FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26200

FusionGeneSummary for PCDHA11_ANKHD1

check button Fusion gene summary
Fusion gene informationFusion gene name: PCDHA11_ANKHD1
Fusion gene ID: 26200
HgeneTgene
Gene symbol

PCDHA11

ANKHD1

Gene ID

56138

54882

Gene nameprotocadherin alpha 11ankyrin repeat and KH domain containing 1
SynonymsCNR7|CNRN7|CNRS7|CRNR7|PCDH-ALPHA11MASK|MASK1|PP2500|VBARP
Cytomap

5q31.3

5q31.3

Type of geneprotein-codingprotein-coding
Descriptionprotocadherin alpha-11KIAA0345-like 3ankyrin repeat and KH domain-containing protein 1HIV-1 Vpr-binding ankyrin repeat proteinmultiple ankyrin repeats, single KH-domain homolog
Modification date2018052320180523
UniProtAcc

Q9Y5I1

Q8IWZ3

Ensembl transtripts involved in fusion geneENST00000398640, ENST00000360839, 
ENST00000297183, ENST00000394723, 
ENST00000394722, ENST00000462121, 
ENST00000544120, 
Fusion gene scores* DoF score1 X 1 X 1=18 X 11 X 3=264
# samples 111
** MAII scorelog2(1/1*10)=3.32192809488736log2(11/264*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PCDHA11 [Title/Abstract] AND ANKHD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-D8-A13Z-01APCDHA11chr5

140251079

+ANKHD1chr5

139892948

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000398640ENST00000360839PCDHA11chr5

140251079

+ANKHD1chr5

139892948

+
In-frameENST00000398640ENST00000297183PCDHA11chr5

140251079

+ANKHD1chr5

139892948

+
5CDS-intronENST00000398640ENST00000394723PCDHA11chr5

140251079

+ANKHD1chr5

139892948

+
5CDS-intronENST00000398640ENST00000394722PCDHA11chr5

140251079

+ANKHD1chr5

139892948

+
5CDS-intronENST00000398640ENST00000462121PCDHA11chr5

140251079

+ANKHD1chr5

139892948

+
5CDS-intronENST00000398640ENST00000544120PCDHA11chr5

140251079

+ANKHD1chr5

139892948

+

Top

FusionProtFeatures for PCDHA11_ANKHD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PCDHA11

Q9Y5I1

ANKHD1

Q8IWZ3

Potential calcium-dependent cell-adhesion protein. Maybe involved in the establishment and maintenance of specificneuronal connections in the brain.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14157_242797950DomainCadherin 2
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14243_349797950DomainCadherin 3
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+1430_133797950DomainCadherin 1
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14350_454797950DomainCadherin 4
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14455_564797950DomainCadherin 5
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14580_677797950DomainCadherin 6
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14733_736797950RepeatNote=PXXP 1
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14773_776797950RepeatNote=PXXP 2
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14795_798797950RepeatNote=PXXP 3
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+1430_696797950Topological domainExtracellular
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14697_717797950TransmembraneHelical
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361415_148514002618Coiled coilOntology_term=ECO:0000255
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341415_148514002543Coiled coilOntology_term=ECO:0000255
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111415_1485-16617Coiled coilOntology_term=ECO:0000255
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011775_852-16617Coiled coilOntology_term=ECO:0000255
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111415_1485-38628Coiled coilOntology_term=ECO:0000255
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011775_852-38628Coiled coilOntology_term=ECO:0000255
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361977_210014002618Compositional biasNote=Ser-rich
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22362291_229914002618Compositional biasNote=Poly-Ser
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341977_210014002543Compositional biasNote=Ser-rich
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22342291_229914002543Compositional biasNote=Poly-Ser
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111977_2100-16617Compositional biasNote=Ser-rich
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0112291_2299-16617Compositional biasNote=Poly-Ser
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0116_94-16617Compositional biasNote=Gly-rich
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111977_2100-38628Compositional biasNote=Ser-rich
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0112291_2299-38628Compositional biasNote=Poly-Ser
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0116_94-38628Compositional biasNote=Gly-rich
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361695_175914002618DomainKH
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341695_175914002543DomainKH
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111695_1759-16617DomainKH
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111695_1759-38628DomainKH
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111054_1083-16617RepeatNote=ANK 16
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111087_1116-16617RepeatNote=ANK 17
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111121_1150-16617RepeatNote=ANK 18
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111154_1183-16617RepeatNote=ANK 19
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111189_1218-16617RepeatNote=ANK 20
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111223_1252-16617RepeatNote=ANK 21
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111256_1285-16617RepeatNote=ANK 22
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111291_1320-16617RepeatNote=ANK 23
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111324_1353-16617RepeatNote=ANK 24
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+0111357_1386-16617RepeatNote=ANK 25
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011204_233-16617RepeatNote=ANK 1
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011237_266-16617RepeatNote=ANK 2
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011271_300-16617RepeatNote=ANK 3
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011304_333-16617RepeatNote=ANK 4
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011337_366-16617RepeatNote=ANK 5
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011371_400-16617RepeatNote=ANK 6
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011404_433-16617RepeatNote=ANK 7
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011437_466-16617RepeatNote=ANK 8
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011470_499-16617RepeatNote=ANK 9
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011504_533-16617RepeatNote=ANK 10
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011534_563-16617RepeatNote=ANK 11
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011567_596-16617RepeatNote=ANK 12
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011600_629-16617RepeatNote=ANK 13
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011634_663-16617RepeatNote=ANK 14
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394722+011667_696-16617RepeatNote=ANK 15
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111054_1083-38628RepeatNote=ANK 16
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111087_1116-38628RepeatNote=ANK 17
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111121_1150-38628RepeatNote=ANK 18
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111154_1183-38628RepeatNote=ANK 19
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111189_1218-38628RepeatNote=ANK 20
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111223_1252-38628RepeatNote=ANK 21
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111256_1285-38628RepeatNote=ANK 22
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111291_1320-38628RepeatNote=ANK 23
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111324_1353-38628RepeatNote=ANK 24
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+0111357_1386-38628RepeatNote=ANK 25
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011204_233-38628RepeatNote=ANK 1
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011237_266-38628RepeatNote=ANK 2
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011271_300-38628RepeatNote=ANK 3
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011304_333-38628RepeatNote=ANK 4
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011337_366-38628RepeatNote=ANK 5
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011371_400-38628RepeatNote=ANK 6
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011404_433-38628RepeatNote=ANK 7
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011437_466-38628RepeatNote=ANK 8
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011470_499-38628RepeatNote=ANK 9
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011504_533-38628RepeatNote=ANK 10
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011534_563-38628RepeatNote=ANK 11
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011567_596-38628RepeatNote=ANK 12
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011600_629-38628RepeatNote=ANK 13
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011634_663-38628RepeatNote=ANK 14
TgeneANKHD1chr5:140251079chr5:139892948ENST00000394723+011667_696-38628RepeatNote=ANK 15

