FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26571

FusionGeneSummary for PDSS2_LMBRD1

check button Fusion gene summary
Fusion gene informationFusion gene name: PDSS2_LMBRD1
Fusion gene ID: 26571
HgeneTgene
Gene symbol

PDSS2

LMBRD1

Gene ID

57107

55788

Gene namedecaprenyl diphosphate synthase subunit 2LMBR1 domain containing 1
SynonymsC6orf210|COQ10D3|DLP1|bA59I9.3|hDLP1C6orf209|LMBD1|MAHCF|NESI
Cytomap

6q21

6q13

Type of geneprotein-codingprotein-coding
Descriptiondecaprenyl-diphosphate synthase subunit 2all-trans-decaprenyl-diphosphate synthase subunit 2decaprenyl pyrophosphate synthase subunit 2decaprenyl pyrophosphate synthetase subunit 2prenyl (decaprenyl) diphosphate synthase, subunit 2subunit 2 of decaprprobable lysosomal cobalamin transporterHDAg-L-interacting protein NESIhepatitis delta antigen-L interacting proteinliver regeneration p-53 related proteinnuclear export signal-interacting protein
Modification date2018052720180522
UniProtAcc

Q86YH6

Q9NUN5

Ensembl transtripts involved in fusion geneENST00000369037, ENST00000453874, 
ENST00000369031, 
ENST00000370577, 
ENST00000370570, 
Fusion gene scores* DoF score5 X 5 X 3=755 X 3 X 4=60
# samples 67
** MAII scorelog2(6/75*10)=-0.321928094887362
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/60*10)=0.222392421336448
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PDSS2 [Title/Abstract] AND LMBRD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePDSS2

GO:0006744

ubiquinone biosynthetic process

16262699

HgenePDSS2

GO:0008299

isoprenoid biosynthetic process

16262699


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E9-A229-01APDSS2chr6

107595233

-LMBRD1chr6

70428973

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000369037ENST00000370577PDSS2chr6

107595233

-LMBRD1chr6

70428973

-
In-frameENST00000369037ENST00000370570PDSS2chr6

107595233

-LMBRD1chr6

70428973

-
In-frameENST00000453874ENST00000370577PDSS2chr6

107595233

-LMBRD1chr6

70428973

-
In-frameENST00000453874ENST00000370570PDSS2chr6

107595233

-LMBRD1chr6

70428973

-
In-frameENST00000369031ENST00000370577PDSS2chr6

107595233

-LMBRD1chr6

70428973

-
In-frameENST00000369031ENST00000370570PDSS2chr6

107595233

-LMBRD1chr6

70428973

-

Top

FusionProtFeatures for PDSS2_LMBRD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PDSS2

Q86YH6

LMBRD1

Q9NUN5

Supplies decaprenyl diphosphate, the precursor for theside chain of the isoprenoid quinones ubiquinone-10.{ECO:0000269|PubMed:16262699}. Probable lysosomal cobalamin transporter. Required toexport cobalamin from lysosomes allowing its conversion tocofactors. {ECO:0000269|PubMed:19136951}. (Microbial infection) Isoform 3: May play a role in theassembly of hepatitis delta virus (HDV).{ECO:0000269|PubMed:15956556}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515166_188139468Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515210_305139468Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515327_364139468Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515386_408139468Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515430_486139468Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515508_540139468Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616210_305212541Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616327_364212541Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616386_408212541Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616430_486212541Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616508_540212541Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515145_165139468TransmembraneHelical%3B Name%3D4
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515189_209139468TransmembraneHelical%3B Name%3D5
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515306_326139468TransmembraneHelical%3B Name%3D6
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515365_385139468TransmembraneHelical%3B Name%3D7
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515409_429139468TransmembraneHelical%3B Name%3D8
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515487_507139468TransmembraneHelical%3B Name%3D9
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616306_326212541TransmembraneHelical%3B Name%3D6
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616365_385212541TransmembraneHelical%3B Name%3D7
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616409_429212541TransmembraneHelical%3B Name%3D8
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616487_507212541TransmembraneHelical%3B Name%3D9

