FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26464

FusionGeneSummary for PDGFRA_USP8

check button Fusion gene summary
Fusion gene informationFusion gene name: PDGFRA_USP8
Fusion gene ID: 26464
HgeneTgene
Gene symbol

PDGFRA

USP8

Gene ID

5156

9101

Gene nameplatelet derived growth factor receptor alphaubiquitin specific peptidase 8
SynonymsCD140A|PDGFR-2|PDGFR2HumORF8|PITA4|SPG59|UBPY
Cytomap

4q12

15q21.2

Type of geneprotein-codingprotein-coding
Descriptionplatelet-derived growth factor receptor alphaCD140 antigen-like family member ACD140a antigenPDGF-R-alphaalpha-type platelet-derived growth factor receptorplatelet-derived growth factor receptor 2platelet-derived growth factor receptor, alpha polypeubiquitin carboxyl-terminal hydrolase 8deubiquitinating enzyme 8ubiquitin isopeptidase Yubiquitin thiolesterase 8ubiquitin-specific-processing protease 8
Modification date2018052320180527
UniProtAcc

P16234

P40818

Ensembl transtripts involved in fusion geneENST00000257290, ENST00000508170, 
ENST00000307179, ENST00000433963, 
ENST00000396444, ENST00000425032, 
ENST00000558892, 
Fusion gene scores* DoF score8 X 7 X 5=2802 X 2 X 2=8
# samples 103
** MAII scorelog2(10/280*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/8*10)=1.90689059560852
Context

PubMed: PDGFRA [Title/Abstract] AND USP8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePDGFRA

GO:0008284

positive regulation of cell proliferation

10806482

HgenePDGFRA

GO:0010544

negative regulation of platelet activation

8188664

HgenePDGFRA

GO:0018108

peptidyl-tyrosine phosphorylation

1646396|2536956|8188664

HgenePDGFRA

GO:0030335

positive regulation of cell migration

17470632

HgenePDGFRA

GO:0034614

cellular response to reactive oxygen species

24190966

HgenePDGFRA

GO:0038091

positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway

17470632

HgenePDGFRA

GO:0046777

protein autophosphorylation

1646396|2536956|8188664

HgenePDGFRA

GO:0048008

platelet-derived growth factor receptor signaling pathway

2536956|10806482

HgenePDGFRA

GO:0048146

positive regulation of fibroblast proliferation

10806482

TgeneUSP8

GO:0070536

protein K63-linked deubiquitination

16520378

TgeneUSP8

GO:0071108

protein K48-linked deubiquitination

16520378


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-Z4-AAPG-01APDGFRAchr4

55156721

+USP8chr15

50751197

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000257290ENST00000307179PDGFRAchr4

55156721

+USP8chr15

50751197

+
In-frameENST00000257290ENST00000433963PDGFRAchr4

55156721

+USP8chr15

50751197

+
In-frameENST00000257290ENST00000396444PDGFRAchr4

55156721

+USP8chr15

50751197

+
In-frameENST00000257290ENST00000425032PDGFRAchr4

55156721

+USP8chr15

50751197

+
5CDS-intronENST00000257290ENST00000558892PDGFRAchr4

55156721

+USP8chr15

50751197

+
intron-3CDSENST00000508170ENST00000307179PDGFRAchr4

55156721

+USP8chr15

50751197

+
intron-3CDSENST00000508170ENST00000433963PDGFRAchr4

55156721

+USP8chr15

50751197

+
intron-3CDSENST00000508170ENST00000396444PDGFRAchr4

55156721

+USP8chr15

50751197

+
intron-3CDSENST00000508170ENST00000425032PDGFRAchr4

55156721

+USP8chr15

50751197

+
intron-intronENST00000508170ENST00000558892PDGFRAchr4

55156721

+USP8chr15

50751197

+

Top

FusionProtFeatures for PDGFRA_USP8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PDGFRA

P16234

USP8

P40818

Tyrosine-protein kinase that acts as a cell-surfacereceptor for PDGFA, PDGFB and PDGFC and plays an essential role inthe regulation of embryonic development, cell proliferation,survival and chemotaxis. Depending on the context, promotes orinhibits cell proliferation and cell migration. Plays an importantrole in the differentiation of bone marrow-derived mesenchymalstem cells. Required for normal skeleton development and cephalicclosure during embryonic development. Required for normaldevelopment of the mucosa lining the gastrointestinal tract, andfor recruitment of mesenchymal cells and normal development ofintestinal villi. Plays a role in cell migration and chemotaxis inwound healing. Plays a role in platelet activation, secretion ofagonists from platelet granules, and in thrombin-induced plateletaggregation. Binding of its cognate ligands - homodimeric PDGFA,homodimeric PDGFB, heterodimers formed by PDGFA and PDGFB orhomodimeric PDGFC -leads to the activation of several signalingcascades; the response depends on the nature of the bound ligandand is modulated by the formation of heterodimers between PDGFRAand PDGFRB. Phosphorylates PIK3R1, PLCG1, and PTPN11. Activationof PLCG1 leads to the production of the cellular signalingmolecules diacylglycerol and inositol 1,4,5-trisphosphate,mobilization of cytosolic Ca(2+) and the activation of proteinkinase C. Phosphorylates PIK3R1, the regulatory subunit ofphosphatidylinositol 3-kinase, and thereby mediates activation ofthe AKT1 signaling pathway. Mediates activation of HRAS and of theMAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation ofSTAT family members STAT1, STAT3 and STAT5A and/or STAT5B.Receptor signaling is down-regulated by protein phosphatases thatdephosphorylate the receptor and its down-stream effectors, and byrapid internalization of the activated receptor.{ECO:0000269|PubMed:10734113, ECO:0000269|PubMed:10947961,ECO:0000269|PubMed:11297552, ECO:0000269|PubMed:12522257,ECO:0000269|PubMed:1646396, ECO:0000269|PubMed:1709159,ECO:0000269|PubMed:17141222, ECO:0000269|PubMed:20972453,ECO:0000269|PubMed:21224473, ECO:0000269|PubMed:21596750,ECO:0000269|PubMed:2554309, ECO:0000269|PubMed:8188664,ECO:0000269|PubMed:8760137, ECO:0000269|PubMed:8943348}. Hydrolase that can remove conjugated ubiquitin fromproteins and therefore plays an important regulatory role at thelevel of protein turnover by preventing degradation. Converts both'Lys-48' an 'Lys-63'-linked ubiquitin chains. Catalytic activityis enhanced in the M phase. Involved in cell proliferation.Required to enter into S phase in response to serum stimulation.May regulate T-cell anergy mediated by RNF128 via the formation ofa complex containing RNF128 and OTUB1. Probably regulates thestability of STAM2 and RASGRF1. Regulates endosomal ubiquitindynamics, cargo sorting, membrane traffic at early endosomes, andmaintenance of ESCRT-0 stability. The level of proteinubiquitination on endosomes is essential for maintaining themorphology of the organelle. Deubiquitinates EPS15 and controlestyrosine kinase stability. Removes conjugated ubiquitin from EGFRthus regulating EGFR degradation and downstream MAPK signaling.Involved in acrosome biogenesis through interaction with thespermatid ESCRT-0 complex and microtubules. DeubiquitinatesBIRC6/bruce and KIF23/MKLP1. {ECO:0000269|PubMed:16520378,ECO:0000269|PubMed:17711858, ECO:0000269|PubMed:18329369,ECO:0000269|PubMed:9628861}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+2223117_20110401090DomainNote=Ig-like C2-type 2
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+2223202_30610401090DomainNote=Ig-like C2-type 3
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+222324_11310401090DomainNote=Ig-like C2-type 1
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+2223319_41010401090DomainNote=Ig-like C2-type 4
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+2223414_51710401090DomainNote=Ig-like C2-type 5
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+2223593_95410401090DomainProtein kinase
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+2223599_60710401090Nucleotide bindingATP
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+222324_52810401090Topological domainExtracellular
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+2223529_54910401090TransmembraneHelical
TgeneUSP8chr4:55156721chr15:50751197ENST00000307179+320195_3131111119DomainRhodanese
TgeneUSP8chr4:55156721chr15:50751197ENST00000307179+320777_11091111119DomainNote=USP
TgeneUSP8chr4:55156721chr15:50751197ENST00000396444+320195_3131111119DomainRhodanese
TgeneUSP8chr4:55156721chr15:50751197ENST00000396444+320777_11091111119DomainNote=USP
TgeneUSP8chr4:55156721chr15:50751197ENST00000433963+421195_3131111119DomainRhodanese
TgeneUSP8chr4:55156721chr15:50751197ENST00000433963+421777_11091111119DomainNote=USP
TgeneUSP8chr4:55156721chr15:50751197ENST00000307179+320405_4131111119MotifSH3-binding
TgeneUSP8chr4:55156721chr15:50751197ENST00000396444+320405_4131111119MotifSH3-binding
TgeneUSP8chr4:55156721chr15:50751197ENST00000433963+421405_4131111119MotifSH3-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+22231041_108710401090Compositional biasNote=Ser-rich
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+141041_1087-50219Compositional biasNote=Ser-rich
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+14117_201-50219DomainNote=Ig-like C2-type 2
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+14202_306-50219DomainNote=Ig-like C2-type 3
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+1424_113-50219DomainNote=Ig-like C2-type 1
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+14319_410-50219DomainNote=Ig-like C2-type 4
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+14414_517-50219DomainNote=Ig-like C2-type 5
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+14593_954-50219DomainProtein kinase
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+14599_607-50219Nucleotide bindingATP
HgenePDGFRAchr4:55156721chr15:50751197ENST00000257290+2223550_108910401090Topological domainCytoplasmic
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+1424_528-50219Topological domainExtracellular
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+14550_1089-50219Topological domainCytoplasmic
HgenePDGFRAchr4:55156721chr15:50751197ENST00000508170+14529_549-50219TransmembraneHelical
TgeneUSP8chr4:55156721chr15:50751197ENST00000307179+32033_1161111119DomainNote=MIT
TgeneUSP8chr4:55156721chr15:50751197ENST00000396444+32033_1161111119DomainNote=MIT
TgeneUSP8chr4:55156721chr15:50751197ENST00000433963+42133_1161111119DomainNote=MIT


Top

FusionGeneSequence for PDGFRA_USP8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000307179_chr15_50751197_+_2048aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSA
SAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIK
LVYTLTVPEATVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMIC
KDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLK
PTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLA
SKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIG
VTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAK
GSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPD
DSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSIS
LDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEEH
RIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEKELRERQQEEQKEKLRKEEQEQKAKKKQEAEE
NEITEKQQKAKEEMEKKESEQAKKEDKETSAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGK
PFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPS
TPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRN
LGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQE
LLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSK
CTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKY

>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000433963_chr15_50751197_+_2048aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSA
SAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIK
LVYTLTVPEATVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMIC
KDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLK
PTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLA
SKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIG
VTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAK
GSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPD
DSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSIS
LDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEEH
RIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEKELRERQQEEQKEKLRKEEQEQKAKKKQEAEE
NEITEKQQKAKEEMEKKESEQAKKEDKETSAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGK
PFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPS
TPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRN
LGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQE
LLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSK
CTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKY

>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000396444_chr15_50751197_+_2048aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSA
SAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIK
LVYTLTVPEATVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMIC
KDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLK
PTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLA
SKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIG
VTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAK
GSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPD
DSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSIS
LDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEEH
RIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEKELRERQQEEQKEKLRKEEQEQKAKKKQEAEE
NEITEKQQKAKEEMEKKESEQAKKEDKETSAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGK
PFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPS
TPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRN
LGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQE
LLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSK
CTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKY

>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000425032_chr15_50751197_+_2019aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSA
SAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIK
LVYTLTVPEATVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMIC
KDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLK
PTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLA
SKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIG
VTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAK
GSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPD
DSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSIS
LDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEEH
RIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEKELRERQQEEQKEKLRKEEQEQKAKKKQEAEE
NEITEKQQKAKEEMEKKESEQAKKEDKETSAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGK
AQREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSP
DITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCY
QDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDH
LDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRA
RRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000307179_chr15_50751197_+_6144nt
ATGGGGACTTCCCATCCGGCGTTCCTGGTCTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATC
CTTCCAAATGAAAATGAAAAGGTTGTGCAGCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCC
ATGTCTGAAGAAGAGAGCTCCGATGTGGAAATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCC
TCGGCGGCCCACACAGGGTTGTACACTTGCTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTAT
GTGCCAGACCCAGATGTAGCCTTTGTACCTCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGT
CGCACAACTGATCCCGAGACTCCTGTAACCTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGG
ACCTTCACTGTAGGGCCCTATATCTGTGAGGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGCA
ACATCAGAGCTGGATCTAGAAATGGAAGCTCTTAAAACCGTGTATAAGTCAGGGGAAACGATTGTGGTCACCTGTGCTGTTTTTAACAAT
GAGGTGGTTGACCTTCAATGGACTTACCCTGGAGAAGTGAAAGGCAAAGGCATCACAATGCTGGAAGAAATCAAAGTCCCATCCATCAAA
TTGGTGTACACTTTGACGGTCCCCGAGGCCACGGTGAAAGACAGTGGAGATTACGAATGTGCTGCCCGCCAGGCTACCAGGGAGGTCAAA
GAAATGAAGAAAGTCACTATTTCTGTCCATGAGAAAGGTTTCATTGAAATCAAACCCACCTTCAGCCAGTTGGAAGCTGTCAACCTGCAT
GAAGTCAAACATTTTGTTGTAGAGGTGCGGGCCTACCCACCTCCCAGGATATCCTGGCTGAAAAACAATCTGACTCTGATTGAAAATCTC
ACTGAGATCACCACTGATGTGGAAAAGATTCAGGAAATAAGGTATCGAAGCAAATTAAAGCTGATCCGTGCTAAGGAAGAAGACAGTGGC
CATTATACTATTGTAGCTCAAAATGAAGATGCTGTGAAGAGCTATACTTTTGAACTGTTAACTCAAGTTCCTTCATCCATTCTGGACTTG
GTCGATGATCACCATGGCTCAACTGGGGGACAGACGGTGAGGTGCACAGCTGAAGGCACGCCGCTTCCTGATATTGAGTGGATGATATGC
AAAGATATTAAGAAATGTAATAATGAAACTTCCTGGACTATTTTGGCCAACAATGTCTCAAACATCATCACGGAGATCCACTCCCGAGAC
AGGAGTACCGTGGAGGGCCGTGTGACTTTCGCCAAAGTGGAGGAGACCATCGCCGTGCGATGCCTGGCTAAGAATCTCCTTGGAGCTGAG
AACCGAGAGCTGAAGCTGGTGGCTCCCACCCTGCGTTCTGAACTCACGGTGGCTGCTGCAGTCCTGGTGCTGTTGGTGATTGTGATCATC
TCACTTATTGTCCTGGTTGTCATTTGGAAACAGAAACCGAGGTATGAAATTCGCTGGAGGGTCATTGAATCAATCAGCCCAGATGGACAT
GAATATATTTATGTGGACCCGATGCAGCTGCCTTATGACTCAAGATGGGAGTTTCCAAGAGATGGACTAGTGCTTGGTCGGGTCTTGGGG
TCTGGAGCGTTTGGGAAGGTGGTTGAAGGAACAGCCTATGGATTAAGCCGGTCCCAACCTGTCATGAAAGTTGCAGTGAAGATGCTAAAA
CCCACGGCCAGATCCAGTGAAAAACAAGCTCTCATGTCTGAACTGAAGATAATGACTCACCTGGGGCCACATTTGAACATTGTAAACTTG
CTGGGAGCCTGCACCAAGTCAGGCCCCATTTACATCATCACAGAGTATTGCTTCTATGGAGATTTGGTCAACTATTTGCATAAGAATAGG
GATAGCTTCCTGAGCCACCACCCAGAGAAGCCAAAGAAAGAGCTGGATATCTTTGGATTGAACCCTGCTGATGAAAGCACACGGAGCTAT
GTTATTTTATCTTTTGAAAACAATGGTGACTACATGGACATGAAGCAGGCTGATACTACACAGTATGTCCCCATGCTAGAAAGGAAAGAG
GTTTCTAAATATTCCGACATCCAGAGATCACTCTATGATCGTCCAGCCTCATATAAGAAGAAATCTATGTTAGACTCAGAAGTCAAAAAC
CTCCTTTCAGATGATAACTCAGAAGGCCTTACTTTATTGGATTTGTTGAGCTTCACCTATCAAGTTGCCCGAGGAATGGAGTTTTTGGCT
TCAAAAAATTGTGTCCACCGTGATCTGGCTGCTCGCAACGTCCTCCTGGCACAAGGAAAAATTGTGAAGATCTGTGACTTTGGCCTGGCC
AGAGACATCATGCATGATTCGAACTATGTGTCGAAAGGCAGTACCTTTCTGCCCGTGAAGTGGATGGCTCCTGAGAGCATCTTTGACAAC
CTCTACACCACACTGAGTGATGTCTGGTCTTATGGCATTCTGCTCTGGGAGATCTTTTCCCTTGGTGGCACCCCTTACCCCGGCATGATG
GTGGATTCTACTTTCTACAATAAGATCAAGAGTGGGTACCGGATGGCCAAGCCTGACCACGCTACCAGTGAAGTCTACGAGATCATGGTG
AAATGCTGGAACAGTGAGCCGGAGAAGAGACCCTCCTTTTACCACCTGAGTGAGATTGTGGAGAATCTGCTGCCTGGACAATATAAAAAG
AGTTATGAAAAAATTCACCTGGACTTCCTGAAGAGTGACCATCCTGCTGTGGCACGCATGCGTGTGGACTCAGACAATGCATACATTGGT
GTCACCTACAAAAACGAGGAAGACAAGCTGAAGGACTGGGAGGGTGGTCTGGATGAGCAGAGACTGAGCGCTGACAGTGGCTACATCATT
CCTCTGCCTGACATTGACCCTGTCCCTGAGGAGGAGGACCTGGGCAAGAGGAACAGACACAGATATGAAGAAGCTGAAGTCCGGAAAAAA
CTTGAGGAAAAAGACAGGCAGGAGGAAGCACAGCGGCTACAACAAAAAAGGCAGGAAACAGGAAGAGAGGATGGTGGCACATTGGCTAAA
GGCTCTTTGGAGAATGTTTTGGATTCCAAAGACAAAACCCAAAAGAGCAATGGTGAAAAGAATGAAAAATGTGAGACCAAAGAGAAAGGA
GCAATCACAGCAAAGGAACTATACACAATGATGACGGATAAAAACATCAGCTTGATTATAATGGATGCTCGAAGAATGCAGGATTATCAG
GATTCCTGTATTTTACATTCTCTCAGTGTTCCTGAAGAAGCCATCAGTCCAGGAGTCACTGCTAGTTGGATTGAAGCACACCTGCCAGAT
GATTCTAAAGACACATGGAAGAAGAGGGGGAATGTGGAGTATGTGGTACTTCTTGACTGGTTTAGTTCTGCCAAAGATTTACAGATTGGA
ACAACTCTCCGGAGTCTGAAAGATGCACTTTTCAAGTGGGAAAGTAAAACTGTCCTGCGCAATGAGCCTTTGGTTTTAGAGGGAGGCTAT
GAAAACTGGCTCCTTTGTTATCCCCAGTATACAACAAATGCTAAGGTCACTCCACCCCCACGACGCCAGAATGAAGAGGTGTCTATCTCA
TTGGATTTTACTTATCCCTCATTGGAAGAATCAATTCCTTCTAAACCTGCTGCCCAGACGCCACCTGCATCTATAGAAGTAGATGAAAAT
ATAGAATTGATAAGTGGTCAAAATGAGAGAATGGGACCACTGAATATATCAACTCCAGTTGAACCAGTTGCTGCTTCTAAATCTGATGTT
TCACCCATAATTCAGCCAGTGCCTAGTATAAAGAATGTTCCACAGATTGATCGTACTAAAAAACCAGCAGTCAAATTGCCTGAAGAGCAT
AGAATAAAATCTGAAAGTACAAACCATGAGCAGCAATCTCCTCAGAGTGGAAAAGTTATTCCTGATCGTTCCACCAAGCCAGTAGTTTTT
TCTCCAACTCTCATGTTAACAGATGAAGAAAAGGCTCGTATTCATGCAGAAACTGCTCTTCTAATGGAAAAAAACAAACAAGAAAAAGAA
CTTCGGGAAAGGCAGCAAGAGGAACAGAAAGAGAAACTGAGGAAGGAAGAACAAGAACAAAAAGCCAAAAAGAAACAAGAAGCTGAAGAA
AATGAAATTACAGAGAAGCAACAAAAAGCAAAAGAAGAAATGGAGAAGAAAGAAAGTGAACAGGCCAAGAAAGAAGATAAAGAAACCTCA
GCAAAGAGGGGCAAAGAAATAACAGGAGTAAAAAGACAAAGTAAAAGTGAACATGAAACTTCTGATGCCAAGAAATCTGTAGAAGATAGG
GGGAAAAGGTGTCCAACCCCAGAAATACAGAAAAAGTCAACAGGAGATGTGCCCCATACATCTGTGACAGGGGATTCAGGTTCAGGCAAG
CCATTTAAGATTAAAGGACAACCAGAAAGTGGAATTCTAAGGACAGGAACTTTTAGAGAGGATACAGACGATACCGAAAGAAATAAAGCT
CAACGAGAACCTTTGACAAGAGCACGAAGTGAAGAAATGGGGAGGATCGTACCAGGACTGCCTTCAGGCTGGGCCAAGTTTCTTGACCCA
ATCACTGGAACCTTTCGTTATTATCATTCACCCACCAACACTGTTCATATGTACCCACCGGAAATGGCTCCTTCATCTGCACCTCCTTCC
ACCCCTCCAACTCATAAAGCCAAGCCACAGATTCCTGCTGAGCGGGATAGGGAACCTTCCAAACTGAAGCGCTCCTACTCCTCCCCAGAT
ATAACCCAGGCTATTCAAGAGGAAGAGAAGAGGAAGCCAACAGTAACTCCAACAGTTAATCGGGAAAACAAGCCAACATGTTATCCTAAA
GCTGAGATCTCAAGGCTTTCTGCTTCTCAGATTCGGAACCTCAATCCTGTTTTTGGAGGTTCTGGACCAGCTCTTACTGGACTTCGTAAC
TTAGGAAATACTTGTTATATGAACTCAATATTGCAGTGCCTATGTAACGCTCCACATTTGGCTGATTATTTCAACCGAAACTGTTATCAG
GATGATATTAACAGGTCAAATTTGTTGGGGCATAAAGGTGAAGTGGCAGAAGAATTTGGTATAATCATGAAAGCCCTGTGGACAGGACAG
TATAGATATATCAGTCCAAAGGACTTTAAAATCACCATTGGGAAGATCAATGACCAGTTTGCAGGATACAGTCAGCAAGATTCACAAGAA
TTGCTTCTGTTCCTAATGGATGGTCTCCATGAAGATCTAAATAAAGCTGATAATCGGAAGAGATATAAAGAAGAAAATAATGATCATCTC
GATGACTTTAAAGCTGCAGAACATGCCTGGCAGAAACACAAGCAGCTCAATGAGTCTATTATTGTTGCACTTTTTCAGGGTCAATTCAAA
TCTACAGTACAGTGCCTCACATGTCACAAAAAGTCTAGGACATTTGAGGCCTTCATGTATTTGTCTCTACCACTAGCATCCACAAGTAAA
TGTACATTACAGGATTGCCTTAGATTATTTTCCAAAGAAGAAAAACTCACAGATAACAACAGATTTTACTGCAGTCATTGCAGAGCTCGA
CGGGATTCTCTAAAAAAGATAGAAATCTGGAAGTTACCACCTGTGCTTTTAGTGCATCTGAAACGTTTTTCCTACGATGGCAGGTGGAAA
CAAAAATTACAGACATCTGTGGACTTCCCGTTAGAAAATCTTGACTTGTCACAGTATGTTATTGGTCCAAAGAACAATTTGAAGAAATAT
AATTTGTTTTCTGTTTCAAATCACTACGGTGGGCTGGATGGAGGCCACTACACAGCCTATTGTAAAAATGCAGCAAGACAACGGTGGTTT
AAGTTTGATGATCATGAAGTTTCTGATATCTCCGTTTCTTCTGTGAAATCTTCAGCAGCTTATATCCTCTTTTATACTTCATTGGGACCA

>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000433963_chr15_50751197_+_6144nt
ATGGGGACTTCCCATCCGGCGTTCCTGGTCTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATC
CTTCCAAATGAAAATGAAAAGGTTGTGCAGCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCC
ATGTCTGAAGAAGAGAGCTCCGATGTGGAAATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCC
TCGGCGGCCCACACAGGGTTGTACACTTGCTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTAT
GTGCCAGACCCAGATGTAGCCTTTGTACCTCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGT
CGCACAACTGATCCCGAGACTCCTGTAACCTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGG
ACCTTCACTGTAGGGCCCTATATCTGTGAGGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGCA
ACATCAGAGCTGGATCTAGAAATGGAAGCTCTTAAAACCGTGTATAAGTCAGGGGAAACGATTGTGGTCACCTGTGCTGTTTTTAACAAT
GAGGTGGTTGACCTTCAATGGACTTACCCTGGAGAAGTGAAAGGCAAAGGCATCACAATGCTGGAAGAAATCAAAGTCCCATCCATCAAA
TTGGTGTACACTTTGACGGTCCCCGAGGCCACGGTGAAAGACAGTGGAGATTACGAATGTGCTGCCCGCCAGGCTACCAGGGAGGTCAAA
GAAATGAAGAAAGTCACTATTTCTGTCCATGAGAAAGGTTTCATTGAAATCAAACCCACCTTCAGCCAGTTGGAAGCTGTCAACCTGCAT
GAAGTCAAACATTTTGTTGTAGAGGTGCGGGCCTACCCACCTCCCAGGATATCCTGGCTGAAAAACAATCTGACTCTGATTGAAAATCTC
ACTGAGATCACCACTGATGTGGAAAAGATTCAGGAAATAAGGTATCGAAGCAAATTAAAGCTGATCCGTGCTAAGGAAGAAGACAGTGGC
CATTATACTATTGTAGCTCAAAATGAAGATGCTGTGAAGAGCTATACTTTTGAACTGTTAACTCAAGTTCCTTCATCCATTCTGGACTTG
GTCGATGATCACCATGGCTCAACTGGGGGACAGACGGTGAGGTGCACAGCTGAAGGCACGCCGCTTCCTGATATTGAGTGGATGATATGC
AAAGATATTAAGAAATGTAATAATGAAACTTCCTGGACTATTTTGGCCAACAATGTCTCAAACATCATCACGGAGATCCACTCCCGAGAC
AGGAGTACCGTGGAGGGCCGTGTGACTTTCGCCAAAGTGGAGGAGACCATCGCCGTGCGATGCCTGGCTAAGAATCTCCTTGGAGCTGAG
AACCGAGAGCTGAAGCTGGTGGCTCCCACCCTGCGTTCTGAACTCACGGTGGCTGCTGCAGTCCTGGTGCTGTTGGTGATTGTGATCATC
TCACTTATTGTCCTGGTTGTCATTTGGAAACAGAAACCGAGGTATGAAATTCGCTGGAGGGTCATTGAATCAATCAGCCCAGATGGACAT
GAATATATTTATGTGGACCCGATGCAGCTGCCTTATGACTCAAGATGGGAGTTTCCAAGAGATGGACTAGTGCTTGGTCGGGTCTTGGGG
TCTGGAGCGTTTGGGAAGGTGGTTGAAGGAACAGCCTATGGATTAAGCCGGTCCCAACCTGTCATGAAAGTTGCAGTGAAGATGCTAAAA
CCCACGGCCAGATCCAGTGAAAAACAAGCTCTCATGTCTGAACTGAAGATAATGACTCACCTGGGGCCACATTTGAACATTGTAAACTTG
CTGGGAGCCTGCACCAAGTCAGGCCCCATTTACATCATCACAGAGTATTGCTTCTATGGAGATTTGGTCAACTATTTGCATAAGAATAGG
GATAGCTTCCTGAGCCACCACCCAGAGAAGCCAAAGAAAGAGCTGGATATCTTTGGATTGAACCCTGCTGATGAAAGCACACGGAGCTAT
GTTATTTTATCTTTTGAAAACAATGGTGACTACATGGACATGAAGCAGGCTGATACTACACAGTATGTCCCCATGCTAGAAAGGAAAGAG
GTTTCTAAATATTCCGACATCCAGAGATCACTCTATGATCGTCCAGCCTCATATAAGAAGAAATCTATGTTAGACTCAGAAGTCAAAAAC
CTCCTTTCAGATGATAACTCAGAAGGCCTTACTTTATTGGATTTGTTGAGCTTCACCTATCAAGTTGCCCGAGGAATGGAGTTTTTGGCT
TCAAAAAATTGTGTCCACCGTGATCTGGCTGCTCGCAACGTCCTCCTGGCACAAGGAAAAATTGTGAAGATCTGTGACTTTGGCCTGGCC
AGAGACATCATGCATGATTCGAACTATGTGTCGAAAGGCAGTACCTTTCTGCCCGTGAAGTGGATGGCTCCTGAGAGCATCTTTGACAAC
CTCTACACCACACTGAGTGATGTCTGGTCTTATGGCATTCTGCTCTGGGAGATCTTTTCCCTTGGTGGCACCCCTTACCCCGGCATGATG
GTGGATTCTACTTTCTACAATAAGATCAAGAGTGGGTACCGGATGGCCAAGCCTGACCACGCTACCAGTGAAGTCTACGAGATCATGGTG
AAATGCTGGAACAGTGAGCCGGAGAAGAGACCCTCCTTTTACCACCTGAGTGAGATTGTGGAGAATCTGCTGCCTGGACAATATAAAAAG
AGTTATGAAAAAATTCACCTGGACTTCCTGAAGAGTGACCATCCTGCTGTGGCACGCATGCGTGTGGACTCAGACAATGCATACATTGGT
GTCACCTACAAAAACGAGGAAGACAAGCTGAAGGACTGGGAGGGTGGTCTGGATGAGCAGAGACTGAGCGCTGACAGTGGCTACATCATT
CCTCTGCCTGACATTGACCCTGTCCCTGAGGAGGAGGACCTGGGCAAGAGGAACAGACACAGATATGAAGAAGCTGAAGTCCGGAAAAAA
CTTGAGGAAAAAGACAGGCAGGAGGAAGCACAGCGGCTACAACAAAAAAGGCAGGAAACAGGAAGAGAGGATGGTGGCACATTGGCTAAA
GGCTCTTTGGAGAATGTTTTGGATTCCAAAGACAAAACCCAAAAGAGCAATGGTGAAAAGAATGAAAAATGTGAGACCAAAGAGAAAGGA
GCAATCACAGCAAAGGAACTATACACAATGATGACGGATAAAAACATCAGCTTGATTATAATGGATGCTCGAAGAATGCAGGATTATCAG
GATTCCTGTATTTTACATTCTCTCAGTGTTCCTGAAGAAGCCATCAGTCCAGGAGTCACTGCTAGTTGGATTGAAGCACACCTGCCAGAT
GATTCTAAAGACACATGGAAGAAGAGGGGGAATGTGGAGTATGTGGTACTTCTTGACTGGTTTAGTTCTGCCAAAGATTTACAGATTGGA
ACAACTCTCCGGAGTCTGAAAGATGCACTTTTCAAGTGGGAAAGTAAAACTGTCCTGCGCAATGAGCCTTTGGTTTTAGAGGGAGGCTAT
GAAAACTGGCTCCTTTGTTATCCCCAGTATACAACAAATGCTAAGGTCACTCCACCCCCACGACGCCAGAATGAAGAGGTGTCTATCTCA
TTGGATTTTACTTATCCCTCATTGGAAGAATCAATTCCTTCTAAACCTGCTGCCCAGACGCCACCTGCATCTATAGAAGTAGATGAAAAT
ATAGAATTGATAAGTGGTCAAAATGAGAGAATGGGACCACTGAATATATCAACTCCAGTTGAACCAGTTGCTGCTTCTAAATCTGATGTT
TCACCCATAATTCAGCCAGTGCCTAGTATAAAGAATGTTCCACAGATTGATCGTACTAAAAAACCAGCAGTCAAATTGCCTGAAGAGCAT
AGAATAAAATCTGAAAGTACAAACCATGAGCAGCAATCTCCTCAGAGTGGAAAAGTTATTCCTGATCGTTCCACCAAGCCAGTAGTTTTT
TCTCCAACTCTCATGTTAACAGATGAAGAAAAGGCTCGTATTCATGCAGAAACTGCTCTTCTAATGGAAAAAAACAAACAAGAAAAAGAA
CTTCGGGAAAGGCAGCAAGAGGAACAGAAAGAGAAACTGAGGAAGGAAGAACAAGAACAAAAAGCCAAAAAGAAACAAGAAGCTGAAGAA
AATGAAATTACAGAGAAGCAACAAAAAGCAAAAGAAGAAATGGAGAAGAAAGAAAGTGAACAGGCCAAGAAAGAAGATAAAGAAACCTCA
GCAAAGAGGGGCAAAGAAATAACAGGAGTAAAAAGACAAAGTAAAAGTGAACATGAAACTTCTGATGCCAAGAAATCTGTAGAAGATAGG
GGGAAAAGGTGTCCAACCCCAGAAATACAGAAAAAGTCAACAGGAGATGTGCCCCATACATCTGTGACAGGGGATTCAGGTTCAGGCAAG
CCATTTAAGATTAAAGGACAACCAGAAAGTGGAATTCTAAGGACAGGAACTTTTAGAGAGGATACAGACGATACCGAAAGAAATAAAGCT
CAACGAGAACCTTTGACAAGAGCACGAAGTGAAGAAATGGGGAGGATCGTACCAGGACTGCCTTCAGGCTGGGCCAAGTTTCTTGACCCA
ATCACTGGAACCTTTCGTTATTATCATTCACCCACCAACACTGTTCATATGTACCCACCGGAAATGGCTCCTTCATCTGCACCTCCTTCC
ACCCCTCCAACTCATAAAGCCAAGCCACAGATTCCTGCTGAGCGGGATAGGGAACCTTCCAAACTGAAGCGCTCCTACTCCTCCCCAGAT
ATAACCCAGGCTATTCAAGAGGAAGAGAAGAGGAAGCCAACAGTAACTCCAACAGTTAATCGGGAAAACAAGCCAACATGTTATCCTAAA
GCTGAGATCTCAAGGCTTTCTGCTTCTCAGATTCGGAACCTCAATCCTGTTTTTGGAGGTTCTGGACCAGCTCTTACTGGACTTCGTAAC
TTAGGAAATACTTGTTATATGAACTCAATATTGCAGTGCCTATGTAACGCTCCACATTTGGCTGATTATTTCAACCGAAACTGTTATCAG
GATGATATTAACAGGTCAAATTTGTTGGGGCATAAAGGTGAAGTGGCAGAAGAATTTGGTATAATCATGAAAGCCCTGTGGACAGGACAG
TATAGATATATCAGTCCAAAGGACTTTAAAATCACCATTGGGAAGATCAATGACCAGTTTGCAGGATACAGTCAGCAAGATTCACAAGAA
TTGCTTCTGTTCCTAATGGATGGTCTCCATGAAGATCTAAATAAAGCTGATAATCGGAAGAGATATAAAGAAGAAAATAATGATCATCTC
GATGACTTTAAAGCTGCAGAACATGCCTGGCAGAAACACAAGCAGCTCAATGAGTCTATTATTGTTGCACTTTTTCAGGGTCAATTCAAA
TCTACAGTACAGTGCCTCACATGTCACAAAAAGTCTAGGACATTTGAGGCCTTCATGTATTTGTCTCTACCACTAGCATCCACAAGTAAA
TGTACATTACAGGATTGCCTTAGATTATTTTCCAAAGAAGAAAAACTCACAGATAACAACAGATTTTACTGCAGTCATTGCAGAGCTCGA
CGGGATTCTCTAAAAAAGATAGAAATCTGGAAGTTACCACCTGTGCTTTTAGTGCATCTGAAACGTTTTTCCTACGATGGCAGGTGGAAA
CAAAAATTACAGACATCTGTGGACTTCCCGTTAGAAAATCTTGACTTGTCACAGTATGTTATTGGTCCAAAGAACAATTTGAAGAAATAT
AATTTGTTTTCTGTTTCAAATCACTACGGTGGGCTGGATGGAGGCCACTACACAGCCTATTGTAAAAATGCAGCAAGACAACGGTGGTTT
AAGTTTGATGATCATGAAGTTTCTGATATCTCCGTTTCTTCTGTGAAATCTTCAGCAGCTTATATCCTCTTTTATACTTCATTGGGACCA