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14922_929797950Compositional biasNote=Poly-Lys
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14733_893797950RegionNote=6 X 4 AA repeats of P-X-X-P
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14831_834797950RepeatNote=PXXP 4
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14872_875797950RepeatNote=PXXP 5
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14890_893797950RepeatNote=PXXP 6
HgenePCDHA11chr5:140251079chr5:139892948ENST00000398640+14718_949797950Topological domainCytoplasmic
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236775_85214002618Coiled coilOntology_term=ECO:0000255
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234775_85214002543Coiled coilOntology_term=ECO:0000255
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22366_9414002618Compositional biasNote=Gly-rich
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22346_9414002543Compositional biasNote=Gly-rich
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361054_108314002618RepeatNote=ANK 16
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361087_111614002618RepeatNote=ANK 17
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361121_115014002618RepeatNote=ANK 18
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361154_118314002618RepeatNote=ANK 19
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361189_121814002618RepeatNote=ANK 20
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361223_125214002618RepeatNote=ANK 21
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361256_128514002618RepeatNote=ANK 22
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361291_132014002618RepeatNote=ANK 23
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361324_135314002618RepeatNote=ANK 24
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+22361357_138614002618RepeatNote=ANK 25
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236204_23314002618RepeatNote=ANK 1
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236237_26614002618RepeatNote=ANK 2
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236271_30014002618RepeatNote=ANK 3
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236304_33314002618RepeatNote=ANK 4
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236337_36614002618RepeatNote=ANK 5
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236371_40014002618RepeatNote=ANK 6
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236404_43314002618RepeatNote=ANK 7
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236437_46614002618RepeatNote=ANK 8
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236470_49914002618RepeatNote=ANK 9
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236504_53314002618RepeatNote=ANK 10
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236534_56314002618RepeatNote=ANK 11
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236567_59614002618RepeatNote=ANK 12
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236600_62914002618RepeatNote=ANK 13
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236634_66314002618RepeatNote=ANK 14
TgeneANKHD1chr5:140251079chr5:139892948ENST00000297183+2236667_69614002618RepeatNote=ANK 15
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341054_108314002543RepeatNote=ANK 16
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341087_111614002543RepeatNote=ANK 17
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341121_115014002543RepeatNote=ANK 18
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341154_118314002543RepeatNote=ANK 19
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341189_121814002543RepeatNote=ANK 20
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341223_125214002543RepeatNote=ANK 21
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341256_128514002543RepeatNote=ANK 22
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341291_132014002543RepeatNote=ANK 23
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341324_135314002543RepeatNote=ANK 24
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+22341357_138614002543RepeatNote=ANK 25
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234204_23314002543RepeatNote=ANK 1
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234237_26614002543RepeatNote=ANK 2
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234271_30014002543RepeatNote=ANK 3
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234304_33314002543RepeatNote=ANK 4
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234337_36614002543RepeatNote=ANK 5
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234371_40014002543RepeatNote=ANK 6
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234404_43314002543RepeatNote=ANK 7
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234437_46614002543RepeatNote=ANK 8
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234470_49914002543RepeatNote=ANK 9
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234504_53314002543RepeatNote=ANK 10
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234534_56314002543RepeatNote=ANK 11
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234567_59614002543RepeatNote=ANK 12
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234600_62914002543RepeatNote=ANK 13
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234634_66314002543RepeatNote=ANK 14
TgeneANKHD1chr5:140251079chr5:139892948ENST00000360839+2234667_69614002543RepeatNote=ANK 15