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515122_144139468Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-5151_10139468Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-51532_50139468Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-51572_100139468Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616122_144212541Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616166_188212541Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-6161_10212541Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-61632_50212541Topological domainCytoplasmic
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-61672_100212541Topological domainExtracellular
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-515101_121139468TransmembraneHelical%3B Name%3D3
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-51511_31139468TransmembraneHelical%3B Name%3D1
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370570-51551_71139468TransmembraneHelical%3B Name%3D2
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616101_121212541TransmembraneHelical%3B Name%3D3
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-61611_31212541TransmembraneHelical%3B Name%3D1
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616145_165212541TransmembraneHelical%3B Name%3D4
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-616189_209212541TransmembraneHelical%3B Name%3D5
TgeneLMBRD1chr6:107595233chr6:70428973ENST00000370577-61651_71212541TransmembraneHelical%3B Name%3D2


Top

FusionGeneSequence for PDSS2_LMBRD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PDSS2_ENST00000369037_chr6_107595233_-_LMBRD1_ENST00000370577_chr6_70428973_-_539aa
MNFRQLLLHLPRTLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGT
QHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNTDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKATGMSALPLNLIKGTRSAATERLENTEDIEEVEQHIQTIKSKSKDGRPLPARDKRALKQF
EERLRTLKKRERHLEFIENSWWTKFCGALRPLKIVWGIFFILVALLFVISLFLSNLDKALHSAGIDSGFIIFGANLSNPLNMLLPLLQTV
FPLDTILITIIIMYFIFTSMAGIRNIGIWFFWIRLTKIRRGRTRPQALLFLCMILLLIVLHTSYMITSLAPQTVMTGSQNYLIETNITSD

>In-frame_PDSS2_ENST00000369037_chr6_107595233_-_LMBRD1_ENST00000370570_chr6_70428973_-_539aa
MNFRQLLLHLPRTLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGT
QHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNTDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKATGMSALPLNLIKGTRSAATERLENTEDIEEVEQHIQTIKSKSKDGRPLPARDKRALKQF
EERLRTLKKRERHLEFIENSWWTKFCGALRPLKIVWGIFFILVALLFVISLFLSNLDKALHSAGIDSGFIIFGANLSNPLNMLLPLLQTV
FPLDTILITIIIMYFIFTSMAGIRNIGIWFFWIRLTKIRRGRTRPQALLFLCMILLLIVLHTSYMITSLAPQTVMTGSQNYLIETNITSD

>In-frame_PDSS2_ENST00000453874_chr6_107595233_-_LMBRD1_ENST00000370577_chr6_70428973_-_539aa
MNFRQLLLHLPRTLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGT
QHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNTDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKATGMSALPLNLIKGTRSAATERLENTEDIEEVEQHIQTIKSKSKDGRPLPARDKRALKQF
EERLRTLKKRERHLEFIENSWWTKFCGALRPLKIVWGIFFILVALLFVISLFLSNLDKALHSAGIDSGFIIFGANLSNPLNMLLPLLQTV
FPLDTILITIIIMYFIFTSMAGIRNIGIWFFWIRLTKIRRGRTRPQALLFLCMILLLIVLHTSYMITSLAPQTVMTGSQNYLIETNITSD

>In-frame_PDSS2_ENST00000453874_chr6_107595233_-_LMBRD1_ENST00000370570_chr6_70428973_-_539aa
MNFRQLLLHLPRTLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGT
QHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNTDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKATGMSALPLNLIKGTRSAATERLENTEDIEEVEQHIQTIKSKSKDGRPLPARDKRALKQF
EERLRTLKKRERHLEFIENSWWTKFCGALRPLKIVWGIFFILVALLFVISLFLSNLDKALHSAGIDSGFIIFGANLSNPLNMLLPLLQTV
FPLDTILITIIIMYFIFTSMAGIRNIGIWFFWIRLTKIRRGRTRPQALLFLCMILLLIVLHTSYMITSLAPQTVMTGSQNYLIETNITSD

>In-frame_PDSS2_ENST00000369031_chr6_107595233_-_LMBRD1_ENST00000370577_chr6_70428973_-_539aa
MNFRQLLLHLPRTLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGT
QHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNTDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKATGMSALPLNLIKGTRSAATERLENTEDIEEVEQHIQTIKSKSKDGRPLPARDKRALKQF
EERLRTLKKRERHLEFIENSWWTKFCGALRPLKIVWGIFFILVALLFVISLFLSNLDKALHSAGIDSGFIIFGANLSNPLNMLLPLLQTV
FPLDTILITIIIMYFIFTSMAGIRNIGIWFFWIRLTKIRRGRTRPQALLFLCMILLLIVLHTSYMITSLAPQTVMTGSQNYLIETNITSD

