FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26362

FusionGeneSummary for PDCD7_TAF15

check button Fusion gene summary
Fusion gene informationFusion gene name: PDCD7_TAF15
Fusion gene ID: 26362
HgeneTgene
Gene symbol

PDCD7

TAF15

Gene ID

10081

8148

Gene nameprogrammed cell death 7TATA-box binding protein associated factor 15
SynonymsES18|HES18Npl3|RBP56|TAF2N|TAFII68
Cytomap

15q22.31

17q12

Type of geneprotein-codingprotein-coding
Descriptionprogrammed cell death protein 7U11/U12 snRNP 59Kapoptosis-related protein ES18TATA-binding protein-associated factor 2NRBP56/CSMF fusionTAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDaTATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD (RNA-binding protein 56)TATA box-bin
Modification date2018051920180523
UniProtAcc

Q8N8D1

Q92804

Ensembl transtripts involved in fusion geneENST00000204549, ENST00000588240, 
ENST00000592237, ENST00000311979, 
Fusion gene scores* DoF score3 X 3 X 2=187 X 5 X 6=210
# samples 47
** MAII scorelog2(4/18*10)=1.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PDCD7 [Title/Abstract] AND TAF15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-LD-A7W5-01APDCD7chr15

65421370

-TAF15chr17

34144720

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000204549ENST00000588240PDCD7chr15

65421370

-TAF15chr17

34144720

+
5CDS-5UTRENST00000204549ENST00000592237PDCD7chr15

65421370

-TAF15chr17

34144720

+
5CDS-5UTRENST00000204549ENST00000311979PDCD7chr15

65421370

-TAF15chr17

34144720

+

Top

FusionProtFeatures for PDCD7_TAF15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PDCD7

Q8N8D1

TAF15

Q92804

Promotes apoptosis when overexpressed. {ECO:0000250}. RNA and ssDNA-binding protein that may play specificroles during transcription initiation at distinct promoters. Canenter the preinitiation complex together with the RNA polymeraseII (Pol II). {ECO:0000269|PubMed:19124016}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDCD7chr15:65421370chr17:34144720ENST00000204549-25232_335336486Coiled coilOntology_term=ECO:0000255
HgenePDCD7chr15:65421370chr17:34144720ENST00000204549-25236_278336486Compositional biasNote=Arg/Glu-rich
HgenePDCD7chr15:65421370chr17:34144720ENST00000204549-254_129336486Compositional biasNote=Pro-rich
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+0161_2082590Compositional biasNote=Gln/Gly/Ser/Tyr-rich
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016320_5902590Compositional biasNote=Arg/Gly-rich
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+0161_2082593Compositional biasNote=Gln/Gly/Ser/Tyr-rich
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016320_5902593Compositional biasNote=Arg/Gly-rich
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016234_3202590DomainRRM
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016234_3202593DomainRRM
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016407_5752590RegionNote=21 X approximate tandem repeats of D-R-[S%2CG](0%2C3)-G-G-Y-G-G
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016407_5752593RegionNote=21 X approximate tandem repeats of D-R-[S%2CG](0%2C3)-G-G-Y-G-G
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016407_4132590RepeatNote=1
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016414_4202590RepeatNote=2
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016421_4292590RepeatNote=3
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016430_4392590RepeatNote=4
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016440_4482590RepeatNote=5
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016449_4572590RepeatNote=6
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016458_4652590RepeatNote=7
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016466_4732590RepeatNote=8
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016474_4812590RepeatNote=9
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016482_4882590RepeatNote=10
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016489_4962590RepeatNote=11
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016497_5032590RepeatNote=12
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016504_5102590RepeatNote=13
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016511_5172590RepeatNote=14
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016518_5242590RepeatNote=15
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016525_5332590RepeatNote=16
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016534_5432590RepeatNote=17
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016544_5512590RepeatNote=18
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016552_5602590RepeatNote=19
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016561_5682590RepeatNote=20
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016569_5752590RepeatNote=21
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016407_4132593RepeatNote=1
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016414_4202593RepeatNote=2
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016421_4292593RepeatNote=3
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016430_4392593RepeatNote=4
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016440_4482593RepeatNote=5
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016449_4572593RepeatNote=6
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016458_4652593RepeatNote=7
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016466_4732593RepeatNote=8
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016474_4812593RepeatNote=9
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016482_4882593RepeatNote=10
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016489_4962593RepeatNote=11
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016497_5032593RepeatNote=12
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016504_5102593RepeatNote=13
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016511_5172593RepeatNote=14
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016518_5242593RepeatNote=15
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016525_5332593RepeatNote=16
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016534_5432593RepeatNote=17
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016544_5512593RepeatNote=18
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016552_5602593RepeatNote=19
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016561_5682593RepeatNote=20
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016569_5752593RepeatNote=21
TgeneTAF15chr15:65421370chr17:34144720ENST00000311979+016354_3852590Zinc fingerRanBP2-type
TgeneTAF15chr15:65421370chr17:34144720ENST00000588240+016354_3852593Zinc fingerRanBP2-type