Top

FusionGeneSequence for PCDHA11_ANKHD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PCDHA11_ENST00000398640_chr5_140251079_+_ANKHD1_ENST00000360839_chr5_139892948_+_1940aa
MFGFQRRGLGTPRLQLWLLLLEFWEVGSGQLHYSVSEEAKHGTFVGRIAQDLGLELAELVQRLFRVASKTHGDLLEVNLQNGILFVNSRI
DREELCGQSAECSIHLEVIVDRPLQVFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTYRLSKNETFSL
DSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKPELTGTVRLLVQVLDVNDNDPEFDKSETKVSLMENAAKETLVLKLNATDRD
EGVNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDTEENKFTKIEVQATDKGTPPMAGHCTVWVEILDTNDNSPEVAVTSLSLPVRE
DAQPSTVIALISVSDRDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDSALDRENVWATELVVTARDGGSPSLWATARVSVEVADVNDN
APAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRLGDRALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAG
VPPLSSNVTLQVFVLDENDNAPALLATQAGSAGGAVNKLVPRSVGAGHVVAKVRAVDADSGYNAWLSTELQPAAGGSRIPFRVGLYTGEI
STTRALDEADSPRHRLLVLVKDHGEPALTATATVLVSLVESGQAPKASSRTLAGAASPEAALVDVNVYLIIAICVVSSLLVLTLLLTTAL
WWSATPTEGACAPGKPTLVCSRAVGSWSYSQQRRQRVCSEEGPPKTDLMAFSPSLPLGLNKEEEGERQEPGSNHPGQELLKKCHQCVETI
VKAKDQQAAEANKNASILLKELDLEKSREESRKQALAAKREKRKEKRKKKKEEQKRKQEEDEENKPKENSELPEDEDEEENDEDVEQEVP
IEPPSATTTTTIGISATSATFTNVFGKKRANVVTTPSTNRKNKKNKTKETPPTAHLILPEQHMSLAQQKADKNKINGEPRGGGAGGNSDS
DNLDSTDCNSESSSGGKSQELNFVMDVNSSKYPSLLLHSQEEKTSTATSKTQTRLEGEVTPNSLSTSYKTVSLPLSSPNIKLNLTSPKRG
QKREEGWKEVVRRSKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDKNGERMITIRGGTESTRTAVQLINALIQDPAKELEDL
IPKNHIRTPASTKSIHANFSSGVGTTAASSKNAFPLGAPTLVTSQATTLSTFQPANKLNKNVPTNVRSSFPVSLPLATPHPHFALLAAQT
MQQIRHPRLPMAQFGGTFSPSPNTWGPFPVRPVNPGNTNSSPKHNNTSRLPNQNGTVLPSESAGLATASCPITVSSVVAASQQLCVTNTR
TPSSVRKQLFACVPKTSPPATVISSVTSTCSSLPSVSSAPITSGQAPTTFLPASTSQAQLSSQKMESFSAVPPTKEKVSTQDQPMANLCT
PSSTANSCSSSASNTPGAPETHPSSSPTPTSSNTQEEAQPSSVSDLSPMSMPFASNSEPAPLTLTSPRMVAADNQDTSNLPQLAVPAPRV
SHRMQPRGSFYSMVPNATIHQDPQSIFVTNPVTLTPPQGPPAAVQLSSAVNIMNGSQMHINPANKSLPPTFGPATLFNHFSSLFDSSQVP
ANQGWGDGPLSSRVATDASFTVQSAFLGNSVLGHLENMHPDNSKAPGFRPPSQRVSTSPVGLPSIDPSGSSPSSSSAPLASFSGIPGTRV
FLQGPAPVGTPSFNRQHFSPHPWTSASNSSTSAPPTLGQPKGVSASQDRKIPPPIGTERLARIRQGGSVAQAPAGTSFVAPVGHSGIWSF
GVNAVSEGLSGWSQSVMGNHPMHQQLSDPSTFSQHQPMERDDSGMVAPSNIFHQPMASGFVDFSKGLPISMTGGTIIPSHPQLADVPGGP