>In-frame_PDSS2_ENST00000369031_chr6_107595233_-_LMBRD1_ENST00000370570_chr6_70428973_-_539aa
MNFRQLLLHLPRTLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGT
QHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNTDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKATGMSALPLNLIKGTRSAATERLENTEDIEEVEQHIQTIKSKSKDGRPLPARDKRALKQF
EERLRTLKKRERHLEFIENSWWTKFCGALRPLKIVWGIFFILVALLFVISLFLSNLDKALHSAGIDSGFIIFGANLSNPLNMLLPLLQTV
FPLDTILITIIIMYFIFTSMAGIRNIGIWFFWIRLTKIRRGRTRPQALLFLCMILLLIVLHTSYMITSLAPQTVMTGSQNYLIETNITSD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PDSS2_ENST00000369037_chr6_107595233_-_LMBRD1_ENST00000370577_chr6_70428973_-_1617nt
ATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGTCCCTCGAC
ACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGAAGATCGTG
GGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGGTGGGCACT
CAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCCTTATCTCT
AAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTTTGGCAGAG
ATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGAC
ATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAG
GCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAGACATTGAA
GAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAAAACAATTT
GAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCGCTCTGCGT
CCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATAAAGCTCTT
CATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTACAAACAGTT
TTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCATATGGTTC
TTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTATTGTCCTT
CACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAACTTCTGAT
AATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGACATACCTA
TTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAATTGTATCC

>In-frame_PDSS2_ENST00000369037_chr6_107595233_-_LMBRD1_ENST00000370570_chr6_70428973_-_1617nt
ATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGTCCCTCGAC
ACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGAAGATCGTG
GGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGGTGGGCACT
CAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCCTTATCTCT
AAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTTTGGCAGAG
ATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGAC
ATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAG
GCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAGACATTGAA
GAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAAAACAATTT
GAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCGCTCTGCGT
CCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATAAAGCTCTT
CATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTACAAACAGTT
TTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCATATGGTTC
TTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTATTGTCCTT
CACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAACTTCTGAT
AATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGACATACCTA
TTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAATTGTATCC

>In-frame_PDSS2_ENST00000453874_chr6_107595233_-_LMBRD1_ENST00000370577_chr6_70428973_-_1617nt
ATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGTCCCTCGAC
ACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGAAGATCGTG
GGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGGTGGGCACT
CAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCCTTATCTCT
AAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTTTGGCAGAG
ATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGAC
ATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAG
GCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAGACATTGAA
GAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAAAACAATTT
GAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCGCTCTGCGT
CCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATAAAGCTCTT
CATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTACAAACAGTT
TTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCATATGGTTC
TTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTATTGTCCTT
CACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAACTTCTGAT
AATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGACATACCTA
TTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAATTGTATCC

>In-frame_PDSS2_ENST00000453874_chr6_107595233_-_LMBRD1_ENST00000370570_chr6_70428973_-_1617nt
ATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGTCCCTCGAC
ACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGAAGATCGTG
GGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGGTGGGCACT
CAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCCTTATCTCT
AAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTTTGGCAGAG
ATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGAC
ATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAG
GCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAGACATTGAA
GAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAAAACAATTT
GAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCGCTCTGCGT
CCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATAAAGCTCTT
CATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTACAAACAGTT
TTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCATATGGTTC
TTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTATTGTCCTT
CACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAACTTCTGAT
AATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGACATACCTA
TTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAATTGTATCC

>In-frame_PDSS2_ENST00000369031_chr6_107595233_-_LMBRD1_ENST00000370577_chr6_70428973_-_1617nt
ATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGTCCCTCGAC
ACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGAAGATCGTG
GGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGGTGGGCACT
CAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCCTTATCTCT
AAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTTTGGCAGAG
ATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGAC
ATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAG
GCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAGACATTGAA
GAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAAAACAATTT
GAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCGCTCTGCGT
CCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATAAAGCTCTT
CATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTACAAACAGTT
TTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCATATGGTTC
TTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTATTGTCCTT
CACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAACTTCTGAT
AATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGACATACCTA
TTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAATTGTATCC