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDCD7chr15:65421370chr17:34144720ENST00000204549-25362_411336486Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for PDCD7_TAF15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PDCD7_ENST00000204549_chr15_65421370_-_TAF15_ENST00000588240_chr17_34144720_+_927aa
MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPP
PPPQCRPFPGTDAGERPRPPPPGPGPPWSPRWPEAPPPPADVLGDAALQRLRDRQWLEAVFGTPRRAGCPVPQRTHAGPSLGEVRARLLR
ALRLVRRLRGLSQALREAEADGAAWVLLYSQTAPLRAELAERLQPLTQAATVGEARRRLERVRRRRLRLRERAREREAEREAEAARAVER
EQEIDRWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKDSGSYGQSGGEQQSTSTTGNPGSQ
GTGQASQSTSGTGQTTDSSTGQNYSGYSSTGQSQSGTSQSTGGTENQKQSSTSQQPTNNQGQQQNMESSGSQGGRAPSTDQPDTGQQDST
DQQSGTDQHQGSTDEQSNTDQQHDSTSQNQQSTHSQRENYSHHTQDDRRDVSRTGEDNRGTGGSQGGGRGRGGTDKDGRGPMTGSSGGDR
GGFKNFGGHRDTGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDTGKPKGEATVSFDDPPSA
KAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPED
SRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDRGGGTGGDRGGGTGGDRG
GGTGGDRGGTGGDRGGGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGTGGDRGGGY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PDCD7_ENST00000204549_chr15_65421370_-_TAF15_ENST00000588240_chr17_34144720_+_2781nt
ATGGCCCTGCCACCATTCTTCGGCCAGGGTCGCCCAGGCCCACCGCCCCCGCAGCCGCCGCCTCCTGCTCCTTTCGGCTGTCCGCCACCG
CCGCTGCCCTCCCCGGCTTTCCCGCCGCCTCTCCCCCAGCGGCCCGGCCCTTTTCCGGGGGCCTCCGCCCCCTTCCTTCAGCCTCCGCTG
GCTCTGCAGCCCCGAGCCTCCGCGGAGGCCTCCCGCGGCGGAGGCGGCGCTGGCGCCTTCTACCCGGTGCCACCACCGCCGCTGCCTCCT
CCGCCGCCCCAGTGTCGGCCCTTCCCGGGGACCGACGCCGGCGAGCGGCCGCGGCCACCGCCTCCCGGCCCGGGGCCGCCCTGGAGCCCG
CGGTGGCCTGAGGCGCCGCCGCCGCCGGCCGACGTGCTCGGGGATGCGGCCCTCCAACGCCTGCGCGACCGGCAGTGGCTGGAGGCGGTG
TTCGGGACCCCGCGGCGGGCAGGCTGTCCGGTGCCCCAGCGCACGCATGCCGGGCCCAGCCTTGGCGAAGTGCGCGCGCGATTGCTCCGG
GCTCTGCGCCTGGTGCGGCGGCTGCGCGGCCTGAGCCAGGCCCTGCGCGAGGCCGAAGCCGACGGCGCGGCCTGGGTCCTGCTGTACTCC
CAGACCGCGCCGCTGCGCGCGGAACTGGCCGAGCGGCTACAGCCGTTGACCCAGGCTGCCTATGTGGGCGAGGCGCGGAGGAGGCTGGAG
AGGGTCCGGCGCCGCCGGCTGCGGCTTCGCGAGAGGGCCCGGGAACGCGAGGCCGAGCGGGAGGCAGAGGCCGCGCGGGCAGTGGAACGC
GAGCAGGAGATTGACCGCTGGAGGGTGAAGTGTGTGCAGGAGGTGGAGGAGAAGAAGCGGGAGCAGGAACTCAAAGCAGCCGCTGATGGC
GTACTATCTGAAGTGAGGAAAAAACAAGCAGATACCAAAAGAATGGTGGACATTCTACGGGCTTTGGAGAAATTGAGGAAACTGAGGAAA
GAGGCTGCAGCGAGGAAAGATTCTGGAAGTTACGGTCAGTCTGGGGGTGAGCAGCAAAGTTATTCTACCTATGGAAATCCAGGCAGCCAA
GGCTATGGACAAGCATCACAAAGCTATTCTGGCTATGGGCAAACGACTGATTCCTCTTATGGACAGAACTACAGCGGTTACTCCAGTTAT
GGACAAAGTCAGTCAGGTTATTCACAGTCCTATGGTGGTTATGAGAATCAAAAGCAGAGCTCATATAGCCAGCAACCATATAATAACCAG
GGACAGCAGCAAAACATGGAATCATCAGGAAGCCAAGGTGGAAGAGCACCTTCCTATGACCAGCCAGACTATGGTCAACAAGATTCATAT
GACCAGCAGTCAGGCTATGATCAACATCAAGGCTCATATGATGAGCAGTCAAATTATGATCAGCAGCATGATTCCTATAGTCAAAACCAG
CAGTCCTATCATTCACAAAGGGAAAACTACAGCCACCACACACAAGATGACCGTCGTGATGTGAGTAGGTATGGAGAAGATAATAGAGGA
TATGGCGGGTCACAGGGAGGAGGTAGAGGGCGTGGGGGATATGACAAGGATGGAAGAGGTCCTATGACAGGATCAAGTGGTGGTGACCGC
GGTGGCTTCAAAAATTTTGGTGGTCACAGGGATTATGGACCCAGAACAGATGCTGATTCAGAATCTGATAATTCAGATAACAACACAATC
TTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACC
GGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCT
AAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGA
GGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGG
GATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGAC
TCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGC
GGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTAT
GGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGA
GGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGA
GGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGT
GGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PDCD7_ENST00000204549_chr15_65421370_-_TAF15_ENST00000588240_chr17_34144720_+_3133nt
CTCATGAGGAGCCACTCAGATTCCTGTCACTTCTCAAAGCATCTCCGTCGTGAACATGGCCCTGCCACCATTCTTCGGCCAGGGTCGCCC
AGGCCCACCGCCCCCGCAGCCGCCGCCTCCTGCTCCTTTCGGCTGTCCGCCACCGCCGCTGCCCTCCCCGGCTTTCCCGCCGCCTCTCCC
CCAGCGGCCCGGCCCTTTTCCGGGGGCCTCCGCCCCCTTCCTTCAGCCTCCGCTGGCTCTGCAGCCCCGAGCCTCCGCGGAGGCCTCCCG
CGGCGGAGGCGGCGCTGGCGCCTTCTACCCGGTGCCACCACCGCCGCTGCCTCCTCCGCCGCCCCAGTGTCGGCCCTTCCCGGGGACCGA
CGCCGGCGAGCGGCCGCGGCCACCGCCTCCCGGCCCGGGGCCGCCCTGGAGCCCGCGGTGGCCTGAGGCGCCGCCGCCGCCGGCCGACGT
GCTCGGGGATGCGGCCCTCCAACGCCTGCGCGACCGGCAGTGGCTGGAGGCGGTGTTCGGGACCCCGCGGCGGGCAGGCTGTCCGGTGCC
CCAGCGCACGCATGCCGGGCCCAGCCTTGGCGAAGTGCGCGCGCGATTGCTCCGGGCTCTGCGCCTGGTGCGGCGGCTGCGCGGCCTGAG
CCAGGCCCTGCGCGAGGCCGAAGCCGACGGCGCGGCCTGGGTCCTGCTGTACTCCCAGACCGCGCCGCTGCGCGCGGAACTGGCCGAGCG
GCTACAGCCGTTGACCCAGGCTGCCTATGTGGGCGAGGCGCGGAGGAGGCTGGAGAGGGTCCGGCGCCGCCGGCTGCGGCTTCGCGAGAG
GGCCCGGGAACGCGAGGCCGAGCGGGAGGCAGAGGCCGCGCGGGCAGTGGAACGCGAGCAGGAGATTGACCGCTGGAGGGTGAAGTGTGT
GCAGGAGGTGGAGGAGAAGAAGCGGGAGCAGGAACTCAAAGCAGCCGCTGATGGCGTACTATCTGAAGTGAGGAAAAAACAAGCAGATAC
CAAAAGAATGGTGGACATTCTACGGGCTTTGGAGAAATTGAGGAAACTGAGGAAAGAGGCTGCAGCGAGGAAAGATTCTGGAAGTTACGG
TCAGTCTGGGGGTGAGCAGCAAAGTTATTCTACCTATGGAAATCCAGGCAGCCAAGGCTATGGACAAGCATCACAAAGCTATTCTGGCTA
TGGGCAAACGACTGATTCCTCTTATGGACAGAACTACAGCGGTTACTCCAGTTATGGACAAAGTCAGTCAGGTTATTCACAGTCCTATGG
TGGTTATGAGAATCAAAAGCAGAGCTCATATAGCCAGCAACCATATAATAACCAGGGACAGCAGCAAAACATGGAATCATCAGGAAGCCA
AGGTGGAAGAGCACCTTCCTATGACCAGCCAGACTATGGTCAACAAGATTCATATGACCAGCAGTCAGGCTATGATCAACATCAAGGCTC
ATATGATGAGCAGTCAAATTATGATCAGCAGCATGATTCCTATAGTCAAAACCAGCAGTCCTATCATTCACAAAGGGAAAACTACAGCCA
CCACACACAAGATGACCGTCGTGATGTGAGTAGGTATGGAGAAGATAATAGAGGATATGGCGGGTCACAGGGAGGAGGTAGAGGGCGTGG
GGGATATGACAAGGATGGAAGAGGTCCTATGACAGGATCAAGTGGTGGTGACCGCGGTGGCTTCAAAAATTTTGGTGGTCACAGGGATTA
TGGACCCAGAACAGATGCTGATTCAGAATCTGATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGA
TCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGA
CACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATT
CCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGG
AGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATAT
GAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGG
CTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGG
TGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGA
CAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGG
AGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGA
TCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGG
CTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGG
AGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTG
AAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAG
GGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTT


Top

FusionGenePPI for PDCD7_TAF15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PDCD7RNU11, FEZ1, HAP1, FEZ2, CALM1, ELAVL1, APP, SNRNP200, PRPF40A, WWOX, ZRSR2, RNU12, MARK2, RPL10, PCGF1, NANOG, POU5F1, SNRPN, ZCRB1, SNRPF, SNRPG, ZMAT5, SNRPE, SNRNP35TAF15SAFB, PRMT1, TAF7, TAF5, TAF13, TAF11, POLR2C, POLR2G, POLR2E, SF1, KAT2B, POLR2A, HIST2H2AC, HIST1H3A, HIST2H4A, CACNA1A, SIRT7, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, DDB1, TPR, SAP30BP, RNF168, SCARB2, TPM2, TMED9, MED26, PRMT8, FUS, RPA3, RPA2, RPA1, HIST3H3, CUL7, OBSL1, EZH2, SUZ12, EED, RNF2, BMI1, RPS6KB2, ACAA2, SFN, HNRNPA1, PPP1CB, MATR3, MED12, MCM2, NF2, DNPEP, KLHL8, TRIM25, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PDCD7_TAF15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PDCD7_TAF15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneTAF15C0029463Osteosarcoma1CTD_human
TgeneTAF15C0038356Stomach Neoplasms1CTD_human