FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26443

FusionGeneSummary for PDE9A_DHRS7

check button Fusion gene summary
Fusion gene informationFusion gene name: PDE9A_DHRS7
Fusion gene ID: 26443
HgeneTgene
Gene symbol

PDE9A

DHRS7

Gene ID

5152

51635

Gene namephosphodiesterase 9Adehydrogenase/reductase 7
SynonymsHSPDE9A2CGI-86|SDR34C1|retDSR4|retSDR4
Cytomap

21q22.3

14q23.1

Type of geneprotein-codingprotein-coding
Descriptionhigh affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9ACGMP-specific 3',5'-cyclic phosphodiesterase type 9phosphodiesterase PDE9A21dehydrogenase/reductase SDR family member 7dehydrogenase/reductase (SDR family) member 7retinal short-chain dehydrogenase/reductase 4short chain dehydrogenase/reductase family 34C member 1
Modification date2018051920180519
UniProtAcc

O76083

Q9Y394

Ensembl transtripts involved in fusion geneENST00000335512, ENST00000539837, 
ENST00000470987, ENST00000291539, 
ENST00000398236, ENST00000398229, 
ENST00000398234, ENST00000398232, 
ENST00000398227, ENST00000398225, 
ENST00000380328, ENST00000328862, 
ENST00000335440, ENST00000398224, 
ENST00000349112, 
ENST00000216500, 
ENST00000557185, ENST00000536410, 
ENST00000553986, 
Fusion gene scores* DoF score6 X 4 X 4=961 X 1 X 1=1
# samples 61
** MAII scorelog2(6/96*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: PDE9A [Title/Abstract] AND DHRS7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePDE9A

GO:0046068

cGMP metabolic process

9624146

HgenePDE9A

GO:0046069

cGMP catabolic process

25799991


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HT-7603-01APDE9Achr21

44153536

+DHRS7chr14

60622870

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000335512ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000335512ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000335512ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000335512ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000539837ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000539837ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000539837ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000539837ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
3UTR-3CDSENST00000470987ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
3UTR-3CDSENST00000470987ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
3UTR-5UTRENST00000470987ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
3UTR-intronENST00000470987ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000291539ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000291539ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000291539ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000291539ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398236ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398236ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000398236ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000398236ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398229ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398229ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000398229ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000398229ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398234ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398234ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000398234ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000398234ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398232ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398232ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000398232ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000398232ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398227ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398227ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000398227ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000398227ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398225ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398225ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000398225ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000398225ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000380328ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000380328ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000380328ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000380328ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000328862ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000328862ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000328862ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000328862ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000335440ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000335440ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000335440ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000335440ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398224ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000398224ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000398224ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000398224ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000349112ENST00000216500PDE9Achr21

44153536

+DHRS7chr14

60622870

-
In-frameENST00000349112ENST00000557185PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-5UTRENST00000349112ENST00000536410PDE9Achr21

44153536

+DHRS7chr14

60622870

-
5CDS-intronENST00000349112ENST00000553986PDE9Achr21

44153536

+DHRS7chr14

60622870

-

Top

FusionProtFeatures for PDE9A_DHRS7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PDE9A

O76083

DHRS7

Q9Y394


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDHRS7chr21:44153536chr14:60622870ENST00000216500-1854_7844340Nucleotide bindingNAD
TgeneDHRS7chr21:44153536chr14:60622870ENST00000536410-0754_78-6290Nucleotide bindingNAD
TgeneDHRS7chr21:44153536chr14:60622870ENST00000557185-0754_7844340Nucleotide bindingNAD

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDE9Achr21:44153536chr14:60622870ENST00000291539+720236_557189594DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000328862+619236_557163568DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000335440+417236_55787492DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000335512+619236_557129534DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000349112+316236_55761466DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000380328+619236_557136541DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000398224+417236_55762467DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000398225+619236_557148553DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000398227+215236_55729434DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000398229+316236_55755460DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000398232+518236_557122527DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000398234+518236_55788493DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000398236+518236_557103508DomainPDEase
HgenePDE9Achr21:44153536chr14:60622870ENST00000291539+720312_316189594Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000291539+720512_513189594Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000328862+619312_316163568Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000328862+619512_513163568Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000335440+417312_31687492Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000335440+417512_51387492Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000335512+619312_316129534Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000335512+619512_513129534Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000349112+316312_31661466Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000349112+316512_51361466Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000380328+619312_316136541Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000380328+619512_513136541Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398224+417312_31662467Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398224+417512_51362467Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398225+619312_316148553Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398225+619512_513148553Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398227+215312_31629434Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398227+215512_51329434Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398229+316312_31655460Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398229+316512_51355460Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398232+518312_316122527Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398232+518512_513122527Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398234+518312_31688493Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398234+518512_51388493Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398236+518312_316103508Nucleotide bindingcGMP
HgenePDE9Achr21:44153536chr14:60622870ENST00000398236+518512_513103508Nucleotide bindingcGMP