>In-frame_PCDHA11_ENST00000398640_chr5_140251079_+_ANKHD1_ENST00000297183_chr5_139892948_+_2015aa
MFGFQRRGLGTPRLQLWLLLLEFWEVGSGQLHYSVSEEAKHGTFVGRIAQDLGLELAELVQRLFRVASKTHGDLLEVNLQNGILFVNSRI
DREELCGQSAECSIHLEVIVDRPLQVFHVNVEVKDINDNPPVFSLREQKLLIAESKQSDSRFPLEGASDADIEENALLTYRLSKNETFSL
DSPTNGKQIKRLSLILKKSLDREKTPELNLLLTATDGGKPELTGTVRLLVQVLDVNDNDPEFDKSETKVSLMENAAKETLVLKLNATDRD
EGVNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDTEENKFTKIEVQATDKGTPPMAGHCTVWVEILDTNDNSPEVAVTSLSLPVRE
DAQPSTVIALISVSDRDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDSALDRENVWATELVVTARDGGSPSLWATARVSVEVADVNDN
APAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRLGDRALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAG
VPPLSSNVTLQVFVLDENDNAPALLATQAGSAGGAVNKLVPRSVGAGHVVAKVRAVDADSGYNAWLSTELQPAAGGSRIPFRVGLYTGEI
STTRALDEADSPRHRLLVLVKDHGEPALTATATVLVSLVESGQAPKASSRTLAGAASPEAALVDVNVYLIIAICVVSSLLVLTLLLTTAL
WWSATPTEGACAPGKPTLVCSRAVGSWSYSQQRRQRVCSEEGPPKTDLMAFSPSLPLGLNKEEEGERQEPGSNHPGQELLKKCHQCVETI
VKAKDQQAAEANKNASILLKELDLEKSREESRKQALAAKREKRKEKRKKKKEEQKRKQEEDEENKPKENSELPEDEDEEENDEDVEQEVP
IEPPSATTTTTIGISATSATFTNVFGKKRANVVTTPSTNRKNKKNKTKETPPTAHLILPEQHMSLAQQKADKNKINGEPRGGGAGGNSDS
DNLDSTDCNSESSSGGKSQELNFVMDVNSSKYPSLLLHSQEEKTSTATSKTQTRLEGEVTPNSLSTSYKTVSLPLSSPNIKLNLTSPKRG
QKREEGWKEVVRRSKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDKNGERMITIRGGTESTRTAVQLINALIQDPAKELEDL
IPKNHIRTPASTKSIHANFSSGVGTTAASSKNAFPLGAPTLVTSQATTLSTFQPANKLNKNVPTNVRSSFPVSLPLATPHPHFALLAAQT
MQQIRHPRLPMAQFGGTFSPSPNTWGPFPVRPVNPGNTNSSPKHNNTSRLPNQNGTVLPSESAGLATASCPITVSSVVAASQQLCVTNTR
TPSSVRKQLFACVPKTSPPATVISSVTSTCSSLPSVSSAPITSGQAPTTFLPASTSQAQLSSQKMESFSAVPPTKEKVSTQDQPMANLCT
PSSTANSCSSSASNTPGAPETHPSSSPTPTSSNTQEEAQPSSVSDLSPMSMPFASNSEPAPLTLTSPRMVAADNQDTSNLPQLAVPAPRV
SHRMQPRGSFYSMVPNATIHQDPQSIFVTNPVTLTPPQGPPAAVQLSSAVNIMNGSQMHINPANKSLPPTFGPATLFNHFSSLFDSSQVP
ANQGWGDGPLSSRVATDASFTVQSAFLGNSVLGHLENMHPDNSKAPGFRPPSQRVSTSPVGLPSIDPSGSSPSSSSAPLASFSGIPGTRV
FLQGPAPVGTPSFNRQHFSPHPWTSASNSSTSAPPTLGQPKGVSASQDRKIPPPIGTERLARIRQGGSVAQAPAGTSFVAPVGHSGIWSF
