAGTTACATCCCCTCCGCCACTGTTTCAGATGCTGTTTCTCATTCTCCAT
GGGAGCAGCCAGCATCGTGTTTAGGATGGGGATACAATAGCCTGAGCTCCTGATTGAGTCAGACCCTGGACTTTCCCTTTTGTATCTGTC
ATTTTCCTCTGGATCCTCACACCTTTGTGTTTAATTTTTTTAAATTTCATTTGTTGACTTCCTATGTGGGGTAAAATGACTTCCTTTGAT
TAATGTACTTTCTGTATCCTAGAGTTTCCCTTTCCCTTTGTGATTTAGTCCAACGTGTCCTACTACAGCCTCAAAAATTGTCATTGGAAT
CAAAAGCTTTCCAAGGTGCATCAGGTTAATGATTTGGATGCATCCTGAGGTTGTCTCCTGTAGCATGGAGGCATTATAATAGGAGTCTCA
GAAGTTACACCATTTTTCTACAGCACATCACAGGCCCAGAGGCTTGAATCTAAGAGAATCCACTCTATGTCTGTCAGCCTGAATCCTTCC
TTCTTGCTGCACAACAAAGCAACTGAACGTATTTTGAGTTTAGGTGAAAACTATCACTCATTCATCAAAGTTCTATCTGGGTGATATATG
CTATCGAAACAGATGTGGACACTGGGCTGACAGATGTTGAGAACGGACCTGTTGCTGAAGCTCATGTTATCACACATGCTGTGGGAAGAG

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000543771_chr9_7011698_+_2403nt
TGCTTTGCAGAAAAGGAGAAGCGCGCGGCTTCCTCCCGCCTCCTTCCCTCCTTTCTTCCCCCGCCCCTTCTGTTTCGCCAACCCCGACGC
GGCGCCTTCGCTGCCGCCCTGCGAGAGCGCGAGCGTGCTGCACCTCGGGAGCTGGCGGCTGAGCTGCCAGGAGCCCAGCCCAGCTGAATC
GAGCGGAGCCGGTGGAGCAGGGGCCTTGTGGGTACCCGGTTGGGCAGGGAGAGGTGCGGCTCTGCGACGGAAACAATCGCCAGAGATGCC
GGGGCTAGCCTTCCCCACCAGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAGCTAGAAAAGCTAG
GCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCCCTGTGGGAGAAGC
ACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAACAAGGGCTACAAGG
GGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATCGACATGGATGCTG
TGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTGGGGTGGGAGTGAG
TGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAAGCACTCAGTGTAT
ACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTTCTCCCCACCATCA
CGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAAACAGAGTCTTGGG
CGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCCAGGATGAAGCCAC
ACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAGACAAAATTAGATG
AAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAATATTCTCCACCCA
ATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGTTATGGTATTCCTT
CTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAATTTGAGAGGAGGTG
CTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAATGTCCCAGAAAGGA
CACAAATAGATGTAGGCAGAATACCTTTACAGAGGTTAAAATTGGGAAGGCTGGGAATCTAGACACAGCAACAGTAACAACAACAACAAT
AACAATGAAGGCTCACTGTGAAAACATCAATTCATTAGGAAAGTTACATCCCCTCCGCCACTGTTTCAGATGCTGTTTCTCATTCTCCAT
GGGAGCAGCCAGCATCGTGTTTAGGATGGGGATACAATAGCCTGAGCTCCTGATTGAGTCAGACCCTGGACTTTCCCTTTTGTATCTGTC
ATTTTCCTCTGGATCCTCACACCTTTGTGTTTAATTTTTTTAAATTTCATTTGTTGACTTCCTATGTGGGGTAAAATGACTTCCTTTGAT
TAATGTACTTTCTGTATCCTAGAGTTTCCCTTTCCCTTTGTGATTTAGTCCAACGTGTCCTACTACAGCCTCAAAAATTGTCATTGGAAT
CAAAAGCTTTCCAAGGTGCATCAGGTTAATGATTTGGATGCATCCTGAGGTTGTCTCCTGTAGCATGGAGGCATTATAATAGGAGTCTCA
GAAGTTACACCATTTTTCTACAGCACATCACAGGCCCAGAGGCTTGAATCTAAGAGAATCCACTCTATGTCTGTCAGCCTGAATCCTTCC
TTCTTGCTGCACAACAAAGCAACTGAACGTATTTTGAGTTTAGGTGAAAACTATCACTCATTCATCAAAGTTCTATCTGGGTGATATATG
CTATCGAAACAGATGTGGACACTGGGCTGACAGATGTTGAGAACGGACCTGTTGCTGAAGCTCATGTTATCACACATGCTGTGGGAAGAG