>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000396444_chr15_50751197_+_6144nt
ATGGGGACTTCCCATCCGGCGTTCCTGGTCTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATC
CTTCCAAATGAAAATGAAAAGGTTGTGCAGCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCC
ATGTCTGAAGAAGAGAGCTCCGATGTGGAAATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCC
TCGGCGGCCCACACAGGGTTGTACACTTGCTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTAT
GTGCCAGACCCAGATGTAGCCTTTGTACCTCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGT
CGCACAACTGATCCCGAGACTCCTGTAACCTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGG
ACCTTCACTGTAGGGCCCTATATCTGTGAGGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGCA
ACATCAGAGCTGGATCTAGAAATGGAAGCTCTTAAAACCGTGTATAAGTCAGGGGAAACGATTGTGGTCACCTGTGCTGTTTTTAACAAT
GAGGTGGTTGACCTTCAATGGACTTACCCTGGAGAAGTGAAAGGCAAAGGCATCACAATGCTGGAAGAAATCAAAGTCCCATCCATCAAA
TTGGTGTACACTTTGACGGTCCCCGAGGCCACGGTGAAAGACAGTGGAGATTACGAATGTGCTGCCCGCCAGGCTACCAGGGAGGTCAAA
GAAATGAAGAAAGTCACTATTTCTGTCCATGAGAAAGGTTTCATTGAAATCAAACCCACCTTCAGCCAGTTGGAAGCTGTCAACCTGCAT
GAAGTCAAACATTTTGTTGTAGAGGTGCGGGCCTACCCACCTCCCAGGATATCCTGGCTGAAAAACAATCTGACTCTGATTGAAAATCTC
ACTGAGATCACCACTGATGTGGAAAAGATTCAGGAAATAAGGTATCGAAGCAAATTAAAGCTGATCCGTGCTAAGGAAGAAGACAGTGGC
CATTATACTATTGTAGCTCAAAATGAAGATGCTGTGAAGAGCTATACTTTTGAACTGTTAACTCAAGTTCCTTCATCCATTCTGGACTTG
GTCGATGATCACCATGGCTCAACTGGGGGACAGACGGTGAGGTGCACAGCTGAAGGCACGCCGCTTCCTGATATTGAGTGGATGATATGC
AAAGATATTAAGAAATGTAATAATGAAACTTCCTGGACTATTTTGGCCAACAATGTCTCAAACATCATCACGGAGATCCACTCCCGAGAC
AGGAGTACCGTGGAGGGCCGTGTGACTTTCGCCAAAGTGGAGGAGACCATCGCCGTGCGATGCCTGGCTAAGAATCTCCTTGGAGCTGAG
AACCGAGAGCTGAAGCTGGTGGCTCCCACCCTGCGTTCTGAACTCACGGTGGCTGCTGCAGTCCTGGTGCTGTTGGTGATTGTGATCATC
TCACTTATTGTCCTGGTTGTCATTTGGAAACAGAAACCGAGGTATGAAATTCGCTGGAGGGTCATTGAATCAATCAGCCCAGATGGACAT
GAATATATTTATGTGGACCCGATGCAGCTGCCTTATGACTCAAGATGGGAGTTTCCAAGAGATGGACTAGTGCTTGGTCGGGTCTTGGGG
TCTGGAGCGTTTGGGAAGGTGGTTGAAGGAACAGCCTATGGATTAAGCCGGTCCCAACCTGTCATGAAAGTTGCAGTGAAGATGCTAAAA
CCCACGGCCAGATCCAGTGAAAAACAAGCTCTCATGTCTGAACTGAAGATAATGACTCACCTGGGGCCACATTTGAACATTGTAAACTTG
CTGGGAGCCTGCACCAAGTCAGGCCCCATTTACATCATCACAGAGTATTGCTTCTATGGAGATTTGGTCAACTATTTGCATAAGAATAGG
GATAGCTTCCTGAGCCACCACCCAGAGAAGCCAAAGAAAGAGCTGGATATCTTTGGATTGAACCCTGCTGATGAAAGCACACGGAGCTAT
GTTATTTTATCTTTTGAAAACAATGGTGACTACATGGACATGAAGCAGGCTGATACTACACAGTATGTCCCCATGCTAGAAAGGAAAGAG
GTTTCTAAATATTCCGACATCCAGAGATCACTCTATGATCGTCCAGCCTCATATAAGAAGAAATCTATGTTAGACTCAGAAGTCAAAAAC
CTCCTTTCAGATGATAACTCAGAAGGCCTTACTTTATTGGATTTGTTGAGCTTCACCTATCAAGTTGCCCGAGGAATGGAGTTTTTGGCT
TCAAAAAATTGTGTCCACCGTGATCTGGCTGCTCGCAACGTCCTCCTGGCACAAGGAAAAATTGTGAAGATCTGTGACTTTGGCCTGGCC
AGAGACATCATGCATGATTCGAACTATGTGTCGAAAGGCAGTACCTTTCTGCCCGTGAAGTGGATGGCTCCTGAGAGCATCTTTGACAAC
CTCTACACCACACTGAGTGATGTCTGGTCTTATGGCATTCTGCTCTGGGAGATCTTTTCCCTTGGTGGCACCCCTTACCCCGGCATGATG
GTGGATTCTACTTTCTACAATAAGATCAAGAGTGGGTACCGGATGGCCAAGCCTGACCACGCTACCAGTGAAGTCTACGAGATCATGGTG
AAATGCTGGAACAGTGAGCCGGAGAAGAGACCCTCCTTTTACCACCTGAGTGAGATTGTGGAGAATCTGCTGCCTGGACAATATAAAAAG
AGTTATGAAAAAATTCACCTGGACTTCCTGAAGAGTGACCATCCTGCTGTGGCACGCATGCGTGTGGACTCAGACAATGCATACATTGGT
GTCACCTACAAAAACGAGGAAGACAAGCTGAAGGACTGGGAGGGTGGTCTGGATGAGCAGAGACTGAGCGCTGACAGTGGCTACATCATT
CCTCTGCCTGACATTGACCCTGTCCCTGAGGAGGAGGACCTGGGCAAGAGGAACAGACACAGATATGAAGAAGCTGAAGTCCGGAAAAAA
CTTGAGGAAAAAGACAGGCAGGAGGAAGCACAGCGGCTACAACAAAAAAGGCAGGAAACAGGAAGAGAGGATGGTGGCACATTGGCTAAA
GGCTCTTTGGAGAATGTTTTGGATTCCAAAGACAAAACCCAAAAGAGCAATGGTGAAAAGAATGAAAAATGTGAGACCAAAGAGAAAGGA
GCAATCACAGCAAAGGAACTATACACAATGATGACGGATAAAAACATCAGCTTGATTATAATGGATGCTCGAAGAATGCAGGATTATCAG
GATTCCTGTATTTTACATTCTCTCAGTGTTCCTGAAGAAGCCATCAGTCCAGGAGTCACTGCTAGTTGGATTGAAGCACACCTGCCAGAT
GATTCTAAAGACACATGGAAGAAGAGGGGGAATGTGGAGTATGTGGTACTTCTTGACTGGTTTAGTTCTGCCAAAGATTTACAGATTGGA
ACAACTCTCCGGAGTCTGAAAGATGCACTTTTCAAGTGGGAAAGTAAAACTGTCCTGCGCAATGAGCCTTTGGTTTTAGAGGGAGGCTAT
GAAAACTGGCTCCTTTGTTATCCCCAGTATACAACAAATGCTAAGGTCACTCCACCCCCACGACGCCAGAATGAAGAGGTGTCTATCTCA
TTGGATTTTACTTATCCCTCATTGGAAGAATCAATTCCTTCTAAACCTGCTGCCCAGACGCCACCTGCATCTATAGAAGTAGATGAAAAT
ATAGAATTGATAAGTGGTCAAAATGAGAGAATGGGACCACTGAATATATCAACTCCAGTTGAACCAGTTGCTGCTTCTAAATCTGATGTT
TCACCCATAATTCAGCCAGTGCCTAGTATAAAGAATGTTCCACAGATTGATCGTACTAAAAAACCAGCAGTCAAATTGCCTGAAGAGCAT
AGAATAAAATCTGAAAGTACAAACCATGAGCAGCAATCTCCTCAGAGTGGAAAAGTTATTCCTGATCGTTCCACCAAGCCAGTAGTTTTT
TCTCCAACTCTCATGTTAACAGATGAAGAAAAGGCTCGTATTCATGCAGAAACTGCTCTTCTAATGGAAAAAAACAAACAAGAAAAAGAA
CTTCGGGAAAGGCAGCAAGAGGAACAGAAAGAGAAACTGAGGAAGGAAGAACAAGAACAAAAAGCCAAAAAGAAACAAGAAGCTGAAGAA
AATGAAATTACAGAGAAGCAACAAAAAGCAAAAGAAGAAATGGAGAAGAAAGAAAGTGAACAGGCCAAGAAAGAAGATAAAGAAACCTCA
GCAAAGAGGGGCAAAGAAATAACAGGAGTAAAAAGACAAAGTAAAAGTGAACATGAAACTTCTGATGCCAAGAAATCTGTAGAAGATAGG
GGGAAAAGGTGTCCAACCCCAGAAATACAGAAAAAGTCAACAGGAGATGTGCCCCATACATCTGTGACAGGGGATTCAGGTTCAGGCAAG
CCATTTAAGATTAAAGGACAACCAGAAAGTGGAATTCTAAGGACAGGAACTTTTAGAGAGGATACAGACGATACCGAAAGAAATAAAGCT
CAACGAGAACCTTTGACAAGAGCACGAAGTGAAGAAATGGGGAGGATCGTACCAGGACTGCCTTCAGGCTGGGCCAAGTTTCTTGACCCA
ATCACTGGAACCTTTCGTTATTATCATTCACCCACCAACACTGTTCATATGTACCCACCGGAAATGGCTCCTTCATCTGCACCTCCTTCC
ACCCCTCCAACTCATAAAGCCAAGCCACAGATTCCTGCTGAGCGGGATAGGGAACCTTCCAAACTGAAGCGCTCCTACTCCTCCCCAGAT
ATAACCCAGGCTATTCAAGAGGAAGAGAAGAGGAAGCCAACAGTAACTCCAACAGTTAATCGGGAAAACAAGCCAACATGTTATCCTAAA
GCTGAGATCTCAAGGCTTTCTGCTTCTCAGATTCGGAACCTCAATCCTGTTTTTGGAGGTTCTGGACCAGCTCTTACTGGACTTCGTAAC
TTAGGAAATACTTGTTATATGAACTCAATATTGCAGTGCCTATGTAACGCTCCACATTTGGCTGATTATTTCAACCGAAACTGTTATCAG
GATGATATTAACAGGTCAAATTTGTTGGGGCATAAAGGTGAAGTGGCAGAAGAATTTGGTATAATCATGAAAGCCCTGTGGACAGGACAG
TATAGATATATCAGTCCAAAGGACTTTAAAATCACCATTGGGAAGATCAATGACCAGTTTGCAGGATACAGTCAGCAAGATTCACAAGAA
TTGCTTCTGTTCCTAATGGATGGTCTCCATGAAGATCTAAATAAAGCTGATAATCGGAAGAGATATAAAGAAGAAAATAATGATCATCTC
GATGACTTTAAAGCTGCAGAACATGCCTGGCAGAAACACAAGCAGCTCAATGAGTCTATTATTGTTGCACTTTTTCAGGGTCAATTCAAA
TCTACAGTACAGTGCCTCACATGTCACAAAAAGTCTAGGACATTTGAGGCCTTCATGTATTTGTCTCTACCACTAGCATCCACAAGTAAA
TGTACATTACAGGATTGCCTTAGATTATTTTCCAAAGAAGAAAAACTCACAGATAACAACAGATTTTACTGCAGTCATTGCAGAGCTCGA
CGGGATTCTCTAAAAAAGATAGAAATCTGGAAGTTACCACCTGTGCTTTTAGTGCATCTGAAACGTTTTTCCTACGATGGCAGGTGGAAA
CAAAAATTACAGACATCTGTGGACTTCCCGTTAGAAAATCTTGACTTGTCACAGTATGTTATTGGTCCAAAGAACAATTTGAAGAAATAT
AATTTGTTTTCTGTTTCAAATCACTACGGTGGGCTGGATGGAGGCCACTACACAGCCTATTGTAAAAATGCAGCAAGACAACGGTGGTTT
AAGTTTGATGATCATGAAGTTTCTGATATCTCCGTTTCTTCTGTGAAATCTTCAGCAGCTTATATCCTCTTTTATACTTCATTGGGACCA