Top

FusionGeneSequence for PDE9A_DHRS7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PDE9A_ENST00000335512_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_425aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSERE
ELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCL
ENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKI
VTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLI

>In-frame_PDE9A_ENST00000335512_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_425aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSERE
ELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCL
ENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKI
VTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLI

>In-frame_PDE9A_ENST00000539837_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_357aa
MDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKL
GVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNY
LGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKT

>In-frame_PDE9A_ENST00000539837_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_357aa
MDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKL
GVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNY
LGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKT

>In-frame_PDE9A_ENST00000291539_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_485aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSAGV
EDKRTTSRGQSAERPLRDRRVVGLEQPRREGAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAV
LQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFN
GLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYMPTWA

>In-frame_PDE9A_ENST00000291539_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_485aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSAGV
EDKRTTSRGQSAERPLRDRRVVGLEQPRREGAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAV
LQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFN
GLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYMPTWA

>In-frame_PDE9A_ENST00000398236_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_399aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAE
VANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAA
TKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALR
GFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYM

>In-frame_PDE9A_ENST00000398236_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_399aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAE
VANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAA
TKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALR
GFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYM

>In-frame_PDE9A_ENST00000398229_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_351aa
MDAFRRNTTISLLTTDDAMVSIDPTMPANSERAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVL
SARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSL
TKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGD

>In-frame_PDE9A_ENST00000398229_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_351aa
MDAFRRNTTISLLTTDDAMVSIDPTMPANSERAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVL
SARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSL
TKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGD

>In-frame_PDE9A_ENST00000398234_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_384aa
MDAFRRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_W
ELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILV
NNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPG
IIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYMPTWAWWITNKMGKKR

>In-frame_PDE9A_ENST00000398234_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_384aa
MDAFRRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_W
ELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILV
NNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPG
IIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYMPTWAWWITNKMGKKR

>In-frame_PDE9A_ENST00000398232_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_418aa
MDAFRSTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRREGAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVL
AQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKE
KDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSIL
GIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLK

>In-frame_PDE9A_ENST00000398232_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_418aa
MDAFRSTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRREGAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVL
AQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKE
KDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSIL
GIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLK

>In-frame_PDE9A_ENST00000398227_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_325aa
MDAFRRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDI
LVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGII
SVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVW

>In-frame_PDE9A_ENST00000398227_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_325aa
MDAFRRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDI
LVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGII
SVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVW

>In-frame_PDE9A_ENST00000398225_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_444aa
MDAFRRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRREGAFESGQVEPR
PREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVS
LVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGT
VSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGN

>In-frame_PDE9A_ENST00000398225_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_444aa
MDAFRRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRREGAFESGQVEPR
PREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVS
LVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGT
VSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGN

>In-frame_PDE9A_ENST00000380328_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_432aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERNELILTTSLRNLLFLPS
KESWASHQHSVQSETCGHQATLRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELE
RVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMI
ERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSR

>In-frame_PDE9A_ENST00000380328_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_432aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERNELILTTSLRNLLFLPS
KESWASHQHSVQSETCGHQATLRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELE
RVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMI
ERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSR

>In-frame_PDE9A_ENST00000328862_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_459aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQ
PRREGAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSG
IGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTS
LDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNI
VENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYMPTWAWWITNKMGKKRIENFKSGVDADSSTF

>In-frame_PDE9A_ENST00000328862_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_459aa
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQ
PRREGAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSG
IGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTS
LDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNI
VENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYMPTWAWWITNKMGKKRIENFKSGVDADSSTF

>In-frame_PDE9A_ENST00000335440_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_383aa
MGSGSSSYRPKAIYLDIDGRIQKEHDHLPADHRRRHGLHRPHHAREFRTHSVQSETCGHQATLRAFKINELKAEVANHLAVLEKRVE_WE
LTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVN
NGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGI
IVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYMPTWAWWITNKMGKKRI

>In-frame_PDE9A_ENST00000335440_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_383aa
MGSGSSSYRPKAIYLDIDGRIQKEHDHLPADHRRRHGLHRPHHAREFRTHSVQSETCGHQATLRAFKINELKAEVANHLAVLEKRVE_WE
LTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVN
NGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGI
IVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTTLWQYMPTWAWWITNKMGKKRI

>In-frame_PDE9A_ENST00000398224_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_358aa
MDAFRSTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSK
LGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELN
YLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTK

>In-frame_PDE9A_ENST00000398224_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_358aa
MDAFRSTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSK
LGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELN
YLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTK

>In-frame_PDE9A_ENST00000349112_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_357aa
MGSGSSSYRPKAIYLDIDGRIQKHSVQSETCGHQATLRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKL
GVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNY
LGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKT