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000381306_chr9_7011698_+_3186nt
TGCTTTGCAGAAAAGGAGAAGCGCGCGGCTTCCTCCCGCCTCCTTCCCTCCTTTCTTCCCCCGCCCCTTCTGTTTCGCCAACCCCGACGC
GGCGCCTTCGCTGCCGCCCTGCGAGAGCGCGAGCGTGCTGCACCTCGGGAGCTGGCGGCTGAGCTGCCAGGAGCCCAGCCCAGCTGAATC
GAGCGGAGCCGGTGGAGCAGGGGCCTTGTGGGTACCCGGTTGGGCAGGGAGAGGTGCGGCTCTGCGACGGAAACAATCGCCAGAGATGCC
GGGGCTAGCCTTCCCCACCAGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAGCTAGAAAAGCTAG
GCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCCCTGTGGGAGAAGC
ACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAACAAGGGCTACAAGG
GGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATCGACATGGATGCTG
TGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTGGGGTGGGAGTGAG
TGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAAGCACTCAGTGTAT
ACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTTCTCCCCACCATCA
CGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAAACAGAGTCTTGGG
CGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCCAGGATGAAGCCAC
ACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAGACAAAATTAGATG
AAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAATATTCTCCACCCA
ATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGTTATGGTATTCCTT
CTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAATTTGAGAGGAGGTG
CTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAATGTCCCAGAAAGGA
CACAAATAGATGTAGGCAGAATACCTTTACAGAGGTTAAAATTGAAATGCATCTTCTGCAGACACCGGGTTAAGAGGGTCTCTGGAGCCT
GCATCCAGTGTTCCTACGGTCGCTGCCCGGCCTCCTTCCATGTCACTTGTGCCCATGCTGCTGGGGTACTGATGGAGCCTGATGACTGGC
CTTATGTGGTGAACATTACATGCTTTCGACATAAGGTCAACCCCAACGTGAAGTCCAAGGCTTGCGAGAAGGTCATTTCCGTGGGTCAAA
CGGTCATCACGAAGCATCGGAACACCCGGTATTACAGTTGCAGAGTGATGGCTGTGACATCGCAGACCTTCTATGAGGTCATGTTTGATG
ATGGCTCCTTTAGCAGAGACACATTTCCTGAGGATATCGTGAGCCGAGACTGTCTGAAGCTGGGCCCACCTGCTGAGGGAGAAGTCGTCC
AAGTCAAGTGGCCCGATGGCAAACTCTATGGAGCAAAATATTTTGGATCAAATATTGCCCACATGTACCAGGTTGAGTTTGAAGATGGAT
CCCAGATAGCAATGAAGAGAGAGGACATCTACACTTTAGATGAAGAGTTACCCAAGAGAGTGAAAGCTCGATTTGTAAGTGCTGGCAGAT
GCCACTTGGGGACCTGCCAAGTGAATTCCTTGTCCTCACCTCATGTTTCCCAAGCCCAGCAGGAAACATACTTGGGCTTTTGGATTAATT
CTAAAAAAAGCCAATGCAACATTTTCCTTAGTGGAACCTATTGAATGCAAACTTCAAATTCAACCAAAATCGGGGAAATTAATGCATGTG
CTTTACTTTTCTTCTAATGAAGTCACATGATGCTTCTTTGTGTTGACATTTATTGGTGCACAAAAATACTTACTGAATGTGTGCTCTGTG
TAAAACACCAGGAGCAAACAAAGATACCATCAAGGCATTTGCAATCTTGTTAGTAGAAGCAACATTAAAAGTATTCAGGAGTAGATCAAA
GGGGACTCGGCATAATTGAATGTCTGTCTATTCTTTTATAGGTTTTTCATGGATTGACTACCTTCTGTCTCAGAAAGTTACTGATGTTTG
TGTCAGTTCATCATTAAGCTAAACTCTGACTTTCATAATAAAAGGGATAAACAAAGCCTAAATGCTAGTTGTGGGAATACTAAAGCAGTT
TTTTAAAAAGGAAATAGTAGTTTCATGCCCTCACATACCATTAAAAGATGAACAAACATGGACAAATATTCAAAACTGCAGTCATTGAAA
AATATAATTCACAATAATTTAGACTTCATATTATTGTATCATAAAATATTCAGTGGACCCTGAAATGAAGTCAGTTTTATTCATTTAGAA
TTATATCTATTGTGTCTGTGAAATGATAAATCCTAAATAGAGAAATTTGAATGGATGGGGTTTTTCTGACTAAAATGAAATTTTTTTTCT
GAATAATTCAGTTTAGTGAGTGCTTATGATATACTTGTCTGCAGTGATAGAGTCACTATAGATTATTTGGTTATTTTGGAAAAACCAAGG
GTTTTCTTAAATCAGGGATGTCCAATCTTTTTGCATCCCTGGGCCATACTTGAAGAAGAAGAATTGTCTTTGGCCTCACATAAACTACAC