>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000425032_chr15_50751197_+_6057nt
ATGGGGACTTCCCATCCGGCGTTCCTGGTCTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATC
CTTCCAAATGAAAATGAAAAGGTTGTGCAGCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCC
ATGTCTGAAGAAGAGAGCTCCGATGTGGAAATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCC
TCGGCGGCCCACACAGGGTTGTACACTTGCTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTAT
GTGCCAGACCCAGATGTAGCCTTTGTACCTCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGT
CGCACAACTGATCCCGAGACTCCTGTAACCTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGG
ACCTTCACTGTAGGGCCCTATATCTGTGAGGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGCA
ACATCAGAGCTGGATCTAGAAATGGAAGCTCTTAAAACCGTGTATAAGTCAGGGGAAACGATTGTGGTCACCTGTGCTGTTTTTAACAAT
GAGGTGGTTGACCTTCAATGGACTTACCCTGGAGAAGTGAAAGGCAAAGGCATCACAATGCTGGAAGAAATCAAAGTCCCATCCATCAAA
TTGGTGTACACTTTGACGGTCCCCGAGGCCACGGTGAAAGACAGTGGAGATTACGAATGTGCTGCCCGCCAGGCTACCAGGGAGGTCAAA
GAAATGAAGAAAGTCACTATTTCTGTCCATGAGAAAGGTTTCATTGAAATCAAACCCACCTTCAGCCAGTTGGAAGCTGTCAACCTGCAT
GAAGTCAAACATTTTGTTGTAGAGGTGCGGGCCTACCCACCTCCCAGGATATCCTGGCTGAAAAACAATCTGACTCTGATTGAAAATCTC
ACTGAGATCACCACTGATGTGGAAAAGATTCAGGAAATAAGGTATCGAAGCAAATTAAAGCTGATCCGTGCTAAGGAAGAAGACAGTGGC
CATTATACTATTGTAGCTCAAAATGAAGATGCTGTGAAGAGCTATACTTTTGAACTGTTAACTCAAGTTCCTTCATCCATTCTGGACTTG
GTCGATGATCACCATGGCTCAACTGGGGGACAGACGGTGAGGTGCACAGCTGAAGGCACGCCGCTTCCTGATATTGAGTGGATGATATGC
AAAGATATTAAGAAATGTAATAATGAAACTTCCTGGACTATTTTGGCCAACAATGTCTCAAACATCATCACGGAGATCCACTCCCGAGAC
AGGAGTACCGTGGAGGGCCGTGTGACTTTCGCCAAAGTGGAGGAGACCATCGCCGTGCGATGCCTGGCTAAGAATCTCCTTGGAGCTGAG
AACCGAGAGCTGAAGCTGGTGGCTCCCACCCTGCGTTCTGAACTCACGGTGGCTGCTGCAGTCCTGGTGCTGTTGGTGATTGTGATCATC
TCACTTATTGTCCTGGTTGTCATTTGGAAACAGAAACCGAGGTATGAAATTCGCTGGAGGGTCATTGAATCAATCAGCCCAGATGGACAT
GAATATATTTATGTGGACCCGATGCAGCTGCCTTATGACTCAAGATGGGAGTTTCCAAGAGATGGACTAGTGCTTGGTCGGGTCTTGGGG
TCTGGAGCGTTTGGGAAGGTGGTTGAAGGAACAGCCTATGGATTAAGCCGGTCCCAACCTGTCATGAAAGTTGCAGTGAAGATGCTAAAA
CCCACGGCCAGATCCAGTGAAAAACAAGCTCTCATGTCTGAACTGAAGATAATGACTCACCTGGGGCCACATTTGAACATTGTAAACTTG
CTGGGAGCCTGCACCAAGTCAGGCCCCATTTACATCATCACAGAGTATTGCTTCTATGGAGATTTGGTCAACTATTTGCATAAGAATAGG
GATAGCTTCCTGAGCCACCACCCAGAGAAGCCAAAGAAAGAGCTGGATATCTTTGGATTGAACCCTGCTGATGAAAGCACACGGAGCTAT
GTTATTTTATCTTTTGAAAACAATGGTGACTACATGGACATGAAGCAGGCTGATACTACACAGTATGTCCCCATGCTAGAAAGGAAAGAG
GTTTCTAAATATTCCGACATCCAGAGATCACTCTATGATCGTCCAGCCTCATATAAGAAGAAATCTATGTTAGACTCAGAAGTCAAAAAC
CTCCTTTCAGATGATAACTCAGAAGGCCTTACTTTATTGGATTTGTTGAGCTTCACCTATCAAGTTGCCCGAGGAATGGAGTTTTTGGCT
TCAAAAAATTGTGTCCACCGTGATCTGGCTGCTCGCAACGTCCTCCTGGCACAAGGAAAAATTGTGAAGATCTGTGACTTTGGCCTGGCC
AGAGACATCATGCATGATTCGAACTATGTGTCGAAAGGCAGTACCTTTCTGCCCGTGAAGTGGATGGCTCCTGAGAGCATCTTTGACAAC
CTCTACACCACACTGAGTGATGTCTGGTCTTATGGCATTCTGCTCTGGGAGATCTTTTCCCTTGGTGGCACCCCTTACCCCGGCATGATG
GTGGATTCTACTTTCTACAATAAGATCAAGAGTGGGTACCGGATGGCCAAGCCTGACCACGCTACCAGTGAAGTCTACGAGATCATGGTG
AAATGCTGGAACAGTGAGCCGGAGAAGAGACCCTCCTTTTACCACCTGAGTGAGATTGTGGAGAATCTGCTGCCTGGACAATATAAAAAG
AGTTATGAAAAAATTCACCTGGACTTCCTGAAGAGTGACCATCCTGCTGTGGCACGCATGCGTGTGGACTCAGACAATGCATACATTGGT
GTCACCTACAAAAACGAGGAAGACAAGCTGAAGGACTGGGAGGGTGGTCTGGATGAGCAGAGACTGAGCGCTGACAGTGGCTACATCATT
CCTCTGCCTGACATTGACCCTGTCCCTGAGGAGGAGGACCTGGGCAAGAGGAACAGACACAGATATGAAGAAGCTGAAGTCCGGAAAAAA
CTTGAGGAAAAAGACAGGCAGGAGGAAGCACAGCGGCTACAACAAAAAAGGCAGGAAACAGGAAGAGAGGATGGTGGCACATTGGCTAAA
GGCTCTTTGGAGAATGTTTTGGATTCCAAAGACAAAACCCAAAAGAGCAATGGTGAAAAGAATGAAAAATGTGAGACCAAAGAGAAAGGA
GCAATCACAGCAAAGGAACTATACACAATGATGACGGATAAAAACATCAGCTTGATTATAATGGATGCTCGAAGAATGCAGGATTATCAG
GATTCCTGTATTTTACATTCTCTCAGTGTTCCTGAAGAAGCCATCAGTCCAGGAGTCACTGCTAGTTGGATTGAAGCACACCTGCCAGAT
GATTCTAAAGACACATGGAAGAAGAGGGGGAATGTGGAGTATGTGGTACTTCTTGACTGGTTTAGTTCTGCCAAAGATTTACAGATTGGA
ACAACTCTCCGGAGTCTGAAAGATGCACTTTTCAAGTGGGAAAGTAAAACTGTCCTGCGCAATGAGCCTTTGGTTTTAGAGGGAGGCTAT
GAAAACTGGCTCCTTTGTTATCCCCAGTATACAACAAATGCTAAGGTCACTCCACCCCCACGACGCCAGAATGAAGAGGTGTCTATCTCA
TTGGATTTTACTTATCCCTCATTGGAAGAATCAATTCCTTCTAAACCTGCTGCCCAGACGCCACCTGCATCTATAGAAGTAGATGAAAAT
ATAGAATTGATAAGTGGTCAAAATGAGAGAATGGGACCACTGAATATATCAACTCCAGTTGAACCAGTTGCTGCTTCTAAATCTGATGTT
TCACCCATAATTCAGCCAGTGCCTAGTATAAAGAATGTTCCACAGATTGATCGTACTAAAAAACCAGCAGTCAAATTGCCTGAAGAGCAT
AGAATAAAATCTGAAAGTACAAACCATGAGCAGCAATCTCCTCAGAGTGGAAAAGTTATTCCTGATCGTTCCACCAAGCCAGTAGTTTTT
TCTCCAACTCTCATGTTAACAGATGAAGAAAAGGCTCGTATTCATGCAGAAACTGCTCTTCTAATGGAAAAAAACAAACAAGAAAAAGAA
CTTCGGGAAAGGCAGCAAGAGGAACAGAAAGAGAAACTGAGGAAGGAAGAACAAGAACAAAAAGCCAAAAAGAAACAAGAAGCTGAAGAA
AATGAAATTACAGAGAAGCAACAAAAAGCAAAAGAAGAAATGGAGAAGAAAGAAAGTGAACAGGCCAAGAAAGAAGATAAAGAAACCTCA
GCAAAGAGGGGCAAAGAAATAACAGGAGTAAAAAGACAAAGTAAAAGTGAACATGAAACTTCTGATGCCAAGAAATCTGTAGAAGATAGG
GGGAAAAGGTGTCCAACCCCAGAAATACAGAAAAAGTCAACAGGAGATGTGCCCCATACATCTGTGACAGGGGATTCAGGTTCAGGCAAG
GCTCAACGAGAACCTTTGACAAGAGCACGAAGTGAAGAAATGGGGAGGATCGTACCAGGACTGCCTTCAGGCTGGGCCAAGTTTCTTGAC
CCAATCACTGGAACCTTTCGTTATTATCATTCACCCACCAACACTGTTCATATGTACCCACCGGAAATGGCTCCTTCATCTGCACCTCCT
TCCACCCCTCCAACTCATAAAGCCAAGCCACAGATTCCTGCTGAGCGGGATAGGGAACCTTCCAAACTGAAGCGCTCCTACTCCTCCCCA
GATATAACCCAGGCTATTCAAGAGGAAGAGAAGAGGAAGCCAACAGTAACTCCAACAGTTAATCGGGAAAACAAGCCAACATGTTATCCT
AAAGCTGAGATCTCAAGGCTTTCTGCTTCTCAGATTCGGAACCTCAATCCTGTTTTTGGAGGTTCTGGACCAGCTCTTACTGGACTTCGT
AACTTAGGAAATACTTGTTATATGAACTCAATATTGCAGTGCCTATGTAACGCTCCACATTTGGCTGATTATTTCAACCGAAACTGTTAT
CAGGATGATATTAACAGGTCAAATTTGTTGGGGCATAAAGGTGAAGTGGCAGAAGAATTTGGTATAATCATGAAAGCCCTGTGGACAGGA
CAGTATAGATATATCAGTCCAAAGGACTTTAAAATCACCATTGGGAAGATCAATGACCAGTTTGCAGGATACAGTCAGCAAGATTCACAA
GAATTGCTTCTGTTCCTAATGGATGGTCTCCATGAAGATCTAAATAAAGCTGATAATCGGAAGAGATATAAAGAAGAAAATAATGATCAT
CTCGATGACTTTAAAGCTGCAGAACATGCCTGGCAGAAACACAAGCAGCTCAATGAGTCTATTATTGTTGCACTTTTTCAGGGTCAATTC
AAATCTACAGTACAGTGCCTCACATGTCACAAAAAGTCTAGGACATTTGAGGCCTTCATGTATTTGTCTCTACCACTAGCATCCACAAGT
AAATGTACATTACAGGATTGCCTTAGATTATTTTCCAAAGAAGAAAAACTCACAGATAACAACAGATTTTACTGCAGTCATTGCAGAGCT
CGACGGGATTCTCTAAAAAAGATAGAAATCTGGAAGTTACCACCTGTGCTTTTAGTGCATCTGAAACGTTTTTCCTACGATGGCAGGTGG
AAACAAAAATTACAGACATCTGTGGACTTCCCGTTAGAAAATCTTGACTTGTCACAGTATGTTATTGGTCCAAAGAACAATTTGAAGAAA
TATAATTTGTTTTCTGTTTCAAATCACTACGGTGGGCTGGATGGAGGCCACTACACAGCCTATTGTAAAAATGCAGCAAGACAACGGTGG
TTTAAGTTTGATGATCATGAAGTTTCTGATATCTCCGTTTCTTCTGTGAAATCTTCAGCAGCTTATATCCTCTTTTATACTTCATTGGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000307179_chr15_50751197_+_7163nt
AAGAGCAAAAAGCGAAGGCGCAATCTGGACACTGGGAGATTCGGAGCGCAGGGAGTTTGAGAGAAACTTTTATTTTGAAGAGACCAAGGT
TGAGGGGGGGCTTATTTCCTGACAGCTATTTACTTAGAGCAAATGATTAGTTTTAGAAGGATGGACTATAACATTGAATCAATTACAAAA
CGCGGTTTTTGAGCCCATTACTGTTGGAGCTACAGGGAGAGAAACAGAGGAGGAGACTGCAAGAGATCATTGGAGGCCGTGGGCACGCTC
TTTACTCCATGTGTGGGACATTCATTGCGGAATAACATCGGAGGAGAAGTTTCCCAGAGCTATGGGGACTTCCCATCCGGCGTTCCTGGT
CTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATCCTTCCAAATGAAAATGAAAAGGTTGTGCA
GCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCCATGTCTGAAGAAGAGAGCTCCGATGTGGA
AATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCCTCGGCGGCCCACACAGGGTTGTACACTTG
CTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTATGTGCCAGACCCAGATGTAGCCTTTGTACC
TCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGTCGCACAACTGATCCCGAGACTCCTGTAAC
CTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGGACCTTCACTGTAGGGCCCTATATCTGTGA
GGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGCAACATCAGAGCTGGATCTAGAAATGGAAGC
TCTTAAAACCGTGTATAAGTCAGGGGAAACGATTGTGGTCACCTGTGCTGTTTTTAACAATGAGGTGGTTGACCTTCAATGGACTTACCC
TGGAGAAGTGAAAGGCAAAGGCATCACAATGCTGGAAGAAATCAAAGTCCCATCCATCAAATTGGTGTACACTTTGACGGTCCCCGAGGC
CACGGTGAAAGACAGTGGAGATTACGAATGTGCTGCCCGCCAGGCTACCAGGGAGGTCAAAGAAATGAAGAAAGTCACTATTTCTGTCCA
TGAGAAAGGTTTCATTGAAATCAAACCCACCTTCAGCCAGTTGGAAGCTGTCAACCTGCATGAAGTCAAACATTTTGTTGTAGAGGTGCG
GGCCTACCCACCTCCCAGGATATCCTGGCTGAAAAACAATCTGACTCTGATTGAAAATCTCACTGAGATCACCACTGATGTGGAAAAGAT
TCAGGAAATAAGGTATCGAAGCAAATTAAAGCTGATCCGTGCTAAGGAAGAAGACAGTGGCCATTATACTATTGTAGCTCAAAATGAAGA
TGCTGTGAAGAGCTATACTTTTGAACTGTTAACTCAAGTTCCTTCATCCATTCTGGACTTGGTCGATGATCACCATGGCTCAACTGGGGG
ACAGACGGTGAGGTGCACAGCTGAAGGCACGCCGCTTCCTGATATTGAGTGGATGATATGCAAAGATATTAAGAAATGTAATAATGAAAC
TTCCTGGACTATTTTGGCCAACAATGTCTCAAACATCATCACGGAGATCCACTCCCGAGACAGGAGTACCGTGGAGGGCCGTGTGACTTT
CGCCAAAGTGGAGGAGACCATCGCCGTGCGATGCCTGGCTAAGAATCTCCTTGGAGCTGAGAACCGAGAGCTGAAGCTGGTGGCTCCCAC
CCTGCGTTCTGAACTCACGGTGGCTGCTGCAGTCCTGGTGCTGTTGGTGATTGTGATCATCTCACTTATTGTCCTGGTTGTCATTTGGAA
ACAGAAACCGAGGTATGAAATTCGCTGGAGGGTCATTGAATCAATCAGCCCAGATGGACATGAATATATTTATGTGGACCCGATGCAGCT
GCCTTATGACTCAAGATGGGAGTTTCCAAGAGATGGACTAGTGCTTGGTCGGGTCTTGGGGTCTGGAGCGTTTGGGAAGGTGGTTGAAGG
AACAGCCTATGGATTAAGCCGGTCCCAACCTGTCATGAAAGTTGCAGTGAAGATGCTAAAACCCACGGCCAGATCCAGTGAAAAACAAGC
TCTCATGTCTGAACTGAAGATAATGACTCACCTGGGGCCACATTTGAACATTGTAAACTTGCTGGGAGCCTGCACCAAGTCAGGCCCCAT
TTACATCATCACAGAGTATTGCTTCTATGGAGATTTGGTCAACTATTTGCATAAGAATAGGGATAGCTTCCTGAGCCACCACCCAGAGAA
GCCAAAGAAAGAGCTGGATATCTTTGGATTGAACCCTGCTGATGAAAGCACACGGAGCTATGTTATTTTATCTTTTGAAAACAATGGTGA
CTACATGGACATGAAGCAGGCTGATACTACACAGTATGTCCCCATGCTAGAAAGGAAAGAGGTTTCTAAATATTCCGACATCCAGAGATC
ACTCTATGATCGTCCAGCCTCATATAAGAAGAAATCTATGTTAGACTCAGAAGTCAAAAACCTCCTTTCAGATGATAACTCAGAAGGCCT
TACTTTATTGGATTTGTTGAGCTTCACCTATCAAGTTGCCCGAGGAATGGAGTTTTTGGCTTCAAAAAATTGTGTCCACCGTGATCTGGC
TGCTCGCAACGTCCTCCTGGCACAAGGAAAAATTGTGAAGATCTGTGACTTTGGCCTGGCCAGAGACATCATGCATGATTCGAACTATGT
GTCGAAAGGCAGTACCTTTCTGCCCGTGAAGTGGATGGCTCCTGAGAGCATCTTTGACAACCTCTACACCACACTGAGTGATGTCTGGTC
TTATGGCATTCTGCTCTGGGAGATCTTTTCCCTTGGTGGCACCCCTTACCCCGGCATGATGGTGGATTCTACTTTCTACAATAAGATCAA
GAGTGGGTACCGGATGGCCAAGCCTGACCACGCTACCAGTGAAGTCTACGAGATCATGGTGAAATGCTGGAACAGTGAGCCGGAGAAGAG
ACCCTCCTTTTACCACCTGAGTGAGATTGTGGAGAATCTGCTGCCTGGACAATATAAAAAGAGTTATGAAAAAATTCACCTGGACTTCCT
GAAGAGTGACCATCCTGCTGTGGCACGCATGCGTGTGGACTCAGACAATGCATACATTGGTGTCACCTACAAAAACGAGGAAGACAAGCT
GAAGGACTGGGAGGGTGGTCTGGATGAGCAGAGACTGAGCGCTGACAGTGGCTACATCATTCCTCTGCCTGACATTGACCCTGTCCCTGA
GGAGGAGGACCTGGGCAAGAGGAACAGACACAGATATGAAGAAGCTGAAGTCCGGAAAAAACTTGAGGAAAAAGACAGGCAGGAGGAAGC
ACAGCGGCTACAACAAAAAAGGCAGGAAACAGGAAGAGAGGATGGTGGCACATTGGCTAAAGGCTCTTTGGAGAATGTTTTGGATTCCAA
AGACAAAACCCAAAAGAGCAATGGTGAAAAGAATGAAAAATGTGAGACCAAAGAGAAAGGAGCAATCACAGCAAAGGAACTATACACAAT
GATGACGGATAAAAACATCAGCTTGATTATAATGGATGCTCGAAGAATGCAGGATTATCAGGATTCCTGTATTTTACATTCTCTCAGTGT
TCCTGAAGAAGCCATCAGTCCAGGAGTCACTGCTAGTTGGATTGAAGCACACCTGCCAGATGATTCTAAAGACACATGGAAGAAGAGGGG
GAATGTGGAGTATGTGGTACTTCTTGACTGGTTTAGTTCTGCCAAAGATTTACAGATTGGAACAACTCTCCGGAGTCTGAAAGATGCACT
TTTCAAGTGGGAAAGTAAAACTGTCCTGCGCAATGAGCCTTTGGTTTTAGAGGGAGGCTATGAAAACTGGCTCCTTTGTTATCCCCAGTA
TACAACAAATGCTAAGGTCACTCCACCCCCACGACGCCAGAATGAAGAGGTGTCTATCTCATTGGATTTTACTTATCCCTCATTGGAAGA
ATCAATTCCTTCTAAACCTGCTGCCCAGACGCCACCTGCATCTATAGAAGTAGATGAAAATATAGAATTGATAAGTGGTCAAAATGAGAG
AATGGGACCACTGAATATATCAACTCCAGTTGAACCAGTTGCTGCTTCTAAATCTGATGTTTCACCCATAATTCAGCCAGTGCCTAGTAT
AAAGAATGTTCCACAGATTGATCGTACTAAAAAACCAGCAGTCAAATTGCCTGAAGAGCATAGAATAAAATCTGAAAGTACAAACCATGA
GCAGCAATCTCCTCAGAGTGGAAAAGTTATTCCTGATCGTTCCACCAAGCCAGTAGTTTTTTCTCCAACTCTCATGTTAACAGATGAAGA
AAAGGCTCGTATTCATGCAGAAACTGCTCTTCTAATGGAAAAAAACAAACAAGAAAAAGAACTTCGGGAAAGGCAGCAAGAGGAACAGAA
AGAGAAACTGAGGAAGGAAGAACAAGAACAAAAAGCCAAAAAGAAACAAGAAGCTGAAGAAAATGAAATTACAGAGAAGCAACAAAAAGC
AAAAGAAGAAATGGAGAAGAAAGAAAGTGAACAGGCCAAGAAAGAAGATAAAGAAACCTCAGCAAAGAGGGGCAAAGAAATAACAGGAGT
AAAAAGACAAAGTAAAAGTGAACATGAAACTTCTGATGCCAAGAAATCTGTAGAAGATAGGGGGAAAAGGTGTCCAACCCCAGAAATACA
GAAAAAGTCAACAGGAGATGTGCCCCATACATCTGTGACAGGGGATTCAGGTTCAGGCAAGCCATTTAAGATTAAAGGACAACCAGAAAG
TGGAATTCTAAGGACAGGAACTTTTAGAGAGGATACAGACGATACCGAAAGAAATAAAGCTCAACGAGAACCTTTGACAAGAGCACGAAG
TGAAGAAATGGGGAGGATCGTACCAGGACTGCCTTCAGGCTGGGCCAAGTTTCTTGACCCAATCACTGGAACCTTTCGTTATTATCATTC
ACCCACCAACACTGTTCATATGTACCCACCGGAAATGGCTCCTTCATCTGCACCTCCTTCCACCCCTCCAACTCATAAAGCCAAGCCACA
GATTCCTGCTGAGCGGGATAGGGAACCTTCCAAACTGAAGCGCTCCTACTCCTCCCCAGATATAACCCAGGCTATTCAAGAGGAAGAGAA
GAGGAAGCCAACAGTAACTCCAACAGTTAATCGGGAAAACAAGCCAACATGTTATCCTAAAGCTGAGATCTCAAGGCTTTCTGCTTCTCA
GATTCGGAACCTCAATCCTGTTTTTGGAGGTTCTGGACCAGCTCTTACTGGACTTCGTAACTTAGGAAATACTTGTTATATGAACTCAAT
ATTGCAGTGCCTATGTAACGCTCCACATTTGGCTGATTATTTCAACCGAAACTGTTATCAGGATGATATTAACAGGTCAAATTTGTTGGG
GCATAAAGGTGAAGTGGCAGAAGAATTTGGTATAATCATGAAAGCCCTGTGGACAGGACAGTATAGATATATCAGTCCAAAGGACTTTAA
AATCACCATTGGGAAGATCAATGACCAGTTTGCAGGATACAGTCAGCAAGATTCACAAGAATTGCTTCTGTTCCTAATGGATGGTCTCCA
TGAAGATCTAAATAAAGCTGATAATCGGAAGAGATATAAAGAAGAAAATAATGATCATCTCGATGACTTTAAAGCTGCAGAACATGCCTG
GCAGAAACACAAGCAGCTCAATGAGTCTATTATTGTTGCACTTTTTCAGGGTCAATTCAAATCTACAGTACAGTGCCTCACATGTCACAA
AAAGTCTAGGACATTTGAGGCCTTCATGTATTTGTCTCTACCACTAGCATCCACAAGTAAATGTACATTACAGGATTGCCTTAGATTATT
TTCCAAAGAAGAAAAACTCACAGATAACAACAGATTTTACTGCAGTCATTGCAGAGCTCGACGGGATTCTCTAAAAAAGATAGAAATCTG
GAAGTTACCACCTGTGCTTTTAGTGCATCTGAAACGTTTTTCCTACGATGGCAGGTGGAAACAAAAATTACAGACATCTGTGGACTTCCC
GTTAGAAAATCTTGACTTGTCACAGTATGTTATTGGTCCAAAGAACAATTTGAAGAAATATAATTTGTTTTCTGTTTCAAATCACTACGG
TGGGCTGGATGGAGGCCACTACACAGCCTATTGTAAAAATGCAGCAAGACAACGGTGGTTTAAGTTTGATGATCATGAAGTTTCTGATAT
CTCCGTTTCTTCTGTGAAATCTTCAGCAGCTTATATCCTCTTTTATACTTCATTGGGACCACGAGTAACTGATGTAGCCACATAAGGAGA
CATAGGTTATAAACTAGTTATCTTTTAAAAGGCTCAGCAACACAACTCTTGAAATGCTTATCAGGATAATGGTAGCTATAGCTGGCCATT
TAGAGGAATTCTAGGACAGTGGGAGCTGTGTTACTAGCACTATATAATTCCGGTCAGTGCTGACAAATAACATTTAACAAGTATTGCAGT
AATCATCACTTACAGGTACCATTTATTTCAAAACAACTTTTTTAGTCTGCTCCAAAGTTAAAATAATTAACTAGCTAAGCATTATTATTC
GACTGGTCTAAAAACTATTGTTATCTTTTTTTTTTCCTTTTCACTGTTATGGCCTTTTCACATTTCTAAATCCCATCTTGATATACTATG
AATACTCTAGAATGATGTAAAGCAGATAGGAATGTATGTGTACATATTTATTGCATACTTGCACATCAAATCGATGTACATAGTTTAACA
CGTGGTCCTTTTGTGAAACCTAGAACTCAGAGGATTGCTTTTTTTCTTTCAGCCTATTTTGAGTTAACTTCAGTGCTTTCTTAGGGAAAT
GACAGGGCAAAGCAATTTTTCTGTTGGCTTTGGGCTGTATTTGTGCACTAAATCTTTATTCTAAAAAAAAAAATGGAAACTTTAATTTTT