>In-frame_PDSS2_ENST00000369031_chr6_107595233_-_LMBRD1_ENST00000370570_chr6_70428973_-_1617nt
ATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGTCCCTCGAC
ACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGAAGATCGTG
GGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGGTGGGCACT
CAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCCTTATCTCT
AAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTTTGGCAGAG
ATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGAC
ATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAG
GCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAGACATTGAA
GAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAAAACAATTT
GAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCGCTCTGCGT
CCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATAAAGCTCTT
CATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTACAAACAGTT
TTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCATATGGTTC
TTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTATTGTCCTT
CACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAACTTCTGAT
AATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGACATACCTA
TTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAATTGTATCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PDSS2_ENST00000369037_chr6_107595233_-_LMBRD1_ENST00000370577_chr6_70428973_-_2251nt
TGCCTCCAATATGGCGTCCTCCACATAGGCAGTGGCTGTGGTTTCTACCCCGGGTGGCCGGGGGCAGTGCTGAGCTGGGACTGTTGTTTG
CCCAGCCTGGGCTGCAGAAAGCAGCAGTTAAAGTTCGTTTCTGGTCACTGCTCCAGGAAGCCACCTTACTCTGAGGGTCAAGAATTGCCG
CTTCCTTTTAGTTACTGTAAGTTCCTCCTCTGCCCCTGGTTTGTTTCCCGCGGCACTTCTGGATACCCCCAGGTCCCAGACCCTTCCAGA
CTCAAACCATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGT
CCCTCGACACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGA
AGATCGTGGGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGG
TGGGCACTCAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCC
TTATCTCTAAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTT
TGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCAC
TGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGA
ACACCAAGGCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAG
ACATTGAAGAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAA
AACAATTTGAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCG
CTCTGCGTCCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATA
AAGCTCTTCATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTAC
AAACAGTTTTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCA
TATGGTTCTTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTA
TTGTCCTTCACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAA
CTTCTGATAATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGA
CATACCTATTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAA
TTGTATCCTGTTGTAAAGGGAAGAAATCGGTTATTGAAGGAGTAGATGAAGATTCAGACATAAGTGATGATGAGCCCTCTGTCTATTCTG
CTTGACAGCCTTCTGTCTTAAAGGTTTTATAATGCTGACTGAATATCTGTTATGCATTTTTAAAGTATTAAACTAACATTAGGATTTGCT
AACTAGCTTTCATCAAAAATGGGAGCATGGCTATAAGACAACTATATTTTATTATATGTTTTCTGAAGTAACATTGTATCATAGATTAAC
ATTTTAAATTACCATAATCATGCTATGTAAATATAAGACTACTGGCTTTGTGAGGGAATGTTTGTGCAAAATTTTTTCCTCTAATGTATA
ATAGTGTTAAATTGATTAAAAATCTTCCAGAATTAATATTCCCTTTTGTCACTTTTTGAAAACATAATAAATCATCTGTATCTGTGCCTT