>In-frame_PDE9A_ENST00000349112_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_357aa
MGSGSSSYRPKAIYLDIDGRIQKHSVQSETCGHQATLRAFKINELKAEVANHLAVLEKRVE_WELTDMVVWVTGASSGIGEELAYQLSKL
GVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNY
LGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PDE9A_ENST00000335512_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1275nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATG
GTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAA
GAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCAC
TTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAG
CTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTA
GAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTT
CTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTAC
AGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATT
GTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAAT
GGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCC
CTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATC
AGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCC
TGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAG

>In-frame_PDE9A_ENST00000335512_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1275nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATG
GTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAA
GAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCAC
TTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAG
CTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTA
GAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTT
CTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTAC
AGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATT
GTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAAT
GGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCC
CTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATC
AGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCC
TGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAG

>In-frame_PDE9A_ENST00000539837_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1071nt
ATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCC
ACCATGCCCGCGAATTCAGAACGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTG
GAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTA
GGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAA
GATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGAC
ATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTAC
TTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGT
ATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACA
TACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACT
ATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAA
GTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGG

>In-frame_PDE9A_ENST00000539837_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1071nt
ATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCC
ACCATGCCCGCGAATTCAGAACGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTG
GAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTA
GGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAA
GATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGAC
ATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTAC
TTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGT
ATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACA
TACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACT
ATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAA
GTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGG

>In-frame_PDE9A_ENST00000291539_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1455nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATG
GTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTC
GAGGACAAGAGAACCACAAGCCGTGGCCAGTCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAA
GGAGCATTTGAAAGTGGACAGGTAGAGCCCAGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAA
GAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCAC
TTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAG
CTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTA
GAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTT
CTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTAC
AGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATT
GTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAAT
GGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCC
CTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATC
AGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCC
TGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAG

>In-frame_PDE9A_ENST00000291539_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1455nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATG
GTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTC
GAGGACAAGAGAACCACAAGCCGTGGCCAGTCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAA
GGAGCATTTGAAAGTGGACAGGTAGAGCCCAGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAA
GAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCAC
TTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAG
CTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTA
GAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTT
CTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTAC
AGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATT
GTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAAT
GGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCC
CTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATC
AGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCC
TGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAG

>In-frame_PDE9A_ENST00000398236_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1197nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTC
TCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAA
GTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGA
ATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAA
AGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCT
ACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGC
TTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAG
CAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGG
GGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATT
GTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGG
CTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATG
CCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTT

>In-frame_PDE9A_ENST00000398236_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1197nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTC
TCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAA
GTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGA
ATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAA
AGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCT
ACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGC
TTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAG
CAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGG
GGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATT
GTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGG
CTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATG
CCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTT

>In-frame_PDE9A_ENST00000398229_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1053nt
ATGGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCA
GAACGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACT
GATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTG
TCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCC
CTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGT
GGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTG
ACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTT
TCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTT
TCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGAC
CAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAA
CCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAAC

>In-frame_PDE9A_ENST00000398229_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1053nt
ATGGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCA
GAACGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACT
GATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTG
TCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCC
CTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGT
GGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTG
ACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTT
TCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTT
TCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGAC
CAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAA
CCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAAC

>In-frame_PDE9A_ENST00000398234_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1152nt
ATGGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCA
GAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCA
GAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGG
GAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCT
CTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTT
GTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTC
AACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACG
GTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCT
GTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGT
ATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAAT
AATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATC
TCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGG

>In-frame_PDE9A_ENST00000398234_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1152nt
ATGGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCA
GAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCA
GAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGG
GAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCT
CTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTT
GTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTC
AACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACG
GTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCT
GTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGT
ATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAAT
AATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATC
TCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGG

>In-frame_PDE9A_ENST00000398232_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1254nt
ATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGC
CGTGGCCAGTCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAG
GTAGAGCCCAGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTG
GCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGC
GTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAA
CTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAA
AAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATC
GACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAAC
TACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTG
GGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCC
ACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAG
ACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAA
GAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATG

>In-frame_PDE9A_ENST00000398232_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1254nt
ATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGC
CGTGGCCAGTCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAG
GTAGAGCCCAGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTG
GCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGC
GTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAA
CTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAA
AAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATC
GACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAAC
TACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTG
GGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCC
ACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAG
ACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAA
GAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATG

>In-frame_PDE9A_ENST00000398227_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_975nt
ATGGACGCATTCAGAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAA
TGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTT
TCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATA
CTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTG
GTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGG
ACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATA
TCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCA
GGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGC
AATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGG
ATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAA

>In-frame_PDE9A_ENST00000398227_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_975nt
ATGGACGCATTCAGAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAA
TGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTT
TCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATA
CTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTG
GTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGG
ACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATA
TCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCA
GGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGC
AATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGG
ATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAA

>In-frame_PDE9A_ENST00000398225_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1332nt
ATGGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCA
GAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAGTCT
GCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCCAGG
CCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCA
GAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGG
GAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCT
CTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTT
GTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTC
AACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACG
GTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCT
GTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGT
ATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAAT
AATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATC
TCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGG

>In-frame_PDE9A_ENST00000398225_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1332nt
ATGGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCA
GAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAGTCT
GCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCCAGG
CCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCA
GAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGG
GAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCT
CTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTT
GTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTC
AACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACG
GTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCT
GTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGT
ATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAAT
AATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATC
TCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGG

>In-frame_PDE9A_ENST00000380328_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1296nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATG
GTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGGAATGAGCTCATTCTCTATACATCACTCCGTAACTTGTTGTTTTTACCTAGT
AAGGAGTCATGGGCGTCCCACCAGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGCATTCAAAATCAATGAACTG
AAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCC
TCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAA
AGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCAT
GAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATG
GATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATC
GAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCAT
GCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAA
TCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGT
TGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGG
CAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCT

>In-frame_PDE9A_ENST00000380328_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1296nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATG
GTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGGAATGAGCTCATTCTCTATACATCACTCCGTAACTTGTTGTTTTTACCTAGT
AAGGAGTCATGGGCGTCCCACCAGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGCATTCAAAATCAATGAACTG
AAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCC
TCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAA
AGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCAT
GAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATG
GATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATC
GAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCAT
GCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAA
TCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGT
TGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGG
CAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCT

>In-frame_PDE9A_ENST00000328862_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1377nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTC
TCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAGTCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAG
CCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCCAGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCT
CCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAA
GTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGA
ATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAA
AGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCT
ACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGC
TTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAG
CAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGG
GGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATT
GTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGG
CTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATG
CCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTT

>In-frame_PDE9A_ENST00000328862_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1377nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGC
AACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTC
TCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAGTCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAG
CCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCCAGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCT
CCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAA
GTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGA
ATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAA
AGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCT
ACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGC
TTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAG
CAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGG
GGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATT
GTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGG
CTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATG
CCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTT

>In-frame_PDE9A_ENST00000335440_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1149nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGAACACGACCATCTCCCTGCT
GACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAA
GCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAG
CTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTT
GTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTT
TTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAAC
AATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTG
TCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTA
CCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATA
ATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAAT
GGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCA
GAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATT

>In-frame_PDE9A_ENST00000335440_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1149nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGAACACGACCATCTCCCTGCT
GACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAA
GCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAG
CTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTT
GTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTT
TTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAAC
AATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTG
TCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTA
CCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATA
ATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAAT
GGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCA
GAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATT

>In-frame_PDE9A_ENST00000398224_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1074nt
ATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTG
GCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGC
GTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAA
CTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAA
AAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATC
GACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAAC
TACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTG
GGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCC
ACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAG
ACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAA
GAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATG

>In-frame_PDE9A_ENST00000398224_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1074nt
ATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTG
GCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGC
GTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAA
CTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAA
AAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATC
GACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAAC
TACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTG
GGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCC
ACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAG
ACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAA
GAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATG

>In-frame_PDE9A_ENST00000349112_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1071nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGACC
TGTGGCCATCAAGCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTG
GAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTA
GGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAA
GATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGAC
ATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTAC
TTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGT
ATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACA
TACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACT
ATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAA
GTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGG

>In-frame_PDE9A_ENST00000349112_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1071nt
ATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGACC
TGTGGCCATCAAGCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTG
GAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTA
GGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAA
GATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGAC
ATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTAC
TTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGT
ATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACA
TACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACT
ATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAA
GTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PDE9A_ENST00000335512_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2186nt
CCTCCCGCGGCGGCTGGCGTCGGGAAAGTACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACC
GGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGT
TCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCG
CGAATTCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGC
AGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGG
AATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAG
GAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAG
ATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACA
TTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACT
TAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTA
TCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACAT
ACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTA
TAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAG
TTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGA
AGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACC
TGTACTTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGAT
TTTACTTTTTAATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGG
TATTAACTCATACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAG
TCCATTTGTGCTGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATT
CCAAGACCAATGCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGG
AGGAATGTATGTCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCA
GTCACCTCTTAAAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACC
ATAGCAACATAAATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTC
CAAGATGCTTATACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTA

>In-frame_PDE9A_ENST00000335512_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1522nt
CCTCCCGCGGCGGCTGGCGTCGGGAAAGTACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACC
GGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGT
TCTGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCG
CGAATTCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGC
AGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGG
AATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAG
GAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAG
ATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACA
TTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACT
TAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTA
TCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACAT
ACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTA
TAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAG
TTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGA
AGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACC
TGTACTTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGAT

>In-frame_PDE9A_ENST00000539837_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2085nt
TCCCGCGGCGGCTGGCGTCGGGAAAGTACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGG
CCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTC
TGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCG
AATTCAGAACGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAG
CTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTT
GTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTT
TTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAAC
AATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTG
TCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTA
CCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATA
ATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAAT
GGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCA
GAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATT
GAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCA
AGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTA
ATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTAACTCAT
ACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCATTTGTGC
TGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAGACCAAT
GCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAATGTATG
TCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCACCTCTTA
AAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGCAACATA
AATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGATGCTTA
TACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTAAACACCTGTTG

>In-frame_PDE9A_ENST00000539837_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1421nt
TCCCGCGGCGGCTGGCGTCGGGAAAGTACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGG
CCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTC
TGCATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCG
AATTCAGAACGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAG
CTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTT
GTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTT
TTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAAC
AATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTG
TCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTA
CCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATA
ATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAAT
GGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCA
GAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATT
GAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCA
AGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTA

>In-frame_PDE9A_ENST00000291539_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2361nt
CGCGGCGGCTGGCGTCGGGAAAGTACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCC
AAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTCTGC
ATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAAT
TCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAG
TCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCC
AGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTT
GCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAA
TGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTT
TCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATA
CTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTG
GTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGG
ACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATA
TCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCA
GGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGC
AATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGG
ATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAA
AGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTAC
TTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTAC
TTTTTAATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTA
ACTCATACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCAT
TTGTGCTGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAG
ACCAATGCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAA
TGTATGTCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCAC
CTCTTAAAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGC
AACATAAATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGA
TGCTTATACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTAAACAC

>In-frame_PDE9A_ENST00000291539_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1697nt
CGCGGCGGCTGGCGTCGGGAAAGTACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCC
AAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTCTGC
ATCGCCACCGGCCTGCCTCGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAAT
TCAGAACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAG
TCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCC
AGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTT
GCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAA
TGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTT
TCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATA
CTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTG
GTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGG
ACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATA
TCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCA
GGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGC
AATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGG
ATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAA
AGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTAC
TTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTAC

>In-frame_PDE9A_ENST00000398236_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2079nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGCACT
CCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTC
TCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACT
GATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTG
TCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCC
CTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGT
GGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTG
ACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTT
TCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTT
TCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGAC
CAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAA
CCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAAC
TTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCAC
TGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGAT
ATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTAACTCATACTATA
TTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCATTTGTGCTGCTAT
AACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAGACCAATGCACCA
GCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAATGTATGTCCTCA
CATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCACCTCTTAAAGGCC
ACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGCAACATAAATGTA
TAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGATGCTTATACTCT
TAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTAAACACCTGTTGTATGTC

>In-frame_PDE9A_ENST00000398236_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1415nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGCACT
CCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTC
TCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACT
GATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTG
TCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCC
CTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGT
GGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTG
ACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTT
TCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTT
TCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGAC
CAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAA
CCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAAC
TTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCAC
TGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGAT

>In-frame_PDE9A_ENST00000398229_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1987nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGA
ACGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGA
TATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTC
AGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCT
TGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGG
AATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGAC
AAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTC
CATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTC
TAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCA
GTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACC
TTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTT
TAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCACTG
GAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGATAT
GACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTAACTCATACTATATT
CTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCATTTGTGCTGCTATAA
CAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAGACCAATGCACCAGC
AGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAATGTATGTCCTCACA
TGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCACCTCTTAAAGGCCAC
ATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGCAACATAAATGTATA
GAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGATGCTTATACTCTTA
GAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTAAACACCTGTTGTATGTCTT

>In-frame_PDE9A_ENST00000398229_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1323nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGA
ACGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGA
TATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTC
AGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCT
TGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGG
AATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGAC
AAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTC
CATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTC
TAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCA
GTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACC
TTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTT
TAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCACTG
GAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGATAT

>In-frame_PDE9A_ENST00000398234_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2086nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGA
ACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGA
GCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGA
GCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCT
TGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGT
TTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAA
CAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGT
GTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGT
ACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTAT
AATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAA
TGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTC
AGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGAT
TGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTC
AAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTT
AATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTAACTCA
TACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCATTTGTG
CTGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAGACCAA
TGCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAATGTAT
GTCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCACCTCTT
AAAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGCAACAT
AAATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGATGCTT
ATACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTAAACACCTGTT

>In-frame_PDE9A_ENST00000398234_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1422nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGA
ACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGA
GCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGA
GCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCT
TGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGT
TTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAA
CAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGT
GTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGT
ACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTAT
AATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAA
TGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTC
AGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGAT
TGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTC
AAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTT

>In-frame_PDE9A_ENST00000398232_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2188nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCG
TGGCCAGTCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGT
AGAGCCCAGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGC
GCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGT
GGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACT
AGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAA
AGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGA
CATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTA
CTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGG
TATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCAC
ATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGAC
TATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGA
AGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGG
GAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCA
CCTGTACTTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTG
ATTTTACTTTTTAATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAA
GGTATTAACTCATACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTT
AGTCCATTTGTGCTGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAA
TTCCAAGACCAATGCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGT
GGAGGAATGTATGTCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACT
CAGTCACCTCTTAAAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAA
CCATAGCAACATAAATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACC
TCCAAGATGCTTATACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCAT

>In-frame_PDE9A_ENST00000398232_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1524nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCG
TGGCCAGTCTGCTGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGT
AGAGCCCAGGCCCAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGC
GCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGT
GGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACT
AGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAA
AGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGA
CATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTA
CTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGG
TATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCAC
ATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGAC
TATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGA
AGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGG
GAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCA
CCTGTACTTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTG

>In-frame_PDE9A_ENST00000398227_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1909nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATG
GGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTC
TCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACT
TGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGT
CAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGAC
GGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATC
TGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGG
TATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAA
TAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGAT
CTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAG
GATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTT
TTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTT
TTTAATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTAAC
TCATACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCATTT
GTGCTGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAGAC
CAATGCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAATG
TATGTCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCACCT
CTTAAAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGCAA
CATAAATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGATG
CTTATACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTAAACACCT

>In-frame_PDE9A_ENST00000398227_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1245nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATG
GGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTC
TCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACT
TGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGT
CAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGAC
GGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATC
TGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGG
TATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAA
TAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGAT
CTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAG
GATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTT
TTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTT

>In-frame_PDE9A_ENST00000398225_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2266nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGA
ACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAGTCTGC
TGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCCAGGCC
CAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGA
GCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGA
GCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCT
TGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGT
TTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAA
CAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGT
GTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGT
ACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTAT
AATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAA
TGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTC
AGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGAT
TGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTC
AAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTT
AATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTAACTCA
TACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCATTTGTG
CTGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAGACCAA
TGCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAATGTAT
GTCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCACCTCTT
AAAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGCAACAT
AAATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGATGCTT
ATACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTAAACACCTGTT

>In-frame_PDE9A_ENST00000398225_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1602nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGA
ACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAGTCTGC
TGAGAGACCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCCAGGCC
CAGAGAGCCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGA
GCAGTTCTCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGA
GCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCT
TGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGT
TTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAA
CAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGT
GTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGT
ACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTAT
AATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAA
TGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTC
AGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGAT
TGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTC
AAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTT

>In-frame_PDE9A_ENST00000380328_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2178nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAAC
ACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGGAATGAGCTCATTCTC
TATACATCACTCCGTAACTTGTTGTTTTTACCTAGTAAGGAGTCATGGGCGTCCCACCAGCACTCCGTACAAAGTGAGACCTGTGGCCAT
CAAGCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGG
GAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCT
CTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTT
GTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTC
AACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACG
GTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCT
GTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGT
ATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAAT
AATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATC
TCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGG
ATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTT
TCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTT
TTAATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTAACT
CATACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCATTTG
TGCTGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAGACC
AATGCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAATGT
ATGTCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCACCTC
TTAAAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGCAAC
ATAAATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGATGC
TTATACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTAAACACCTG

>In-frame_PDE9A_ENST00000380328_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1514nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGGAAC
ACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGAACGGAATGAGCTCATTCTC
TATACATCACTCCGTAACTTGTTGTTTTTACCTAGTAAGGAGTCATGGGCGTCCCACCAGCACTCCGTACAAAGTGAGACCTGTGGCCAT
CAAGCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGG
GAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCT
CTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTT
GTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTC
AACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACG
GTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCT
GTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGT
ATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAAT
AATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATC
TCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGG
ATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTT
TCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTT

>In-frame_PDE9A_ENST00000328862_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2259nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGCACT
CCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAGTCTGCTGAGAGA
CCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCCAGGCCCAGAGAG
CCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTC
TCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACT
GATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTG
TCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCC
CTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGT
GGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTG
ACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTT
TCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTT
TCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGAC
CAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAA
CCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAAC
TTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCAC
TGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGAT
ATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTAACTCATACTATA
TTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCATTTGTGCTGCTAT
AACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAGACCAATGCACCA
GCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAATGTATGTCCTCA
CATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCACCTCTTAAAGGCC
ACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGCAACATAAATGTA
TAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGATGCTTATACTCT
TAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCATTAAACACCTGTTGTATGTC

>In-frame_PDE9A_ENST00000328862_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1595nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGTAATCTTCAGCAAGTACTGCAACTCCAGCGACATCATGGACCTGTTCTGCATCGCCACCGGCCTGCCTCGCACT
CCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGCTGGTGTCGAGGACAAGAGAACCACAAGCCGTGGCCAGTCTGCTGAGAGA
CCACTGAGGGACAGACGGGTTGTGGGCCTGGAGCAGCCCCGGAGGGAAGGAGCATTTGAAAGTGGACAGGTAGAGCCCAGGCCCAGAGAG
CCCCAGGGCTGCTACCAGGAAGGCCAGCGCATCCCTCCAGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTC
TCAAGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACT
GATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTG
TCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCC
CTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGT
GGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTG
ACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTT
TCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTT
TCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGAC
CAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAA
CCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAAC
TTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCAC
TGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGAT

>In-frame_PDE9A_ENST00000335440_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_2031nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGA
ACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCAC
TTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAG
CTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTA
GAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTT
CTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTAC
AGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATT
GTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAAT
GGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCC
CTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATC
AGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCC
TGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAG
ACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCT
GAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAG
ATTGCCATGAATCTTGCAAAAAAGGTATTAACTCATACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAA
ATCTAAGTTAACAGATTTGTCTTAGTCCATTTGTGCTGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTT
TTCCTGGCTCTTGAGGCTGGGAATTCCAAGACCAATGCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCAC
CTCATTGCTGCATCCTCCACAGTGGAGGAATGTATGTCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAG
AGCATTTAATCTCATTCATTACTCAGTCACCTCTTAAAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTT
TGGAGGGGACAAAAACATCCAAACCATAGCAACATAAATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAA
GAAGTATTTGAAATGACCTTACCTCCAAGATGCTTATACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAG

>In-frame_PDE9A_ENST00000335440_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1367nt
ACAGTAAAAAGTCCGAGTGCAGCCGCCGGGCGCAGGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGAT
GGACGCATTCAGAAGGAACACGACCATCTCCCTGCTGACCACCGACGACGCCATGGTCTCCATCGACCCCACCATGCCCGCGAATTCAGA
ACGCACTCCGTACAAAGTGAGACCTGTGGCCATCAAGCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCAC
TTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAG
CTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTA
GAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTT
CTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTAC
AGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATT
GTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAAT
GGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCC
CTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATC
AGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCC
TGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAG
ACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCT
GAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAG

>In-frame_PDE9A_ENST00000398224_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1974nt
GGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGA
CCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAA
ATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGG
GTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTG
CATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGAC
ACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGT
TCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTG
CCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGT
GCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCA
GGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATG
ACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTA
ACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTG
GATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCACTGGAGGGAGAAATGG
AAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGATATGACTTTGCTTCCA
ACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAAAGGTATTAACTCATACTATATTCTTGGATAAAATA
ACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCTTAGTCCATTTGTGCTGCTATAACAAAATACCACAG
ATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGAATTCCAAGACCAATGCACCAGCAGAATTAGTGTCT
GGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAGTGGAGGAATGTATGTCCTCACATGGTGGAAGGGAC
AGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTACTCAGTCACCTCTTAAAGGCCACATCCTTTAATACT
GTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAAACCATAGCAACATAAATGTATAGAATATTTCACAC
AAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTACCTCCAAGATGCTTATACTCTTAGAAAAGTTGACAG

>In-frame_PDE9A_ENST00000398224_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1310nt
GGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGA
CCTGTGGCCATCAAGCAACTCTCCGAGAGAGAAGAATTAATCCAGAGCGTGCTGGCGCAGGTTGCAGAGCAGTTCTCAAGAGCATTCAAA
ATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCGTGGAATAATGGGAGCTGACTGATATGGTGGTGTGG
GTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTG
CATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGAC
ACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGAATGTCCCAGCGT
TCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTG
CCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGT
GCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCCCA
GGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAATGGAGACCAGTCCCACAAGATG
ACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTA
ACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTG
GATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGCACCTGTACTTTTCAAGCCACTGGAGGGAGAAATGG
AAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGTGATTTTACTTTTTAATAGATATGACTTTGCTTCCA