>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000433963_chr15_50751197_+_8466nt
AAGAGCAAAAAGCGAAGGCGCAATCTGGACACTGGGAGATTCGGAGCGCAGGGAGTTTGAGAGAAACTTTTATTTTGAAGAGACCAAGGT
TGAGGGGGGGCTTATTTCCTGACAGCTATTTACTTAGAGCAAATGATTAGTTTTAGAAGGATGGACTATAACATTGAATCAATTACAAAA
CGCGGTTTTTGAGCCCATTACTGTTGGAGCTACAGGGAGAGAAACAGAGGAGGAGACTGCAAGAGATCATTGGAGGCCGTGGGCACGCTC
TTTACTCCATGTGTGGGACATTCATTGCGGAATAACATCGGAGGAGAAGTTTCCCAGAGCTATGGGGACTTCCCATCCGGCGTTCCTGGT
CTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATCCTTCCAAATGAAAATGAAAAGGTTGTGCA
GCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCCATGTCTGAAGAAGAGAGCTCCGATGTGGA
AATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCCTCGGCGGCCCACACAGGGTTGTACACTTG
CTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTATGTGCCAGACCCAGATGTAGCCTTTGTACC
TCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGTCGCACAACTGATCCCGAGACTCCTGTAAC
CTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGGACCTTCACTGTAGGGCCCTATATCTGTGA
GGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGCAACATCAGAGCTGGATCTAGAAATGGAAGC
TCTTAAAACCGTGTATAAGTCAGGGGAAACGATTGTGGTCACCTGTGCTGTTTTTAACAATGAGGTGGTTGACCTTCAATGGACTTACCC
TGGAGAAGTGAAAGGCAAAGGCATCACAATGCTGGAAGAAATCAAAGTCCCATCCATCAAATTGGTGTACACTTTGACGGTCCCCGAGGC
CACGGTGAAAGACAGTGGAGATTACGAATGTGCTGCCCGCCAGGCTACCAGGGAGGTCAAAGAAATGAAGAAAGTCACTATTTCTGTCCA
TGAGAAAGGTTTCATTGAAATCAAACCCACCTTCAGCCAGTTGGAAGCTGTCAACCTGCATGAAGTCAAACATTTTGTTGTAGAGGTGCG
GGCCTACCCACCTCCCAGGATATCCTGGCTGAAAAACAATCTGACTCTGATTGAAAATCTCACTGAGATCACCACTGATGTGGAAAAGAT
TCAGGAAATAAGGTATCGAAGCAAATTAAAGCTGATCCGTGCTAAGGAAGAAGACAGTGGCCATTATACTATTGTAGCTCAAAATGAAGA
TGCTGTGAAGAGCTATACTTTTGAACTGTTAACTCAAGTTCCTTCATCCATTCTGGACTTGGTCGATGATCACCATGGCTCAACTGGGGG
ACAGACGGTGAGGTGCACAGCTGAAGGCACGCCGCTTCCTGATATTGAGTGGATGATATGCAAAGATATTAAGAAATGTAATAATGAAAC
TTCCTGGACTATTTTGGCCAACAATGTCTCAAACATCATCACGGAGATCCACTCCCGAGACAGGAGTACCGTGGAGGGCCGTGTGACTTT
CGCCAAAGTGGAGGAGACCATCGCCGTGCGATGCCTGGCTAAGAATCTCCTTGGAGCTGAGAACCGAGAGCTGAAGCTGGTGGCTCCCAC
CCTGCGTTCTGAACTCACGGTGGCTGCTGCAGTCCTGGTGCTGTTGGTGATTGTGATCATCTCACTTATTGTCCTGGTTGTCATTTGGAA
ACAGAAACCGAGGTATGAAATTCGCTGGAGGGTCATTGAATCAATCAGCCCAGATGGACATGAATATATTTATGTGGACCCGATGCAGCT
GCCTTATGACTCAAGATGGGAGTTTCCAAGAGATGGACTAGTGCTTGGTCGGGTCTTGGGGTCTGGAGCGTTTGGGAAGGTGGTTGAAGG
AACAGCCTATGGATTAAGCCGGTCCCAACCTGTCATGAAAGTTGCAGTGAAGATGCTAAAACCCACGGCCAGATCCAGTGAAAAACAAGC
TCTCATGTCTGAACTGAAGATAATGACTCACCTGGGGCCACATTTGAACATTGTAAACTTGCTGGGAGCCTGCACCAAGTCAGGCCCCAT
TTACATCATCACAGAGTATTGCTTCTATGGAGATTTGGTCAACTATTTGCATAAGAATAGGGATAGCTTCCTGAGCCACCACCCAGAGAA
GCCAAAGAAAGAGCTGGATATCTTTGGATTGAACCCTGCTGATGAAAGCACACGGAGCTATGTTATTTTATCTTTTGAAAACAATGGTGA
CTACATGGACATGAAGCAGGCTGATACTACACAGTATGTCCCCATGCTAGAAAGGAAAGAGGTTTCTAAATATTCCGACATCCAGAGATC
ACTCTATGATCGTCCAGCCTCATATAAGAAGAAATCTATGTTAGACTCAGAAGTCAAAAACCTCCTTTCAGATGATAACTCAGAAGGCCT
TACTTTATTGGATTTGTTGAGCTTCACCTATCAAGTTGCCCGAGGAATGGAGTTTTTGGCTTCAAAAAATTGTGTCCACCGTGATCTGGC
TGCTCGCAACGTCCTCCTGGCACAAGGAAAAATTGTGAAGATCTGTGACTTTGGCCTGGCCAGAGACATCATGCATGATTCGAACTATGT
GTCGAAAGGCAGTACCTTTCTGCCCGTGAAGTGGATGGCTCCTGAGAGCATCTTTGACAACCTCTACACCACACTGAGTGATGTCTGGTC
TTATGGCATTCTGCTCTGGGAGATCTTTTCCCTTGGTGGCACCCCTTACCCCGGCATGATGGTGGATTCTACTTTCTACAATAAGATCAA
GAGTGGGTACCGGATGGCCAAGCCTGACCACGCTACCAGTGAAGTCTACGAGATCATGGTGAAATGCTGGAACAGTGAGCCGGAGAAGAG
ACCCTCCTTTTACCACCTGAGTGAGATTGTGGAGAATCTGCTGCCTGGACAATATAAAAAGAGTTATGAAAAAATTCACCTGGACTTCCT
GAAGAGTGACCATCCTGCTGTGGCACGCATGCGTGTGGACTCAGACAATGCATACATTGGTGTCACCTACAAAAACGAGGAAGACAAGCT
GAAGGACTGGGAGGGTGGTCTGGATGAGCAGAGACTGAGCGCTGACAGTGGCTACATCATTCCTCTGCCTGACATTGACCCTGTCCCTGA
GGAGGAGGACCTGGGCAAGAGGAACAGACACAGATATGAAGAAGCTGAAGTCCGGAAAAAACTTGAGGAAAAAGACAGGCAGGAGGAAGC
ACAGCGGCTACAACAAAAAAGGCAGGAAACAGGAAGAGAGGATGGTGGCACATTGGCTAAAGGCTCTTTGGAGAATGTTTTGGATTCCAA
AGACAAAACCCAAAAGAGCAATGGTGAAAAGAATGAAAAATGTGAGACCAAAGAGAAAGGAGCAATCACAGCAAAGGAACTATACACAAT
GATGACGGATAAAAACATCAGCTTGATTATAATGGATGCTCGAAGAATGCAGGATTATCAGGATTCCTGTATTTTACATTCTCTCAGTGT
TCCTGAAGAAGCCATCAGTCCAGGAGTCACTGCTAGTTGGATTGAAGCACACCTGCCAGATGATTCTAAAGACACATGGAAGAAGAGGGG
GAATGTGGAGTATGTGGTACTTCTTGACTGGTTTAGTTCTGCCAAAGATTTACAGATTGGAACAACTCTCCGGAGTCTGAAAGATGCACT
TTTCAAGTGGGAAAGTAAAACTGTCCTGCGCAATGAGCCTTTGGTTTTAGAGGGAGGCTATGAAAACTGGCTCCTTTGTTATCCCCAGTA
TACAACAAATGCTAAGGTCACTCCACCCCCACGACGCCAGAATGAAGAGGTGTCTATCTCATTGGATTTTACTTATCCCTCATTGGAAGA
ATCAATTCCTTCTAAACCTGCTGCCCAGACGCCACCTGCATCTATAGAAGTAGATGAAAATATAGAATTGATAAGTGGTCAAAATGAGAG
AATGGGACCACTGAATATATCAACTCCAGTTGAACCAGTTGCTGCTTCTAAATCTGATGTTTCACCCATAATTCAGCCAGTGCCTAGTAT
AAAGAATGTTCCACAGATTGATCGTACTAAAAAACCAGCAGTCAAATTGCCTGAAGAGCATAGAATAAAATCTGAAAGTACAAACCATGA
GCAGCAATCTCCTCAGAGTGGAAAAGTTATTCCTGATCGTTCCACCAAGCCAGTAGTTTTTTCTCCAACTCTCATGTTAACAGATGAAGA
AAAGGCTCGTATTCATGCAGAAACTGCTCTTCTAATGGAAAAAAACAAACAAGAAAAAGAACTTCGGGAAAGGCAGCAAGAGGAACAGAA
AGAGAAACTGAGGAAGGAAGAACAAGAACAAAAAGCCAAAAAGAAACAAGAAGCTGAAGAAAATGAAATTACAGAGAAGCAACAAAAAGC
AAAAGAAGAAATGGAGAAGAAAGAAAGTGAACAGGCCAAGAAAGAAGATAAAGAAACCTCAGCAAAGAGGGGCAAAGAAATAACAGGAGT
AAAAAGACAAAGTAAAAGTGAACATGAAACTTCTGATGCCAAGAAATCTGTAGAAGATAGGGGGAAAAGGTGTCCAACCCCAGAAATACA
GAAAAAGTCAACAGGAGATGTGCCCCATACATCTGTGACAGGGGATTCAGGTTCAGGCAAGCCATTTAAGATTAAAGGACAACCAGAAAG
TGGAATTCTAAGGACAGGAACTTTTAGAGAGGATACAGACGATACCGAAAGAAATAAAGCTCAACGAGAACCTTTGACAAGAGCACGAAG
TGAAGAAATGGGGAGGATCGTACCAGGACTGCCTTCAGGCTGGGCCAAGTTTCTTGACCCAATCACTGGAACCTTTCGTTATTATCATTC
ACCCACCAACACTGTTCATATGTACCCACCGGAAATGGCTCCTTCATCTGCACCTCCTTCCACCCCTCCAACTCATAAAGCCAAGCCACA
GATTCCTGCTGAGCGGGATAGGGAACCTTCCAAACTGAAGCGCTCCTACTCCTCCCCAGATATAACCCAGGCTATTCAAGAGGAAGAGAA
GAGGAAGCCAACAGTAACTCCAACAGTTAATCGGGAAAACAAGCCAACATGTTATCCTAAAGCTGAGATCTCAAGGCTTTCTGCTTCTCA
GATTCGGAACCTCAATCCTGTTTTTGGAGGTTCTGGACCAGCTCTTACTGGACTTCGTAACTTAGGAAATACTTGTTATATGAACTCAAT
ATTGCAGTGCCTATGTAACGCTCCACATTTGGCTGATTATTTCAACCGAAACTGTTATCAGGATGATATTAACAGGTCAAATTTGTTGGG
GCATAAAGGTGAAGTGGCAGAAGAATTTGGTATAATCATGAAAGCCCTGTGGACAGGACAGTATAGATATATCAGTCCAAAGGACTTTAA
AATCACCATTGGGAAGATCAATGACCAGTTTGCAGGATACAGTCAGCAAGATTCACAAGAATTGCTTCTGTTCCTAATGGATGGTCTCCA
TGAAGATCTAAATAAAGCTGATAATCGGAAGAGATATAAAGAAGAAAATAATGATCATCTCGATGACTTTAAAGCTGCAGAACATGCCTG
GCAGAAACACAAGCAGCTCAATGAGTCTATTATTGTTGCACTTTTTCAGGGTCAATTCAAATCTACAGTACAGTGCCTCACATGTCACAA
AAAGTCTAGGACATTTGAGGCCTTCATGTATTTGTCTCTACCACTAGCATCCACAAGTAAATGTACATTACAGGATTGCCTTAGATTATT
TTCCAAAGAAGAAAAACTCACAGATAACAACAGATTTTACTGCAGTCATTGCAGAGCTCGACGGGATTCTCTAAAAAAGATAGAAATCTG
GAAGTTACCACCTGTGCTTTTAGTGCATCTGAAACGTTTTTCCTACGATGGCAGGTGGAAACAAAAATTACAGACATCTGTGGACTTCCC
GTTAGAAAATCTTGACTTGTCACAGTATGTTATTGGTCCAAAGAACAATTTGAAGAAATATAATTTGTTTTCTGTTTCAAATCACTACGG
TGGGCTGGATGGAGGCCACTACACAGCCTATTGTAAAAATGCAGCAAGACAACGGTGGTTTAAGTTTGATGATCATGAAGTTTCTGATAT
CTCCGTTTCTTCTGTGAAATCTTCAGCAGCTTATATCCTCTTTTATACTTCATTGGGACCACGAGTAACTGATGTAGCCACATAAGGAGA
CATAGGTTATAAACTAGTTATCTTTTAAAAGGCTCAGCAACACAACTCTTGAAATGCTTATCAGGATAATGGTAGCTATAGCTGGCCATT
TAGAGGAATTCTAGGACAGTGGGAGCTGTGTTACTAGCACTATATAATTCCGGTCAGTGCTGACAAATAACATTTAACAAGTATTGCAGT
AATCATCACTTACAGGTACCATTTATTTCAAAACAACTTTTTTAGTCTGCTCCAAAGTTAAAATAATTAACTAGCTAAGCATTATTATTC
GACTGGTCTAAAAACTATTGTTATCTTTTTTTTTTCCTTTTCACTGTTATGGCCTTTTCACATTTCTAAATCCCATCTTGATATACTATG
AATACTCTAGAATGATGTAAAGCAGATAGGAATGTATGTGTACATATTTATTGCATACTTGCACATCAAATCGATGTACATAGTTTAACA
CGTGGTCCTTTTGTGAAACCTAGAACTCAGAGGATTGCTTTTTTTCTTTCAGCCTATTTTGAGTTAACTTCAGTGCTTTCTTAGGGAAAT
GACAGGGCAAAGCAATTTTTCTGTTGGCTTTGGGCTGTATTTGTGCACTAAATCTTTATTCTAAAAAAAAAAATGGAAACTTTAATTTTT
TTAAAACGAGAATTTCATTTACAGCTACATTAAAATCTTAATGAGAAAAATAATTTATAACCCTGTGGGTGTTCTGTCTTTAATATTGTA
TTATCAAATATAGGACAGTAAAACCATAGATTTTATATACACACGTGCTATATAATAACACCCAGAGTCATTCTTTCAAGACTAGTATTC
TCACATATTGAGAATATTCATTCTAAATATTAAAGTAAAAATGCCGGGAGTCAGGCATGATTGCAAAGTGAACTGCATTATAAACTACAT
CTTTACAGAGTGATGTATTAAGAGGGTTAAAGGAGCTTATAATTTATTTAACCGAGGGACTCAGTTGCTATATATATAGTCAGTAAAACA
CTCCATATAAAAATAAGATTCTAAAAGTGCTTCAGAAAGAGACCACCATTAGCAGGCTCTCAGGGAGAAGATGAAAGGATGGGGTTCAAA
TTGTGAAGCTGACAACTTTTCATGTTTTACAATTAGTCTAAGAGACCACTTCTTGGCTAAATTATTATATCAAATATATTCAAATCATAT
TCTTAAACTCATCGAGCCATTTGAACAAAAATTATTTTTGTTTAGCTTCATGAGTATCTTTGGAAAATAATTTGTTGAATATATATGATT
ATGAGATATTTTCTGATAAACACTGAATTTTGAAACCTGAACTCACTATATAATTGCAGTGTTTTGAAGGCCTGCATCCATTAGCATTGC
ATTATATTCACACTGCCTTTTTTAGTGAACCAAGACCCATCTTCTGGACGACAGATTTATCTTAAGATGAAAGGTTGTATAACATGCCCA
CAAGGCATAAAAATGTTAATGATGCAAGTAAGTTCTAAGAGTTTAATGACCAAGCAAAACTCTACCACCAGATGCTGACTGCTTGTTTTG
CAGTGTTCAGGAAACACCATTTTCCTGGCTCTTAACGCTTTTGTATTGGTATGGAAAAGGGCTGGCAGCTATAGAACAGGAGATCCATAG
CATTTTGAACAGAAGTATCTGGAATCTCACTGACTCGTGTGTTATCAAAGCTATATCAGGCCTGGGTGACTGAATTCTTGCAGAAAGCAG
TGTAGTGGCCACCATCCAAATCACCAAAATGGTTCTATGGGAGAAAGGAATGTCAAACTTAGTATTCACATATGAACACTAACTACTGGA
ACAGAAATGATAGGGCCAAGAGATGCTTTTTAAATTGTCCCTTATTCTAAATTAAAAGGAAGTGATAATTTTGTTGTTAAATCATGCATA
TAGCCTGACTGCTATATTGCTTCTCATTTCATTGTAACTACTTATATGTTGTGCCCATTGACTATCATCTGTGAATAAAGAAAGACAATA