>In-frame_PDSS2_ENST00000369037_chr6_107595233_-_LMBRD1_ENST00000370570_chr6_70428973_-_2247nt
TGCCTCCAATATGGCGTCCTCCACATAGGCAGTGGCTGTGGTTTCTACCCCGGGTGGCCGGGGGCAGTGCTGAGCTGGGACTGTTGTTTG
CCCAGCCTGGGCTGCAGAAAGCAGCAGTTAAAGTTCGTTTCTGGTCACTGCTCCAGGAAGCCACCTTACTCTGAGGGTCAAGAATTGCCG
CTTCCTTTTAGTTACTGTAAGTTCCTCCTCTGCCCCTGGTTTGTTTCCCGCGGCACTTCTGGATACCCCCAGGTCCCAGACCCTTCCAGA
CTCAAACCATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGT
CCCTCGACACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGA
AGATCGTGGGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGG
TGGGCACTCAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCC
TTATCTCTAAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTT
TGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCAC
TGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGA
ACACCAAGGCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAG
ACATTGAAGAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAA
AACAATTTGAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCG
CTCTGCGTCCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATA
AAGCTCTTCATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTAC
AAACAGTTTTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCA
TATGGTTCTTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTA
TTGTCCTTCACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAA
CTTCTGATAATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGA
CATACCTATTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAA
TTGTATCCTGTTGTAAAGGGAAGAAATCGGTTATTGAAGGAGTAGATGAAGATTCAGACATAAGTGATGATGAGCCCTCTGTCTATTCTG
CTTGACAGCCTTCTGTCTTAAAGGTTTTATAATGCTGACTGAATATCTGTTATGCATTTTTAAAGTATTAAACTAACATTAGGATTTGCT
AACTAGCTTTCATCAAAAATGGGAGCATGGCTATAAGACAACTATATTTTATTATATGTTTTCTGAAGTAACATTGTATCATAGATTAAC
ATTTTAAATTACCATAATCATGCTATGTAAATATAAGACTACTGGCTTTGTGAGGGAATGTTTGTGCAAAATTTTTTCCTCTAATGTATA

>In-frame_PDSS2_ENST00000453874_chr6_107595233_-_LMBRD1_ENST00000370577_chr6_70428973_-_2244nt
AATATGGCGTCCTCCACATAGGCAGTGGCTGTGGTTTCTACCCCGGGTGGCCGGGGGCAGTGCTGAGCTGGGACTGTTGTTTGCCCAGCC
TGGGCTGCAGAAAGCAGCAGTTAAAGTTCGTTTCTGGTCACTGCTCCAGGAAGCCACCTTACTCTGAGGGTCAAGAATTGCCGCTTCCTT
TTAGTTACTGTAAGTTCCTCCTCTGCCCCTGGTTTGTTTCCCGCGGCACTTCTGGATACCCCCAGGTCCCAGACCCTTCCAGACTCAAAC
CATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGTCCCTCGA
CACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGAAGATCGT
GGGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGGTGGGCAC
TCAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCCTTATCTC
TAAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTTTGGCAGA
GATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGA
CATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAA
GGCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAGACATTGA
AGAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAAAACAATT
TGAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCGCTCTGCG
TCCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATAAAGCTCT
TCATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTACAAACAGT
TTTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCATATGGTT
CTTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTATTGTCCT
TCACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAACTTCTGA
TAATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGACATACCT
ATTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAATTGTATC
CTGTTGTAAAGGGAAGAAATCGGTTATTGAAGGAGTAGATGAAGATTCAGACATAAGTGATGATGAGCCCTCTGTCTATTCTGCTTGACA
GCCTTCTGTCTTAAAGGTTTTATAATGCTGACTGAATATCTGTTATGCATTTTTAAAGTATTAAACTAACATTAGGATTTGCTAACTAGC
TTTCATCAAAAATGGGAGCATGGCTATAAGACAACTATATTTTATTATATGTTTTCTGAAGTAACATTGTATCATAGATTAACATTTTAA
ATTACCATAATCATGCTATGTAAATATAAGACTACTGGCTTTGTGAGGGAATGTTTGTGCAAAATTTTTTCCTCTAATGTATAATAGTGT