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000381309_chr9_7011698_+_3240nt
TGCTTTGCAGAAAAGGAGAAGCGCGCGGCTTCCTCCCGCCTCCTTCCCTCCTTTCTTCCCCCGCCCCTTCTGTTTCGCCAACCCCGACGC
GGCGCCTTCGCTGCCGCCCTGCGAGAGCGCGAGCGTGCTGCACCTCGGGAGCTGGCGGCTGAGCTGCCAGGAGCCCAGCCCAGCTGAATC
GAGCGGAGCCGGTGGAGCAGGGGCCTTGTGGGTACCCGGTTGGGCAGGGAGAGGTGCGGCTCTGCGACGGAAACAATCGCCAGAGATGCC
GGGGCTAGCCTTCCCCACCAGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAGCTAGAAAAGCTAG
GCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCCCTGTGGGAGAAGC
ACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAACAAGGGCTACAAGG
GGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATCGACATGGATGCTG
TGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTGGGGTGGGAGTGAG
TGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAAGCACTCAGTGTAT
ACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTTCTCCCCACCATCA
CGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAAACAGAGTCTTGGG
CGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCCAGGATGAAGCCAC
ACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAGACAAAATTAGATG
AAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAATATTCTCCACCCA
ATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGTTATGGTATTCCTT
CTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAATTTGAGAGGAGGTG
CTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAATGTCCCAGAAAGGA
CACAAATAGATGTAGGCAGAATACCTTTACAGAGGTTAAAATTGAAATGCATCTTCTGCAGACACCGGGTTAAGAGGGTCTCTGGAGCCT
GCATCCAGTGTTCCTACGGTCGCTGCCCGGCCTCCTTCCATGTCACTTGTGCCCATGCTGCTGGGGTACTGATGGAGCCTGATGACTGGC