>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000396444_chr15_50751197_+_8470nt
AAGAGCAAAAAGCGAAGGCGCAATCTGGACACTGGGAGATTCGGAGCGCAGGGAGTTTGAGAGAAACTTTTATTTTGAAGAGACCAAGGT
TGAGGGGGGGCTTATTTCCTGACAGCTATTTACTTAGAGCAAATGATTAGTTTTAGAAGGATGGACTATAACATTGAATCAATTACAAAA
CGCGGTTTTTGAGCCCATTACTGTTGGAGCTACAGGGAGAGAAACAGAGGAGGAGACTGCAAGAGATCATTGGAGGCCGTGGGCACGCTC
TTTACTCCATGTGTGGGACATTCATTGCGGAATAACATCGGAGGAGAAGTTTCCCAGAGCTATGGGGACTTCCCATCCGGCGTTCCTGGT
CTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATCCTTCCAAATGAAAATGAAAAGGTTGTGCA
GCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCCATGTCTGAAGAAGAGAGCTCCGATGTGGA
AATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCCTCGGCGGCCCACACAGGGTTGTACACTTG
CTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTATGTGCCAGACCCAGATGTAGCCTTTGTACC
TCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGTCGCACAACTGATCCCGAGACTCCTGTAAC
CTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGGACCTTCACTGTAGGGCCCTATATCTGTGA
GGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGCAACATCAGAGCTGGATCTAGAAATGGAAGC
TCTTAAAACCGTGTATAAGTCAGGGGAAACGATTGTGGTCACCTGTGCTGTTTTTAACAATGAGGTGGTTGACCTTCAATGGACTTACCC
TGGAGAAGTGAAAGGCAAAGGCATCACAATGCTGGAAGAAATCAAAGTCCCATCCATCAAATTGGTGTACACTTTGACGGTCCCCGAGGC
CACGGTGAAAGACAGTGGAGATTACGAATGTGCTGCCCGCCAGGCTACCAGGGAGGTCAAAGAAATGAAGAAAGTCACTATTTCTGTCCA
TGAGAAAGGTTTCATTGAAATCAAACCCACCTTCAGCCAGTTGGAAGCTGTCAACCTGCATGAAGTCAAACATTTTGTTGTAGAGGTGCG
GGCCTACCCACCTCCCAGGATATCCTGGCTGAAAAACAATCTGACTCTGATTGAAAATCTCACTGAGATCACCACTGATGTGGAAAAGAT
TCAGGAAATAAGGTATCGAAGCAAATTAAAGCTGATCCGTGCTAAGGAAGAAGACAGTGGCCATTATACTATTGTAGCTCAAAATGAAGA
TGCTGTGAAGAGCTATACTTTTGAACTGTTAACTCAAGTTCCTTCATCCATTCTGGACTTGGTCGATGATCACCATGGCTCAACTGGGGG
ACAGACGGTGAGGTGCACAGCTGAAGGCACGCCGCTTCCTGATATTGAGTGGATGATATGCAAAGATATTAAGAAATGTAATAATGAAAC
TTCCTGGACTATTTTGGCCAACAATGTCTCAAACATCATCACGGAGATCCACTCCCGAGACAGGAGTACCGTGGAGGGCCGTGTGACTTT
CGCCAAAGTGGAGGAGACCATCGCCGTGCGATGCCTGGCTAAGAATCTCCTTGGAGCTGAGAACCGAGAGCTGAAGCTGGTGGCTCCCAC
CCTGCGTTCTGAACTCACGGTGGCTGCTGCAGTCCTGGTGCTGTTGGTGATTGTGATCATCTCACTTATTGTCCTGGTTGTCATTTGGAA
ACAGAAACCGAGGTATGAAATTCGCTGGAGGGTCATTGAATCAATCAGCCCAGATGGACATGAATATATTTATGTGGACCCGATGCAGCT
GCCTTATGACTCAAGATGGGAGTTTCCAAGAGATGGACTAGTGCTTGGTCGGGTCTTGGGGTCTGGAGCGTTTGGGAAGGTGGTTGAAGG
AACAGCCTATGGATTAAGCCGGTCCCAACCTGTCATGAAAGTTGCAGTGAAGATGCTAAAACCCACGGCCAGATCCAGTGAAAAACAAGC
TCTCATGTCTGAACTGAAGATAATGACTCACCTGGGGCCACATTTGAACATTGTAAACTTGCTGGGAGCCTGCACCAAGTCAGGCCCCAT
TTACATCATCACAGAGTATTGCTTCTATGGAGATTTGGTCAACTATTTGCATAAGAATAGGGATAGCTTCCTGAGCCACCACCCAGAGAA
GCCAAAGAAAGAGCTGGATATCTTTGGATTGAACCCTGCTGATGAAAGCACACGGAGCTATGTTATTTTATCTTTTGAAAACAATGGTGA
CTACATGGACATGAAGCAGGCTGATACTACACAGTATGTCCCCATGCTAGAAAGGAAAGAGGTTTCTAAATATTCCGACATCCAGAGATC
ACTCTATGATCGTCCAGCCTCATATAAGAAGAAATCTATGTTAGACTCAGAAGTCAAAAACCTCCTTTCAGATGATAACTCAGAAGGCCT
TACTTTATTGGATTTGTTGAGCTTCACCTATCAAGTTGCCCGAGGAATGGAGTTTTTGGCTTCAAAAAATTGTGTCCACCGTGATCTGGC
TGCTCGCAACGTCCTCCTGGCACAAGGAAAAATTGTGAAGATCTGTGACTTTGGCCTGGCCAGAGACATCATGCATGATTCGAACTATGT
GTCGAAAGGCAGTACCTTTCTGCCCGTGAAGTGGATGGCTCCTGAGAGCATCTTTGACAACCTCTACACCACACTGAGTGATGTCTGGTC
TTATGGCATTCTGCTCTGGGAGATCTTTTCCCTTGGTGGCACCCCTTACCCCGGCATGATGGTGGATTCTACTTTCTACAATAAGATCAA
GAGTGGGTACCGGATGGCCAAGCCTGACCACGCTACCAGTGAAGTCTACGAGATCATGGTGAAATGCTGGAACAGTGAGCCGGAGAAGAG
ACCCTCCTTTTACCACCTGAGTGAGATTGTGGAGAATCTGCTGCCTGGACAATATAAAAAGAGTTATGAAAAAATTCACCTGGACTTCCT
GAAGAGTGACCATCCTGCTGTGGCACGCATGCGTGTGGACTCAGACAATGCATACATTGGTGTCACCTACAAAAACGAGGAAGACAAGCT
GAAGGACTGGGAGGGTGGTCTGGATGAGCAGAGACTGAGCGCTGACAGTGGCTACATCATTCCTCTGCCTGACATTGACCCTGTCCCTGA
GGAGGAGGACCTGGGCAAGAGGAACAGACACAGATATGAAGAAGCTGAAGTCCGGAAAAAACTTGAGGAAAAAGACAGGCAGGAGGAAGC
ACAGCGGCTACAACAAAAAAGGCAGGAAACAGGAAGAGAGGATGGTGGCACATTGGCTAAAGGCTCTTTGGAGAATGTTTTGGATTCCAA
AGACAAAACCCAAAAGAGCAATGGTGAAAAGAATGAAAAATGTGAGACCAAAGAGAAAGGAGCAATCACAGCAAAGGAACTATACACAAT
GATGACGGATAAAAACATCAGCTTGATTATAATGGATGCTCGAAGAATGCAGGATTATCAGGATTCCTGTATTTTACATTCTCTCAGTGT
TCCTGAAGAAGCCATCAGTCCAGGAGTCACTGCTAGTTGGATTGAAGCACACCTGCCAGATGATTCTAAAGACACATGGAAGAAGAGGGG
GAATGTGGAGTATGTGGTACTTCTTGACTGGTTTAGTTCTGCCAAAGATTTACAGATTGGAACAACTCTCCGGAGTCTGAAAGATGCACT
TTTCAAGTGGGAAAGTAAAACTGTCCTGCGCAATGAGCCTTTGGTTTTAGAGGGAGGCTATGAAAACTGGCTCCTTTGTTATCCCCAGTA
TACAACAAATGCTAAGGTCACTCCACCCCCACGACGCCAGAATGAAGAGGTGTCTATCTCATTGGATTTTACTTATCCCTCATTGGAAGA
ATCAATTCCTTCTAAACCTGCTGCCCAGACGCCACCTGCATCTATAGAAGTAGATGAAAATATAGAATTGATAAGTGGTCAAAATGAGAG
AATGGGACCACTGAATATATCAACTCCAGTTGAACCAGTTGCTGCTTCTAAATCTGATGTTTCACCCATAATTCAGCCAGTGCCTAGTAT
AAAGAATGTTCCACAGATTGATCGTACTAAAAAACCAGCAGTCAAATTGCCTGAAGAGCATAGAATAAAATCTGAAAGTACAAACCATGA
GCAGCAATCTCCTCAGAGTGGAAAAGTTATTCCTGATCGTTCCACCAAGCCAGTAGTTTTTTCTCCAACTCTCATGTTAACAGATGAAGA
AAAGGCTCGTATTCATGCAGAAACTGCTCTTCTAATGGAAAAAAACAAACAAGAAAAAGAACTTCGGGAAAGGCAGCAAGAGGAACAGAA
AGAGAAACTGAGGAAGGAAGAACAAGAACAAAAAGCCAAAAAGAAACAAGAAGCTGAAGAAAATGAAATTACAGAGAAGCAACAAAAAGC
AAAAGAAGAAATGGAGAAGAAAGAAAGTGAACAGGCCAAGAAAGAAGATAAAGAAACCTCAGCAAAGAGGGGCAAAGAAATAACAGGAGT
AAAAAGACAAAGTAAAAGTGAACATGAAACTTCTGATGCCAAGAAATCTGTAGAAGATAGGGGGAAAAGGTGTCCAACCCCAGAAATACA
GAAAAAGTCAACAGGAGATGTGCCCCATACATCTGTGACAGGGGATTCAGGTTCAGGCAAGCCATTTAAGATTAAAGGACAACCAGAAAG
TGGAATTCTAAGGACAGGAACTTTTAGAGAGGATACAGACGATACCGAAAGAAATAAAGCTCAACGAGAACCTTTGACAAGAGCACGAAG
TGAAGAAATGGGGAGGATCGTACCAGGACTGCCTTCAGGCTGGGCCAAGTTTCTTGACCCAATCACTGGAACCTTTCGTTATTATCATTC
ACCCACCAACACTGTTCATATGTACCCACCGGAAATGGCTCCTTCATCTGCACCTCCTTCCACCCCTCCAACTCATAAAGCCAAGCCACA
GATTCCTGCTGAGCGGGATAGGGAACCTTCCAAACTGAAGCGCTCCTACTCCTCCCCAGATATAACCCAGGCTATTCAAGAGGAAGAGAA
GAGGAAGCCAACAGTAACTCCAACAGTTAATCGGGAAAACAAGCCAACATGTTATCCTAAAGCTGAGATCTCAAGGCTTTCTGCTTCTCA
GATTCGGAACCTCAATCCTGTTTTTGGAGGTTCTGGACCAGCTCTTACTGGACTTCGTAACTTAGGAAATACTTGTTATATGAACTCAAT
ATTGCAGTGCCTATGTAACGCTCCACATTTGGCTGATTATTTCAACCGAAACTGTTATCAGGATGATATTAACAGGTCAAATTTGTTGGG
GCATAAAGGTGAAGTGGCAGAAGAATTTGGTATAATCATGAAAGCCCTGTGGACAGGACAGTATAGATATATCAGTCCAAAGGACTTTAA
AATCACCATTGGGAAGATCAATGACCAGTTTGCAGGATACAGTCAGCAAGATTCACAAGAATTGCTTCTGTTCCTAATGGATGGTCTCCA
TGAAGATCTAAATAAAGCTGATAATCGGAAGAGATATAAAGAAGAAAATAATGATCATCTCGATGACTTTAAAGCTGCAGAACATGCCTG
GCAGAAACACAAGCAGCTCAATGAGTCTATTATTGTTGCACTTTTTCAGGGTCAATTCAAATCTACAGTACAGTGCCTCACATGTCACAA
AAAGTCTAGGACATTTGAGGCCTTCATGTATTTGTCTCTACCACTAGCATCCACAAGTAAATGTACATTACAGGATTGCCTTAGATTATT
TTCCAAAGAAGAAAAACTCACAGATAACAACAGATTTTACTGCAGTCATTGCAGAGCTCGACGGGATTCTCTAAAAAAGATAGAAATCTG
GAAGTTACCACCTGTGCTTTTAGTGCATCTGAAACGTTTTTCCTACGATGGCAGGTGGAAACAAAAATTACAGACATCTGTGGACTTCCC
GTTAGAAAATCTTGACTTGTCACAGTATGTTATTGGTCCAAAGAACAATTTGAAGAAATATAATTTGTTTTCTGTTTCAAATCACTACGG
TGGGCTGGATGGAGGCCACTACACAGCCTATTGTAAAAATGCAGCAAGACAACGGTGGTTTAAGTTTGATGATCATGAAGTTTCTGATAT
CTCCGTTTCTTCTGTGAAATCTTCAGCAGCTTATATCCTCTTTTATACTTCATTGGGACCACGAGTAACTGATGTAGCCACATAAGGAGA
CATAGGTTATAAACTAGTTATCTTTTAAAAGGCTCAGCAACACAACTCTTGAAATGCTTATCAGGATAATGGTAGCTATAGCTGGCCATT
TAGAGGAATTCTAGGACAGTGGGAGCTGTGTTACTAGCACTATATAATTCCGGTCAGTGCTGACAAATAACATTTAACAAGTATTGCAGT
AATCATCACTTACAGGTACCATTTATTTCAAAACAACTTTTTTAGTCTGCTCCAAAGTTAAAATAATTAACTAGCTAAGCATTATTATTC
GACTGGTCTAAAAACTATTGTTATCTTTTTTTTTTCCTTTTCACTGTTATGGCCTTTTCACATTTCTAAATCCCATCTTGATATACTATG
AATACTCTAGAATGATGTAAAGCAGATAGGAATGTATGTGTACATATTTATTGCATACTTGCACATCAAATCGATGTACATAGTTTAACA
CGTGGTCCTTTTGTGAAACCTAGAACTCAGAGGATTGCTTTTTTTCTTTCAGCCTATTTTGAGTTAACTTCAGTGCTTTCTTAGGGAAAT
GACAGGGCAAAGCAATTTTTCTGTTGGCTTTGGGCTGTATTTGTGCACTAAATCTTTATTCTAAAAAAAAAAATGGAAACTTTAATTTTT
TTAAAACGAGAATTTCATTTACAGCTACATTAAAATCTTAATGAGAAAAATAATTTATAACCCTGTGGGTGTTCTGTCTTTAATATTGTA
TTATCAAATATAGGACAGTAAAACCATAGATTTTATATACACACGTGCTATATAATAACACCCAGAGTCATTCTTTCAAGACTAGTATTC
TCACATATTGAGAATATTCATTCTAAATATTAAAGTAAAAATGCCGGGAGTCAGGCATGATTGCAAAGTGAACTGCATTATAAACTACAT
CTTTACAGAGTGATGTATTAAGAGGGTTAAAGGAGCTTATAATTTATTTAACCGAGGGACTCAGTTGCTATATATATAGTCAGTAAAACA
CTCCATATAAAAATAAGATTCTAAAAGTGCTTCAGAAAGAGACCACCATTAGCAGGCTCTCAGGGAGAAGATGAAAGGATGGGGTTCAAA
TTGTGAAGCTGACAACTTTTCATGTTTTACAATTAGTCTAAGAGACCACTTCTTGGCTAAATTATTATATCAAATATATTCAAATCATAT
TCTTAAACTCATCGAGCCATTTGAACAAAAATTATTTTTGTTTAGCTTCATGAGTATCTTTGGAAAATAATTTGTTGAATATATATGATT
ATGAGATATTTTCTGATAAACACTGAATTTTGAAACCTGAACTCACTATATAATTGCAGTGTTTTGAAGGCCTGCATCCATTAGCATTGC
ATTATATTCACACTGCCTTTTTTAGTGAACCAAGACCCATCTTCTGGACGACAGATTTATCTTAAGATGAAAGGTTGTATAACATGCCCA
CAAGGCATAAAAATGTTAATGATGCAAGTAAGTTCTAAGAGTTTAATGACCAAGCAAAACTCTACCACCAGATGCTGACTGCTTGTTTTG
CAGTGTTCAGGAAACACCATTTTCCTGGCTCTTAACGCTTTTGTATTGGTATGGAAAAGGGCTGGCAGCTATAGAACAGGAGATCCATAG
CATTTTGAACAGAAGTATCTGGAATCTCACTGACTCGTGTGTTATCAAAGCTATATCAGGCCTGGGTGACTGAATTCTTGCAGAAAGCAG
TGTAGTGGCCACCATCCAAATCACCAAAATGGTTCTATGGGAGAAAGGAATGTCAAACTTAGTATTCACATATGAACACTAACTACTGGA
ACAGAAATGATAGGGCCAAGAGATGCTTTTTAAATTGTCCCTTATTCTAAATTAAAAGGAAGTGATAATTTTGTTGTTAAATCATGCATA
TAGCCTGACTGCTATATTGCTTCTCATTTCATTGTAACTACTTATATGTTGTGCCCATTGACTATCATCTGTGAATAAAGAAAGACAATA