>In-frame_PDSS2_ENST00000453874_chr6_107595233_-_LMBRD1_ENST00000370570_chr6_70428973_-_2240nt
AATATGGCGTCCTCCACATAGGCAGTGGCTGTGGTTTCTACCCCGGGTGGCCGGGGGCAGTGCTGAGCTGGGACTGTTGTTTGCCCAGCC
TGGGCTGCAGAAAGCAGCAGTTAAAGTTCGTTTCTGGTCACTGCTCCAGGAAGCCACCTTACTCTGAGGGTCAAGAATTGCCGCTTCCTT
TTAGTTACTGTAAGTTCCTCCTCTGCCCCTGGTTTGTTTCCCGCGGCACTTCTGGATACCCCCAGGTCCCAGACCCTTCCAGACTCAAAC
CATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCGTCCCTCGA
CACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAGAAGATCGT
GGGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTGGTGGGCAC
TCAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTCCTTATCTC
TAAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGTTTGGCAGA
GATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGA
CATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAA
GGCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAAGACATTGA
AGAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTAAAACAATT
TGAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGCGCTCTGCG
TCCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGATAAAGCTCT
TCATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTACAAACAGT
TTTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGCATATGGTT
CTTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTTATTGTCCT
TCACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATAACTTCTGA
TAATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGGACATACCT
ATTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTAATTGTATC
CTGTTGTAAAGGGAAGAAATCGGTTATTGAAGGAGTAGATGAAGATTCAGACATAAGTGATGATGAGCCCTCTGTCTATTCTGCTTGACA
GCCTTCTGTCTTAAAGGTTTTATAATGCTGACTGAATATCTGTTATGCATTTTTAAAGTATTAAACTAACATTAGGATTTGCTAACTAGC
TTTCATCAAAAATGGGAGCATGGCTATAAGACAACTATATTTTATTATATGTTTTCTGAAGTAACATTGTATCATAGATTAACATTTTAA
ATTACCATAATCATGCTATGTAAATATAAGACTACTGGCTTTGTGAGGGAATGTTTGTGCAAAATTTTTTCCTCTAATGTATAATAGTGT

>In-frame_PDSS2_ENST00000369031_chr6_107595233_-_LMBRD1_ENST00000370577_chr6_70428973_-_2252nt
ATGCCTCCAATATGGCGTCCTCCACATAGGCAGTGGCTGTGGTTTCTACCCCGGGTGGCCGGGGGCAGTGCTGAGCTGGGACTGTTGTTT
GCCCAGCCTGGGCTGCAGAAAGCAGCAGTTAAAGTTCGTTTCTGGTCACTGCTCCAGGAAGCCACCTTACTCTGAGGGTCAAGAATTGCC
GCTTCCTTTTAGTTACTGTAAGTTCCTCCTCTGCCCCTGGTTTGTTTCCCGCGGCACTTCTGGATACCCCCAGGTCCCAGACCCTTCCAG
ACTCAAACCATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCG
TCCCTCGACACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAG
AAGATCGTGGGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTG
GTGGGCACTCAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTC
CTTATCTCTAAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGT
TTGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCA
CTGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAG
AACACCAAGGCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAA
GACATTGAAGAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTA
AAACAATTTGAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGC
GCTCTGCGTCCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGAT
AAAGCTCTTCATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTA
CAAACAGTTTTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGC
ATATGGTTCTTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTT
ATTGTCCTTCACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATA
ACTTCTGATAATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGG
ACATACCTATTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTA
ATTGTATCCTGTTGTAAAGGGAAGAAATCGGTTATTGAAGGAGTAGATGAAGATTCAGACATAAGTGATGATGAGCCCTCTGTCTATTCT
GCTTGACAGCCTTCTGTCTTAAAGGTTTTATAATGCTGACTGAATATCTGTTATGCATTTTTAAAGTATTAAACTAACATTAGGATTTGC
TAACTAGCTTTCATCAAAAATGGGAGCATGGCTATAAGACAACTATATTTTATTATATGTTTTCTGAAGTAACATTGTATCATAGATTAA
CATTTTAAATTACCATAATCATGCTATGTAAATATAAGACTACTGGCTTTGTGAGGGAATGTTTGTGCAAAATTTTTTCCTCTAATGTAT
AATAGTGTTAAATTGATTAAAAATCTTCCAGAATTAATATTCCCTTTTGTCACTTTTTGAAAACATAATAAATCATCTGTATCTGTGCCT