GVNAVSEGLSGWSQSVMGNHPMHQQLSDPSTFSQHQPMERDDSGMVAPSNIFHQPMASGFVDFSKGLPISMTGGTIIPSHPQLADVPGGP
LFNGLHNPDPAWNPMIKVIQNSTECTDAQQASLLPSVPALKGEIPSPQLTRPKKRIGRPMVASPNQRHQDHLRPKVPAGVQELTHCPDTP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PCDHA11_ENST00000398640_chr5_140251079_+_ANKHD1_ENST00000360839_chr5_139892948_+_5820nt
ATGTTTGGTTTTCAGAGAAGGGGATTGGGCACCCCACGACTACAGCTCTGGCTTCTCCTCCTCGAATTCTGGGAGGTGGGGAGCGGCCAG
CTCCACTACTCCGTCTCGGAGGAGGCCAAACACGGCACCTTCGTGGGCCGCATCGCGCAGGACCTGGGGCTGGAGCTGGCGGAGCTGGTG
CAGCGCCTGTTCCGGGTGGCGTCCAAAACACATGGGGACCTTCTGGAGGTAAATCTGCAGAATGGCATTTTGTTTGTGAATTCTCGGATC
GACCGCGAGGAGCTGTGCGGGCAGAGCGCGGAGTGCAGCATCCACCTGGAGGTGATCGTGGACAGGCCGCTGCAGGTTTTCCATGTGAAC
GTGGAGGTGAAGGACATTAACGACAACCCGCCGGTGTTCTCGCTCAGAGAACAAAAGCTGCTGATTGCGGAATCTAAGCAATCGGACTCG
CGTTTTCCACTAGAGGGAGCTTCTGATGCTGACATTGAAGAGAATGCTCTATTGACCTACAGGCTAAGTAAAAATGAGTATTTTTCTTTA
GATTCACCAACAAATGGTAAGCAGATTAAAAGACTGTCACTTATTTTAAAGAAGTCTCTGGATAGAGAGAAAACTCCGGAACTTAATTTG
CTGCTAACAGCTACAGACGGGGGAAAACCAGAGCTTACTGGCACCGTTCGGCTGTTAGTCCAAGTCTTGGATGTCAACGACAATGATCCA
GAGTTTGATAAATCAGAATATAAGGTGAGCCTTATGGAAAATGCTGCTAAAGAAACTCTTGTGCTCAAACTAAACGCCACAGACCGAGAC
GAAGGAGTCAATGGAGAGGTAACATACTCCTTAATGTCAATTAAGCCCAATGGAAGACACTTATTTACACTAGATCAAAATAATGGAGAA
GTGAGGGTCAATGGAACTTTAGATTATGAAGAAAACAAGTTTTATAAAATTGAAGTACAGGCTACAGATAAGGGGACTCCCCCAATGGCA
GGTCACTGTACAGTCTGGGTGGAAATCTTGGACACCAACGATAACTCTCCTGAAGTCGCCGTGACTTCCTTGTCCCTCCCAGTACGAGAG
GACGCTCAGCCCAGCACGGTCATTGCCCTGATCAGCGTGTCTGACCGTGACTCAGGTGTCAACGGACAGGTGACCTGCTCGCTGACGCCC
CACGTTCCCTTCAAGCTGGTGTCCACCTTCAAGAATTACTACTCGTTGGTGCTGGACAGCGCCCTGGACCGCGAGAACGTGTGGGCCTAT
GAACTGGTGGTGACTGCGCGGGATGGGGGTTCGCCTTCTCTGTGGGCCACGGCCAGGGTATCCGTGGAGGTGGCCGACGTGAACGACAAT
GCGCCTGCGTTCGCACAGCCCGAGTACACCGTGTTCGTGAAGGAGAACAACCCACCAGGCTGCCACATCTTCACAGTGTCGGCGCGGGAC
GCGGACGCGCAGGAGAACGCGCTGGTGTCCTACTCGCTGGTGGAGCGGCGGTTGGGCGACCGCGCGCTGTCGAGCTACGTGTCGGTGCAC
GCGGAGAGCGGCAAGGTGTACGCGCTGCAGCCGTTGGACCACGAGGAGCTGGAGCTGCTACAGTTCCAGGTGAGCGCGCGCGATGCGGGC
GTGCCGCCTCTGAGCAGCAACGTGACGCTGCAGGTGTTCGTGCTGGACGAGAACGACAACGCGCCGGCACTGCTGGCGACTCAGGCTGGC