>In-frame_PDE9A_ENST00000349112_chr21_44153536_+_DHRS7_ENST00000216500_chr14_60622870_-_1919nt
GGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGA
CCTGTGGCCATCAAGCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCG
TGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAAC
TAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAA
AAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCG
ACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACT
ACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGG
GTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCA
CATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGA
CTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAG
AAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGG
GGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGC
ACCTGTACTTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGT
GATTTTACTTTTTAATAGATATGACTTTGCTTCCAACATGGAATGAAATAAAAAATAAATAATAAAAGATTGCCATGAATCTTGCAAAAA
AGGTATTAACTCATACTATATTCTTGGATAAAATAACCTTTTAAAATACTTTAGCACATATGCTTAAAATCTAAGTTAACAGATTTGTCT
TAGTCCATTTGTGCTGCTATAACAAAATACCACAGATTTGGTAATTTATAAACAACAGAAATCTGTTTTTCCTGGCTCTTGAGGCTGGGA
ATTCCAAGACCAATGCACCAGCAGAATTAGTGTCTGGTGAAGGCTGATCTCTGCTTCCAAGATGGCACCTCATTGCTGCATCCTCCACAG
TGGAGGAATGTATGTCCTCACATGGTGGAAGGGACAGAAGGGAAAGAGGAGCAAAATGCTTTCAAAAGAGCATTTAATCTCATTCATTAC
TCAGTCACCTCTTAAAGGCCACATCCTTTAATACTGTTGCTTTGGGGATTAAGTTTCGACATGAATTTTGGAGGGGACAAAAACATCCAA
ACCATAGCAACATAAATGTATAGAATATTTCACACAAAGCAGAGTGCTGGGTAATGACCAGATATAAAGAAGTATTTGAAATGACCTTAC
CTCCAAGATGCTTATACTCTTAGAAAAGTTGACAGGTACAGATGGCTGTAATTTGAAGCAGCAGGTAGGATTCATTGCACCTATTATTCA

>In-frame_PDE9A_ENST00000349112_chr21_44153536_+_DHRS7_ENST00000557185_chr14_60622870_-_1255nt
GGATGGGATCCGGCTCCTCCAGCTACCGGCCCAAGGCCATCTACCTGGACATCGATGGACGCATTCAGAAGCACTCCGTACAAAGTGAGA
CCTGTGGCCATCAAGCAACTCTCCGAGCATTCAAAATCAATGAACTGAAAGCTGAAGTTGCAAATCACTTGGCTGTCCTAGAGAAACGCG
TGGAATAATGGGAGCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTGTCTAAAC
TAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGATGCCTAGAGAATGGCAATTTAAAAGAAA
AAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTCCCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCG
ACATTCTGGTCAACAATGGTGGAATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACT
ACTTAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTACTGTGAATAGCATCCTGG
GTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTCCGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCA
CATACCCAGGTATAATAGTTTCTAACATTTGCCCAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGA
CTATAGGCAATAATGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGATTTGAAAG
AAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCTGGGCCTGGTGGATAACCAACAAGATGG
GGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGACTCTTCTTATTTTAAAATCTTTAAGACAAAACATGACTGAAAAGAGC
ACCTGTACTTTTCAAGCCACTGGAGGGAGAAATGGAAAACATGAAAACAGCAATCTTCTTATGCTTCTGAATAATCAAAGACTAATTTGT


Top

FusionGenePPI for PDE9A_DHRS7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PDE9ATRIM32, PHYHIPL, PDE9A, CLK1, CRY2, LMO2, SULT1E1, LAGE3, BAG3, GORASP2, TRPV6, KRTAP9-2, UTP23, NAA38, KRTAP4-2, KRTAP10-8, KRTAP10-3, NOTCH2NL, C9orf106, UNC119, TFAP4, C12orf75, PRKG2, RSPRY1, NPHP3DHRS7ETV5, POPDC2, SPINT2, SRPRB, HLA-DMB, IL20RB, MCOLN3, TMEM30A, IL9R, TSPAN17, TREML2, HTR3E, PTGER3, EVA1C, CHRNA9, TCTN2, TCTN3, EVC2, TMEM17, TMEM216, SCN3B, ATP2B2, PCDHGA5, CPNE5, PCDHA3, PCDHAC2, TNFRSF1A, PLXDC2, KIAA1467, TLR5, PCDHGB4, FAM189B, TMPRSS3, GRPR, CHRND


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PDE9A_DHRS7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PDE9A_DHRS7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePDE9AC0005586Bipolar Disorder1PSYGENET
TgeneDHRS7C0015695Fatty Liver1CTD_human
TgeneDHRS7C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneDHRS7C4277682Chemical and Drug Induced Liver Injury1CTD_human