>In-frame_PDSS2_ENST00000369031_chr6_107595233_-_LMBRD1_ENST00000370570_chr6_70428973_-_2248nt
ATGCCTCCAATATGGCGTCCTCCACATAGGCAGTGGCTGTGGTTTCTACCCCGGGTGGCCGGGGGCAGTGCTGAGCTGGGACTGTTGTTT
GCCCAGCCTGGGCTGCAGAAAGCAGCAGTTAAAGTTCGTTTCTGGTCACTGCTCCAGGAAGCCACCTTACTCTGAGGGTCAAGAATTGCC
GCTTCCTTTTAGTTACTGTAAGTTCCTCCTCTGCCCCTGGTTTGTTTCCCGCGGCACTTCTGGATACCCCCAGGTCCCAGACCCTTCCAG
ACTCAAACCATGAACTTTCGGCAGCTGCTGTTGCACTTGCCACGTTATCTTGGAGCCTCGGGTTCCCCGCGTCGCCTGTGGTGGTCCCCG
TCCCTCGACACCATCTCCTCGGTGGGCTCTTGGCGTGGTCGGTCCTCCAAGTCCCCGGCCCACTGGAATCAGGTAGTGTCAGAGGCGGAG
AAGATCGTGGGGTACCCCACGTCCTTCATGAGCCTTCGCTGCCTGCTGAGCGACGAGCTCAGCAACATCGCTATGCAGGTGCGGAAGCTG
GTGGGCACTCAGCACCCTCTGCTTACCACAGCCAGGGGGCTTGTACATGACAGCTGGAATAGCCTCCAGTTGAGGGGCTTGGTGGTGCTC
CTTATCTCTAAAGCAGCTGGGCCCAGCAGCGTGAACACTTCATGTCAGAACTATGACATGGTCAGTGGGATCTACTCATGTCAAAGAAGT
TTGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCA
CTGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAG
AACACCAAGGCCTATGGCATGTCTGCGTTACCTTTAAATCTGATAAAAGGCACTAGAAGCGCTGCTTATGAACGTTTGGAAAACACTGAA
GACATTGAAGAAGTAGAACAACACATTCAAACGATTAAATCAAAAAGCAAAGATGGTCGACCTTTGCCAGCAAGGGATAAACGCGCCTTA
AAACAATTTGAAGAAAGGTTACGAACACTTAAGAAGAGAGAGAGGCATTTAGAATTCATTGAAAACAGCTGGTGGACAAAATTTTGTGGC
GCTCTGCGTCCCCTGAAGATCGTCTGGGGAATATTTTTCATCTTAGTTGCATTGCTGTTTGTAATTTCTCTCTTCTTGTCAAATTTAGAT
AAAGCTCTTCATTCAGCTGGAATAGATTCTGGTTTCATAATTTTTGGAGCTAACCTGAGTAATCCACTGAATATGCTTTTGCCTTTACTA
CAAACAGTTTTCCCTCTTGATTATATTCTTATAACAATTATTATTATGTACTTTATTTTTACTTCAATGGCAGGAATTCGAAATATTGGC
ATATGGTTCTTTTGGATTAGATTATATAAAATCAGAAGAGGTAGAACCAGGCCCCAAGCACTCCTTTTTCTCTGCATGATACTTCTGCTT
ATTGTCCTTCACACTAGCTACATGATTTATAGTCTTGCTCCCCAATATGTTATGTATGGAAGCCAAAATTACTTAATAGAGACTAATATA
ACTTCTGATAATCATAAAGGCAATTCAACCCTTTCTGTGCCAAAGAGATGTGATGCAGATGCTCCTGAAGATCAGTGTACTGTTACCCGG
ACATACCTATTCCTTCACAAGTTCTGGTTCTTCAGTGCTGCTTACTATTTTGGTAACTGGGCCTTTCTTGGGGTATTTTTGATTGGATTA
ATTGTATCCTGTTGTAAAGGGAAGAAATCGGTTATTGAAGGAGTAGATGAAGATTCAGACATAAGTGATGATGAGCCCTCTGTCTATTCT
GCTTGACAGCCTTCTGTCTTAAAGGTTTTATAATGCTGACTGAATATCTGTTATGCATTTTTAAAGTATTAAACTAACATTAGGATTTGC
TAACTAGCTTTCATCAAAAATGGGAGCATGGCTATAAGACAACTATATTTTATTATATGTTTTCTGAAGTAACATTGTATCATAGATTAA
CATTTTAAATTACCATAATCATGCTATGTAAATATAAGACTACTGGCTTTGTGAGGGAATGTTTGTGCAAAATTTTTTCCTCTAATGTAT


Top

FusionGenePPI for PDSS2_LMBRD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PDSS2ELAVL1, APP, OXLD1, ACAD9, SDHA, THEM4, FDPSLMBRD1HNRNPC, CSGALNACT2, MBOAT7


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PDSS2_LMBRD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PDSS2_LMBRD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePDSS2C3553358COENZYME Q10 DEFICIENCY, PRIMARY, 31UNIPROT