AGCGCGGGAGGCGCAGTTAACAAGCTAGTACCGCGGTCGGTGGGTGCGGGCCACGTGGTGGCGAAGGTGCGCGCAGTGGATGCGGACTCA
GGCTACAACGCGTGGCTTTCATATGAATTGCAGCCGGCGGCGGGCGGCTCGCGCATCCCGTTCCGCGTGGGGCTGTACACGGGCGAGATA
AGCACAACGCGTGCCCTGGACGAGGCAGACTCGCCGCGCCACCGACTTCTAGTACTGGTGAAGGATCACGGTGAGCCGGCGCTGACGGCC
ACGGCCACCGTGCTGGTGTCGTTGGTGGAGAGCGGACAGGCGCCAAAGGCCTCTTCCCGGACTTTGGCGGGCGCCGCGAGCCCAGAGGCT
GCGCTGGTGGATGTCAACGTGTACCTGATCATCGCCATCTGCGTGGTGTCCAGCCTCCTGGTACTCACGCTGCTGCTGTATACGGCGCTG
TGGTGGTCGGCAACGCCCACTGAGGGCGCGTGCGCGCCGGGGAAGCCCACGCTGGTGTGCTCCCGCGCGGTGGGGAGCTGGTCATACTCG
CAGCAGAGGCGGCAGAGGGTGTGCTCTGAGGAGGGCCCACCTAAGACGGACCTCATGGCCTTCAGCCCCAGTCTTCCTCTAGGTCTGAAT
AAAGAGGAGGAAGGGGAAAGACAGGAGCCAGGGTCAAATCACCCCGGACAGGAACTGTTGAAAAAATGTCATCAATGTGTCGAAACCATT
GTGAAGGCTAAAGACCAGCAAGCTGCAGAAGCAAATAAGAATGCGAGTATTCTTTTAAAGGAACTTGATCTGGAAAAGTCAAGAGAAGAG
AGCAGAAAGCAGGCTCTTGCTGCTAAAAGAGAAAAAAGAAAAGAAAAGAGAAAAAAGAAAAAAGAGGAACAGAAAAGGAAACAGGAAGAA
GATGAAGAAAACAAACCTAAGGAGAATTCGGAACTACCAGAGGATGAAGATGAAGAGGAGAATGATGAAGATGTGGAGCAAGAAGTTCCC
ATAGAACCTCCTAGTGCAACCACCACCACTACGATTGGAATCTCTGCAACATCTGCAACATTCACAAATGTGTTTGGGAAAAAAAGGGCC
AATGTGGTGACAACTCCCAGCACCAATCGGAAAAATAAGAAGAACAAAACAAAAGAAACCCCTCCTACAGCACATTTAATTTTACCAGAA
CAACATATGTCTTTAGCCCAACAAAAGGCAGATAAAAATAAAATAAATGGAGAACCTAGAGGTGGTGGTGCAGGTGGGAATAGTGATTCA
GATAACTTGGACAGCACAGACTGCAACAGTGAGAGTAGCAGTGGTGGTAAAAGCCAAGAGTTAAATTTTGTGATGGATGTGAATTCCTCT
AAATACCCCTCACTGCTCCTTCATTCCCAAGAAGAAAAGACAAGTACTGCTACTTCCAAAACTCAGACACGACTTGAAGGTGAAGTGACT
CCTAATTCCTTGTCAACCAGCTACAAGACAGTGTCATTGCCATTAAGCTCTCCAAACATAAAGCTGAATCTCACTAGCCCTAAAAGGGGT
CAGAAAAGAGAAGAAGGGTGGAAAGAAGTTGTACGAAGGTCAAAGAAATTGTCTGTTCCAGCCTCAGTGGTGTCGAGGATAATGGGAAGA
GGAGGATGCAACATCACTGCAATACAGGATGTTACTGGTGCCCATATTGATGTGGATAAACAAAAAGATAAGAATGGCGAGAGAATGATC
ACAATAAGGGGTGGCACAGAATCAACAAGATATGCAGTTCAACTAATCAATGCACTCATTCAAGATCCTGCTAAGGAACTGGAAGACTTG
ATTCCTAAAAATCATATCAGAACACCTGCCAGCACCAAATCAATTCATGCTAACTTCTCATCTGGAGTAGGTACCACAGCAGCTTCCAGT
AAAAATGCATTTCCTTTGGGTGCTCCAACTCTTGTAACTTCACAGGCAACAACGTTATCTACGTTCCAGCCCGCTAATAAACTTAATAAG
AATGTTCCAACAAATGTACGTTCTTCTTTCCCAGTTTCTCTACCCTTAGCTTATCCTCACCCTCATTTTGCCCTGCTGGCTGCTCAAACT