>In-frame_PDGFRA_ENST00000257290_chr4_55156721_+_USP8_ENST00000425032_chr15_50751197_+_6715nt
AAGAGCAAAAAGCGAAGGCGCAATCTGGACACTGGGAGATTCGGAGCGCAGGGAGTTTGAGAGAAACTTTTATTTTGAAGAGACCAAGGT
TGAGGGGGGGCTTATTTCCTGACAGCTATTTACTTAGAGCAAATGATTAGTTTTAGAAGGATGGACTATAACATTGAATCAATTACAAAA
CGCGGTTTTTGAGCCCATTACTGTTGGAGCTACAGGGAGAGAAACAGAGGAGGAGACTGCAAGAGATCATTGGAGGCCGTGGGCACGCTC
TTTACTCCATGTGTGGGACATTCATTGCGGAATAACATCGGAGGAGAAGTTTCCCAGAGCTATGGGGACTTCCCATCCGGCGTTCCTGGT
CTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATCCTTCCAAATGAAAATGAAAAGGTTGTGCA
GCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCCATGTCTGAAGAAGAGAGCTCCGATGTGGA
AATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCCTCGGCGGCCCACACAGGGTTGTACACTTG
CTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTATGTGCCAGACCCAGATGTAGCCTTTGTACC
TCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGTCGCACAACTGATCCCGAGACTCCTGTAAC
CTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGGACCTTCACTGTAGGGCCCTATATCTGTGA
GGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGCAACATCAGAGCTGGATCTAGAAATGGAAGC
TCTTAAAACCGTGTATAAGTCAGGGGAAACGATTGTGGTCACCTGTGCTGTTTTTAACAATGAGGTGGTTGACCTTCAATGGACTTACCC
TGGAGAAGTGAAAGGCAAAGGCATCACAATGCTGGAAGAAATCAAAGTCCCATCCATCAAATTGGTGTACACTTTGACGGTCCCCGAGGC
CACGGTGAAAGACAGTGGAGATTACGAATGTGCTGCCCGCCAGGCTACCAGGGAGGTCAAAGAAATGAAGAAAGTCACTATTTCTGTCCA
TGAGAAAGGTTTCATTGAAATCAAACCCACCTTCAGCCAGTTGGAAGCTGTCAACCTGCATGAAGTCAAACATTTTGTTGTAGAGGTGCG
GGCCTACCCACCTCCCAGGATATCCTGGCTGAAAAACAATCTGACTCTGATTGAAAATCTCACTGAGATCACCACTGATGTGGAAAAGAT
TCAGGAAATAAGGTATCGAAGCAAATTAAAGCTGATCCGTGCTAAGGAAGAAGACAGTGGCCATTATACTATTGTAGCTCAAAATGAAGA
TGCTGTGAAGAGCTATACTTTTGAACTGTTAACTCAAGTTCCTTCATCCATTCTGGACTTGGTCGATGATCACCATGGCTCAACTGGGGG
ACAGACGGTGAGGTGCACAGCTGAAGGCACGCCGCTTCCTGATATTGAGTGGATGATATGCAAAGATATTAAGAAATGTAATAATGAAAC
TTCCTGGACTATTTTGGCCAACAATGTCTCAAACATCATCACGGAGATCCACTCCCGAGACAGGAGTACCGTGGAGGGCCGTGTGACTTT
CGCCAAAGTGGAGGAGACCATCGCCGTGCGATGCCTGGCTAAGAATCTCCTTGGAGCTGAGAACCGAGAGCTGAAGCTGGTGGCTCCCAC
CCTGCGTTCTGAACTCACGGTGGCTGCTGCAGTCCTGGTGCTGTTGGTGATTGTGATCATCTCACTTATTGTCCTGGTTGTCATTTGGAA
ACAGAAACCGAGGTATGAAATTCGCTGGAGGGTCATTGAATCAATCAGCCCAGATGGACATGAATATATTTATGTGGACCCGATGCAGCT
GCCTTATGACTCAAGATGGGAGTTTCCAAGAGATGGACTAGTGCTTGGTCGGGTCTTGGGGTCTGGAGCGTTTGGGAAGGTGGTTGAAGG
AACAGCCTATGGATTAAGCCGGTCCCAACCTGTCATGAAAGTTGCAGTGAAGATGCTAAAACCCACGGCCAGATCCAGTGAAAAACAAGC
TCTCATGTCTGAACTGAAGATAATGACTCACCTGGGGCCACATTTGAACATTGTAAACTTGCTGGGAGCCTGCACCAAGTCAGGCCCCAT
TTACATCATCACAGAGTATTGCTTCTATGGAGATTTGGTCAACTATTTGCATAAGAATAGGGATAGCTTCCTGAGCCACCACCCAGAGAA
GCCAAAGAAAGAGCTGGATATCTTTGGATTGAACCCTGCTGATGAAAGCACACGGAGCTATGTTATTTTATCTTTTGAAAACAATGGTGA
CTACATGGACATGAAGCAGGCTGATACTACACAGTATGTCCCCATGCTAGAAAGGAAAGAGGTTTCTAAATATTCCGACATCCAGAGATC
ACTCTATGATCGTCCAGCCTCATATAAGAAGAAATCTATGTTAGACTCAGAAGTCAAAAACCTCCTTTCAGATGATAACTCAGAAGGCCT
TACTTTATTGGATTTGTTGAGCTTCACCTATCAAGTTGCCCGAGGAATGGAGTTTTTGGCTTCAAAAAATTGTGTCCACCGTGATCTGGC
TGCTCGCAACGTCCTCCTGGCACAAGGAAAAATTGTGAAGATCTGTGACTTTGGCCTGGCCAGAGACATCATGCATGATTCGAACTATGT
GTCGAAAGGCAGTACCTTTCTGCCCGTGAAGTGGATGGCTCCTGAGAGCATCTTTGACAACCTCTACACCACACTGAGTGATGTCTGGTC
TTATGGCATTCTGCTCTGGGAGATCTTTTCCCTTGGTGGCACCCCTTACCCCGGCATGATGGTGGATTCTACTTTCTACAATAAGATCAA
GAGTGGGTACCGGATGGCCAAGCCTGACCACGCTACCAGTGAAGTCTACGAGATCATGGTGAAATGCTGGAACAGTGAGCCGGAGAAGAG
ACCCTCCTTTTACCACCTGAGTGAGATTGTGGAGAATCTGCTGCCTGGACAATATAAAAAGAGTTATGAAAAAATTCACCTGGACTTCCT
GAAGAGTGACCATCCTGCTGTGGCACGCATGCGTGTGGACTCAGACAATGCATACATTGGTGTCACCTACAAAAACGAGGAAGACAAGCT
GAAGGACTGGGAGGGTGGTCTGGATGAGCAGAGACTGAGCGCTGACAGTGGCTACATCATTCCTCTGCCTGACATTGACCCTGTCCCTGA
GGAGGAGGACCTGGGCAAGAGGAACAGACACAGATATGAAGAAGCTGAAGTCCGGAAAAAACTTGAGGAAAAAGACAGGCAGGAGGAAGC
ACAGCGGCTACAACAAAAAAGGCAGGAAACAGGAAGAGAGGATGGTGGCACATTGGCTAAAGGCTCTTTGGAGAATGTTTTGGATTCCAA
AGACAAAACCCAAAAGAGCAATGGTGAAAAGAATGAAAAATGTGAGACCAAAGAGAAAGGAGCAATCACAGCAAAGGAACTATACACAAT
GATGACGGATAAAAACATCAGCTTGATTATAATGGATGCTCGAAGAATGCAGGATTATCAGGATTCCTGTATTTTACATTCTCTCAGTGT
TCCTGAAGAAGCCATCAGTCCAGGAGTCACTGCTAGTTGGATTGAAGCACACCTGCCAGATGATTCTAAAGACACATGGAAGAAGAGGGG
GAATGTGGAGTATGTGGTACTTCTTGACTGGTTTAGTTCTGCCAAAGATTTACAGATTGGAACAACTCTCCGGAGTCTGAAAGATGCACT
TTTCAAGTGGGAAAGTAAAACTGTCCTGCGCAATGAGCCTTTGGTTTTAGAGGGAGGCTATGAAAACTGGCTCCTTTGTTATCCCCAGTA
TACAACAAATGCTAAGGTCACTCCACCCCCACGACGCCAGAATGAAGAGGTGTCTATCTCATTGGATTTTACTTATCCCTCATTGGAAGA
ATCAATTCCTTCTAAACCTGCTGCCCAGACGCCACCTGCATCTATAGAAGTAGATGAAAATATAGAATTGATAAGTGGTCAAAATGAGAG
AATGGGACCACTGAATATATCAACTCCAGTTGAACCAGTTGCTGCTTCTAAATCTGATGTTTCACCCATAATTCAGCCAGTGCCTAGTAT
AAAGAATGTTCCACAGATTGATCGTACTAAAAAACCAGCAGTCAAATTGCCTGAAGAGCATAGAATAAAATCTGAAAGTACAAACCATGA
GCAGCAATCTCCTCAGAGTGGAAAAGTTATTCCTGATCGTTCCACCAAGCCAGTAGTTTTTTCTCCAACTCTCATGTTAACAGATGAAGA
AAAGGCTCGTATTCATGCAGAAACTGCTCTTCTAATGGAAAAAAACAAACAAGAAAAAGAACTTCGGGAAAGGCAGCAAGAGGAACAGAA
AGAGAAACTGAGGAAGGAAGAACAAGAACAAAAAGCCAAAAAGAAACAAGAAGCTGAAGAAAATGAAATTACAGAGAAGCAACAAAAAGC
AAAAGAAGAAATGGAGAAGAAAGAAAGTGAACAGGCCAAGAAAGAAGATAAAGAAACCTCAGCAAAGAGGGGCAAAGAAATAACAGGAGT
AAAAAGACAAAGTAAAAGTGAACATGAAACTTCTGATGCCAAGAAATCTGTAGAAGATAGGGGGAAAAGGTGTCCAACCCCAGAAATACA
GAAAAAGTCAACAGGAGATGTGCCCCATACATCTGTGACAGGGGATTCAGGTTCAGGCAAGGCTCAACGAGAACCTTTGACAAGAGCACG
AAGTGAAGAAATGGGGAGGATCGTACCAGGACTGCCTTCAGGCTGGGCCAAGTTTCTTGACCCAATCACTGGAACCTTTCGTTATTATCA
TTCACCCACCAACACTGTTCATATGTACCCACCGGAAATGGCTCCTTCATCTGCACCTCCTTCCACCCCTCCAACTCATAAAGCCAAGCC
ACAGATTCCTGCTGAGCGGGATAGGGAACCTTCCAAACTGAAGCGCTCCTACTCCTCCCCAGATATAACCCAGGCTATTCAAGAGGAAGA
GAAGAGGAAGCCAACAGTAACTCCAACAGTTAATCGGGAAAACAAGCCAACATGTTATCCTAAAGCTGAGATCTCAAGGCTTTCTGCTTC
TCAGATTCGGAACCTCAATCCTGTTTTTGGAGGTTCTGGACCAGCTCTTACTGGACTTCGTAACTTAGGAAATACTTGTTATATGAACTC
AATATTGCAGTGCCTATGTAACGCTCCACATTTGGCTGATTATTTCAACCGAAACTGTTATCAGGATGATATTAACAGGTCAAATTTGTT
GGGGCATAAAGGTGAAGTGGCAGAAGAATTTGGTATAATCATGAAAGCCCTGTGGACAGGACAGTATAGATATATCAGTCCAAAGGACTT
TAAAATCACCATTGGGAAGATCAATGACCAGTTTGCAGGATACAGTCAGCAAGATTCACAAGAATTGCTTCTGTTCCTAATGGATGGTCT
CCATGAAGATCTAAATAAAGCTGATAATCGGAAGAGATATAAAGAAGAAAATAATGATCATCTCGATGACTTTAAAGCTGCAGAACATGC
CTGGCAGAAACACAAGCAGCTCAATGAGTCTATTATTGTTGCACTTTTTCAGGGTCAATTCAAATCTACAGTACAGTGCCTCACATGTCA
CAAAAAGTCTAGGACATTTGAGGCCTTCATGTATTTGTCTCTACCACTAGCATCCACAAGTAAATGTACATTACAGGATTGCCTTAGATT
ATTTTCCAAAGAAGAAAAACTCACAGATAACAACAGATTTTACTGCAGTCATTGCAGAGCTCGACGGGATTCTCTAAAAAAGATAGAAAT
CTGGAAGTTACCACCTGTGCTTTTAGTGCATCTGAAACGTTTTTCCTACGATGGCAGGTGGAAACAAAAATTACAGACATCTGTGGACTT
CCCGTTAGAAAATCTTGACTTGTCACAGTATGTTATTGGTCCAAAGAACAATTTGAAGAAATATAATTTGTTTTCTGTTTCAAATCACTA
CGGTGGGCTGGATGGAGGCCACTACACAGCCTATTGTAAAAATGCAGCAAGACAACGGTGGTTTAAGTTTGATGATCATGAAGTTTCTGA
TATCTCCGTTTCTTCTGTGAAATCTTCAGCAGCTTATATCCTCTTTTATACTTCATTGGGACCACGAGTAACTGATGTAGCCACATAAGG
AGACATAGGTTATAAACTAGTTATCTTTTAAAAGGCTCAGCAACACAACTCTTGAAATGCTTATCAGGATAATGGTAGCTATAGCTGGCC
ATTTAGAGGAATTCTAGGACAGTGGGAGCTGTGTTACTAGCACTATATAATTCCGGTCAGTGCTGACAAATAACATTTAACAAGTATTGC
AGTAATCATCACTTACAGGTACCATTTATTTCAAAACAACTTTTTTAGTCTGCTCCAAAGTTAAAATAATTAACTAGCTAAGCATTATTA