CTTATGTGGTGAACATTACATGCTTTCGACATAAGGTCAACCCCAACGTGAAGTCCAAGGCTTGCGAGAAGGTCATTTCCGTGGGTCAAA
CGGTCATCACGAAGCATCGGAACACCCGGTATTACAGTTGCAGAGTGATGGCTGTGACATCGCAGACCTTCTATGAGGTCATGTTTGATG
ATGGCTCCTTTAGCAGAGACACATTTCCTGAGGATATCGTGAGCCGAGACTGTCTGAAGCTGGGCCCACCTGCTGAGGGAGAAGTCGTCC
AAGTCAAGTGGCCCGATGGCAAACTCTATGGAGCAAAATATTTTGGATCAAATATTGCCCACATGTACCAGGTTGAGTTTGAAGATGGAT
CCCAGATAGCAATGAAGAGAGAGGACATCTACACTTTAGATGAAGAGTTACCCAAGAGAGTGAAAGCTCGATTTTCCACAGCCTCTGACA
TGCGATTTGAAGACACGTTTTATGGAGCAGACATTATCCAAGGGGAGAGAAAGAGACAAAGAGTGCTGAGCTCCAGGTTTAAGAATGAAT
ATGTGGCCGACCCTGTATACCGCACTTTTTTGAAGAGCTCTTTCCAGAAGAAGTGCCAGAAGAGACAGTAGTCTGCATACATCGCTGCAG
GCCACAGAGCAGCTTGGGTTGGAAGAGAGAAGATGAAGGGACATCCTTGGGGCTGTGCCGTGAGTTTTGCTGGCATAGGTGACAGGGTGT
GTCTCTGACAGTGGTAAATCGGGTTTCCAGAGTTTGGTCACCAAAAATACAAAATACACCCAATGAATTGGACGCAGCAATCTGAAATCA
TCTCTAGTCTTGCTTTCACTTGTGAGCAGTTGTCTTCTATGATCCCAAAGAAGTTTTCTAAGTGAAAGGAAATACTAGTGAATCACCCAC
AAGGAAAAGCCACTGCCACAGAGGAGGCGGGTCCCCTTGTGCGGCTTAGGGCCCTGTCAGGAAACACACGGGGACCTCTCTCTCTAGCTC
CAGCAGGTGGCACCTCGGTACCCAGCGGGTAGGGCGATAATTTATATATTTTCCACAGTCAGGGAAGGACTCTCACTTATTTGTTTCAAA
TTGCAGTTTTTATAAAACATTTTTAAAACACAAATGGCATGTATGCTAATGAGATTTACCCGTGTGCTATCTGTATTTCCCTTGTACAGA
ACTTTTACATTTTTGAATATTCCTATTACTTTTGATTGTGTCTGATGGGAACTGAGTTGTTGGCCTTTGTGAAATGAAATTTTTGGCTCT
TGAGAAAGAATTCTTATGAATTGTTATGCGAATTTTATATATTTAAAGAGGGAGATCTGGGGCTGTTATTTTTAAACACTTTTTTTCATA
ATACATATTCCGAGTAGATATTTATAAAATATATGTTTCTTTCATTATGTGTTTGTAAAATTAGAGTTTAAATAAATATGCTTTGATGCA
TAGTTTTGAACTAATGTAACATGATTTTTCTTTTTTAAAACAGCCTGAAAATGTACTAGTGTTTAAAAATAAAGATTTCCATTTTCTCCA