ATGCAACAGATTCGGCATCCTCGCTTACCCATGGCCCAGTTTGGAGGAACCTTCTCACCTTCTCCTAACACATGGGGACCATTCCCAGTG
AGACCTGTGAATCCTGGCAACACAAATAGCTCTCCAAAGCATAATAACACAAGCCGTCTACCTAACCAGAACGGGACTGTTTTACCCTCA
GAGTCTGCTGGACTAGCTACTGCCAGTTGTCCTATCACTGTCTCTTCTGTAGTTGCTGCCAGTCAGCAACTGTGTGTCACTAATACCCGG
ACTCCTTCATCAGTCAGAAAGCAGTTGTTTGCCTGTGTGCCTAAGACAAGTCCTCCAGCAACAGTGATTTCTTCTGTGACAAGCACTTGT
AGTTCCCTGCCTTCTGTCTCCTCTGCACCTATCACTAGCGGGCAAGCTCCCACCACATTTCTACCTGCAAGTACTTCTCAAGCACAGCTT
TCTTCACAAAAGATGGAGTCTTTCTCTGCTGTGCCACCCACCAAAGAGAAAGTGTCCACACAGGACCAGCCCATGGCAAACCTATGTACC
CCATCTTCAACTGCAAACAGTTGCAGTAGCTCTGCCAGCAACACCCCGGGAGCTCCAGAAACTCACCCATCCAGTAGTCCCACTCCTACT
TCCAGTAACACACAAGAGGAGGCACAGCCATCCAGTGTGTCTGATTTAAGTCCTATGTCAATGCCTTTTGCATCTAACTCAGAACCTGCT
CCATTGACTTTGACATCACCCAGAATGGTTGCTGCTGATAATCAGGACACCAGTAATTTACCTCAGTTAGCTGTACCAGCACCTCGAGTT
TCTCATCGAATGCAGCCCAGAGGTTCTTTTTACTCCATGGTACCAAATGCAACTATTCACCAGGATCCCCAGTCTATTTTTGTTACGAAT
CCAGTTACTTTAACACCACCTCAAGGCCCACCAGCTGCAGTGCAGCTTTCTTCAGCTGTGAACATTATGAATGGTTCTCAGATGCACATA
AACCCAGCAAATAAGTCTTTGCCACCTACATTTGGCCCAGCCACACTTTTCAATCACTTCAGCAGTCTTTTTGATAGTAGTCAGGTGCCA
GCTAACCAGGGCTGGGGAGATGGTCCACTGTCCTCACGAGTTGCTACAGATGCCTCTTTCACTGTTCAGTCAGCGTTCCTGGGTAACTCA
GTGCTTGGACACTTGGAAAACATGCACCCTGATAACTCAAAGGCACCTGGCTTCAGACCACCTTCCCAGCGAGTTTCTACTAGTCCAGTT
GGGTTACCATCCATTGACCCATCAGGCAGCTCCCCATCTTCCTCTTCTGCTCCTCTGGCAAGTTTTTCCGGCATACCAGGAACAAGGGTT
TTCCTGCAAGGGCCAGCTCCTGTTGGGACTCCTAGTTTCAACAGACAACATTTTTCTCCCCATCCTTGGACAAGCGCCTCAAACTCATCC
ACTTCTGCCCCACCAACGTTGGGCCAACCAAAAGGAGTCAGTGCCAGTCAAGATCGAAAGATACCTCCCCCAATTGGAACAGAGAGACTG
GCCCGAATTCGGCAAGGAGGGTCTGTTGCACAAGCCCCGGCGGGGACCAGTTTTGTCGCTCCCGTTGGACACAGTGGAATCTGGTCATTT
GGTGTCAATGCTGTGTCAGAAGGCTTATCAGGTTGGTCGCAATCTGTGATGGGGAACCATCCAATGCATCAACAATTATCAGACCCAAGC
ACATTCTCCCAACATCAGCCAATGGAGAGAGATGATTCTGGAATGGTAGCCCCCTCTAACATTTTTCATCAGCCTATGGCAAGTGGTTTT
GTGGATTTTTCTAAAGGTCTGCCAATTTCCATGTATGGAGGCACCATAATACCCTCTCATCCTCAGCTTGCTGATGTTCCAGGAGGCCCT
CTGTTTAATGGACTTCACAATCCAGATCCTGCTTGGAACCCTATGATAAAAGTTATCCAAAATTCAACTGAATGCACTGATGCCCAGCAG