Top

FusionGenePPI for PDGFRA_USP8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PDGFRACBL, PDGFA, PDGFB, PDGFC, PDGFRB, PDGFRA, CRKL, CRK, GRB2, PLCG1, SLC9A3R1, ITGB3, CAV1, CAV3, SNX6, SNX2, SNX4, PTEN, PIK3R1, KIT, FBXO25, ULBP2, TGFBR2, SRPK1, CCDC155, EGFR, NTRK1, CLU, DSG2, H3F3A, MYO1C, NRD1, THOC5, TFRC, TNK1, FARP1, FLOT1, RNPS1, SCFD1, PPIL2, PACSIN3, WDR74, PRKRIP1, RAB11FIP1, MAK16, PHLDB2, STAT3, STAT1, SMURF1, DNM2, PTPN11, BRCA1, MTOR, TOP1, VHL, RRM2, CDK9, SHF, RASA1, PIK3CAUSP8YWHAB, YWHAZ, YWHAQ, SFN, RNF41, OTUB1, RNF128, STAM2, STAM, GRB2, KIF23, BIRC6, KRT31, KRT85, KRT36, USP22, RPL6P1, AKT1, EPS15, EGFR, CHMP1B, CHMP1A, CHMP4C, CHMP7, KCNN4, YWHAG, SPP1, NBR1, USP8, UBC, CHMP2A, CHMP2B, GRAP2, PJA1, TRIM63, TRIM55, TRIM54, USP21, USP15, USP28, UBE2I, UBE2G1, FARSB, VPS4B, SRC, ERBB4, YWHAE, PTPN23, HTT, POLD3, STAT6, TSEN2, PTEN, LRIG1, TARDBP, VAMP8, PLA2G2A, SCNN1A, SCNN1B, SCNN1G, MCPH1, ACAA2, TATDN1, UBE2E1, NTRK1, HIST2H2AC, HIST2H2BE, C10orf76, PTAR1, BACE1, SNCA, CFLAR, CDH1, CD83, CBY1, RAB3IP, MAGEL2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PDGFRA_USP8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePDGFRAP16234DB00619ImatinibPlatelet-derived growth factor receptor alphasmall moleculeapproved
HgenePDGFRAP16234DB06589PazopanibPlatelet-derived growth factor receptor alphasmall moleculeapproved
HgenePDGFRAP16234DB08896RegorafenibPlatelet-derived growth factor receptor alphasmall moleculeapproved
HgenePDGFRAP16234DB00102BecaplerminPlatelet-derived growth factor receptor alphabiotechapproved|investigational
HgenePDGFRAP16234DB01268SunitinibPlatelet-derived growth factor receptor alphasmall moleculeapproved|investigational
HgenePDGFRAP16234DB08901PonatinibPlatelet-derived growth factor receptor alphasmall moleculeapproved|investigational

Top

RelatedDiseases for PDGFRA_USP8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePDGFRAC0238198Gastrointestinal Stromal Tumors2CTD_human;HPO;ORPHANET;UNIPROT
HgenePDGFRAC0008925Cleft Palate1CTD_human
HgenePDGFRAC0015923Fetal Alcohol Syndrome1PSYGENET
HgenePDGFRAC0023893Liver Cirrhosis, Experimental1CTD_human
HgenePDGFRAC0024115Lung diseases1CTD_human
HgenePDGFRAC0025149Medulloblastoma1CTD_human
HgenePDGFRAC0035238Congenital abnormality of respiratory system1CTD_human
HgenePDGFRAC0080178Spina Bifida1CTD_human
HgenePDGFRAC0206637Chondrosarcoma, Mesenchymal1CTD_human
HgenePDGFRAC0376634Craniofacial Abnormalities1CTD_human
HgenePDGFRAC1540912Hypereosinophilic syndrome1CTD_human
HgenePDGFRAC2985290Fetal Alcohol Spectrum Disorders1PSYGENET
TgeneUSP8C0221406Pituitary-dependent Cushing's disease1CTD_human;ORPHANET
TgeneUSP8C1306214ACTH-Secreting Pituitary Adenoma1CTD_human