>In-frame_PGPEP1_ENST00000595066_chr19_18468425_+_KDM4C_ENST00000442236_chr9_7011698_+_2416nt
TGCTTTGCAGAAAAGGAGAAGCGCGCGGCTTCCTCCCGCCTCCTTCCCTCCTTTCTTCCCCCGCCCCTTCTGTTTCGCCAACCCCGACGC
GGCGCCTTCGCTGCCGCCCTGCGAGAGCGCGAGCGTGCTGCACCTCGGGAGCTGGCGGCTGAGCTGCCAGGAGCCCAGCCCAGCTGAATC
GAGCGGAGCCGGTGGAGCAGGGGCCTTGTGGGTACCCGGTTGGGCAGGGAGAGGTGCGGCTCTGCGACGGAAACAATCGCCAGAGATGCC
GGGGCTAGCCTTCCCCACCAGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCAGTTGGATTGCAGTTCAGGAGCTAGAAAAGCTAG
GCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGATTCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCCCTGTGGGAGAAGC
ACAGTCCACAGCTGGTGGTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAACAAGGGCTACAAGG
GGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGACTCCATCATCGACATGGATGCTG
TGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATCTCGCAGGATGCCGGCAGGTAGGGCCCTGTGGGGTGGGAGTGAG
TGGGGATTTCCCTCCTCCACCCACTGAGCCTGGTGTAGAACAAGCCAAGCGTGTTGACCTTGGCCTCTTTGGACCAAGCACTCAGTGTAT
ACTAGGCACAGAGCCAAGTATTTGTACGTAGCAGGTGCCGTTGGTTCTGCTCCTGGGACTCATGGATCTGCCCACTTCTCCCCACCATCA
CGGTCCCCACCAAGGCCCCCAGCATCTCCCACCTGGAATTGCCTGAGGTTCTGTCCATTGAGGAGGAAGTGGAAGAAACAGAGTCTTGGG
CGAAACCTCTCATCCACCTTTGGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCCAGGATGAAGCCAC
ACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCAATGAAGAAAATGATGCTAGATGGGAGACAAAATTAGATG
AAGTCGTTACATCGGAGGGAAAGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAATATTCTCCACCCA
ATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGTGCTGCGTACGGGTTCATGCAAGTTGTTATGGTATTCCTT
CTCATGAGATCTGTGATGGATGGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAATTTGAGAGGAGGTG
CTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTGCGGTCCCAGAAGTTCGATTCACTAATGTCCCAGAAAGGA
CACAAATAGATGTAGGCAGAATACCTTTACAGAGGTTAAAATTGAAATGCATCTTCTGCAGACACCGGGTTAAGAGGGTCTCTGGAGCCT
GCATCCAGTGTTCCTACGGTCGCTGCCCGGCCTCCTTCCATGTCACTTGTGCCCATGCTGCTGGGGTACTGATGGAGCCTGATGACTGGC
CTTATGTGGTGAACATTACATGCTTTCGACATAAGGTCAACCCCAACGTGAAGTCCAAGGCTTGCGAGAAGGTCATTTCCGTGGGTCAAA
CGGTCATCACGAAGCATCGGAACACCCGGTATTACAGTTGCAGAGTGATGGCTGTGACATCGCAGACCTTCTATGAGGTCATGTTTGATG
ATGGCTCCTTTAGCAGAGACACATTTCCTGAGGATATCGTGAGCCGAGACTGTCTGAAGCTGGGCCCACCTGCTGAGGGAGAAGTCGTCC
AAGTCAAGTGGCCCGATGGCAAACTCTATGGAGCAAAATATTTTGGATCAAATATTGCCCACATGTACCAGGTTGAGTTTGAAGATGGAT
CCCAGATAGCAATGAAGAGAGAGGACATCTACACTTTAGATGAAGAGTTACCCAAGAGAGTGAAAGCTCGATTTTCCACAGCCTCTGACA
TGCGATTTGAAGACACGTTTTATGGAGCAGACATTATCCAAGGGGAGAGAAAGAGACAAAGAGTGCTGAGCTCCAGGTTTAAGAATGAAT
ATGTGGCCGACCCTGTATACCGCACTTTTTTGAAGAGCTCTTTCCAGAAGAAGTGCCAGAAGAGACAGTAGTCTGCATACATCGCTGCAG


Top

FusionGenePPI for PGPEP1_KDM4C


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PGPEP1GTF2I, TNNT3, SELO, HBB, TRIM11, HBA2, GFERKDM4CKDM4A, KDM4C, HIST1H3A, H3F3A, PPARG, HDAC1, HDAC3, HIST2H3C, SHMT2, MOV10, NXF1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PGPEP1_KDM4C


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PGPEP1_KDM4C


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneKDM4CC0025149Medulloblastoma1CTD_human
TgeneKDM4CC0236663Alcohol withdrawal syndrome1PSYGENET