>In-frame_PCDHA11_ENST00000398640_chr5_140251079_+_ANKHD1_ENST00000297183_chr5_139892948_+_6045nt
ATGTTTGGTTTTCAGAGAAGGGGATTGGGCACCCCACGACTACAGCTCTGGCTTCTCCTCCTCGAATTCTGGGAGGTGGGGAGCGGCCAG
CTCCACTACTCCGTCTCGGAGGAGGCCAAACACGGCACCTTCGTGGGCCGCATCGCGCAGGACCTGGGGCTGGAGCTGGCGGAGCTGGTG
CAGCGCCTGTTCCGGGTGGCGTCCAAAACACATGGGGACCTTCTGGAGGTAAATCTGCAGAATGGCATTTTGTTTGTGAATTCTCGGATC
GACCGCGAGGAGCTGTGCGGGCAGAGCGCGGAGTGCAGCATCCACCTGGAGGTGATCGTGGACAGGCCGCTGCAGGTTTTCCATGTGAAC
GTGGAGGTGAAGGACATTAACGACAACCCGCCGGTGTTCTCGCTCAGAGAACAAAAGCTGCTGATTGCGGAATCTAAGCAATCGGACTCG
CGTTTTCCACTAGAGGGAGCTTCTGATGCTGACATTGAAGAGAATGCTCTATTGACCTACAGGCTAAGTAAAAATGAGTATTTTTCTTTA
GATTCACCAACAAATGGTAAGCAGATTAAAAGACTGTCACTTATTTTAAAGAAGTCTCTGGATAGAGAGAAAACTCCGGAACTTAATTTG
CTGCTAACAGCTACAGACGGGGGAAAACCAGAGCTTACTGGCACCGTTCGGCTGTTAGTCCAAGTCTTGGATGTCAACGACAATGATCCA
GAGTTTGATAAATCAGAATATAAGGTGAGCCTTATGGAAAATGCTGCTAAAGAAACTCTTGTGCTCAAACTAAACGCCACAGACCGAGAC
GAAGGAGTCAATGGAGAGGTAACATACTCCTTAATGTCAATTAAGCCCAATGGAAGACACTTATTTACACTAGATCAAAATAATGGAGAA
GTGAGGGTCAATGGAACTTTAGATTATGAAGAAAACAAGTTTTATAAAATTGAAGTACAGGCTACAGATAAGGGGACTCCCCCAATGGCA
GGTCACTGTACAGTCTGGGTGGAAATCTTGGACACCAACGATAACTCTCCTGAAGTCGCCGTGACTTCCTTGTCCCTCCCAGTACGAGAG
GACGCTCAGCCCAGCACGGTCATTGCCCTGATCAGCGTGTCTGACCGTGACTCAGGTGTCAACGGACAGGTGACCTGCTCGCTGACGCCC
CACGTTCCCTTCAAGCTGGTGTCCACCTTCAAGAATTACTACTCGTTGGTGCTGGACAGCGCCCTGGACCGCGAGAACGTGTGGGCCTAT
GAACTGGTGGTGACTGCGCGGGATGGGGGTTCGCCTTCTCTGTGGGCCACGGCCAGGGTATCCGTGGAGGTGGCCGACGTGAACGACAAT
GCGCCTGCGTTCGCACAGCCCGAGTACACCGTGTTCGTGAAGGAGAACAACCCACCAGGCTGCCACATCTTCACAGTGTCGGCGCGGGAC
GCGGACGCGCAGGAGAACGCGCTGGTGTCCTACTCGCTGGTGGAGCGGCGGTTGGGCGACCGCGCGCTGTCGAGCTACGTGTCGGTGCAC
GCGGAGAGCGGCAAGGTGTACGCGCTGCAGCCGTTGGACCACGAGGAGCTGGAGCTGCTACAGTTCCAGGTGAGCGCGCGCGATGCGGGC
GTGCCGCCTCTGAGCAGCAACGTGACGCTGCAGGTGTTCGTGCTGGACGAGAACGACAACGCGCCGGCACTGCTGGCGACTCAGGCTGGC
AGCGCGGGAGGCGCAGTTAACAAGCTAGTACCGCGGTCGGTGGGTGCGGGCCACGTGGTGGCGAAGGTGCGCGCAGTGGATGCGGACTCA
GGCTACAACGCGTGGCTTTCATATGAATTGCAGCCGGCGGCGGGCGGCTCGCGCATCCCGTTCCGCGTGGGGCTGTACACGGGCGAGATA
AGCACAACGCGTGCCCTGGACGAGGCAGACTCGCCGCGCCACCGACTTCTAGTACTGGTGAAGGATCACGGTGAGCCGGCGCTGACGGCC
ACGGCCACCGTGCTGGTGTCGTTGGTGGAGAGCGGACAGGCGCCAAAGGCCTCTTCCCGGACTTTGGCGGGCGCCGCGAGCCCAGAGGCT
GCGCTGGTGGATGTCAACGTGTACCTGATCATCGCCATCTGCGTGGTGTCCAGCCTCCTGGTACTCACGCTGCTGCTGTATACGGCGCTG
TGGTGGTCGGCAACGCCCACTGAGGGCGCGTGCGCGCCGGGGAAGCCCACGCTGGTGTGCTCCCGCGCGGTGGGGAGCTGGTCATACTCG
CAGCAGAGGCGGCAGAGGGTGTGCTCTGAGGAGGGCCCACCTAAGACGGACCTCATGGCCTTCAGCCCCAGTCTTCCTCTAGGTCTGAAT
AAAGAGGAGGAAGGGGAAAGACAGGAGCCAGGGTCAAATCACCCCGGACAGGAACTGTTGAAAAAATGTCATCAATGTGTCGAAACCATT
GTGAAGGCTAAAGACCAGCAAGCTGCAGAAGCAAATAAGAATGCGAGTATTCTTTTAAAGGAACTTGATCTGGAAAAGTCAAGAGAAGAG
AGCAGAAAGCAGGCTCTTGCTGCTAAAAGAGAAAAAAGAAAAGAAAAGAGAAAAAAGAAAAAAGAGGAACAGAAAAGGAAACAGGAAGAA
GATGAAGAAAACAAACCTAAGGAGAATTCGGAACTACCAGAGGATGAAGATGAAGAGGAGAATGATGAAGATGTGGAGCAAGAAGTTCCC
ATAGAACCTCCTAGTGCAACCACCACCACTACGATTGGAATCTCTGCAACATCTGCAACATTCACAAATGTGTTTGGGAAAAAAAGGGCC
AATGTGGTGACAACTCCCAGCACCAATCGGAAAAATAAGAAGAACAAAACAAAAGAAACCCCTCCTACAGCACATTTAATTTTACCAGAA
CAACATATGTCTTTAGCCCAACAAAAGGCAGATAAAAATAAAATAAATGGAGAACCTAGAGGTGGTGGTGCAGGTGGGAATAGTGATTCA
GATAACTTGGACAGCACAGACTGCAACAGTGAGAGTAGCAGTGGTGGTAAAAGCCAAGAGTTAAATTTTGTGATGGATGTGAATTCCTCT
AAATACCCCTCACTGCTCCTTCATTCCCAAGAAGAAAAGACAAGTACTGCTACTTCCAAAACTCAGACACGACTTGAAGGTGAAGTGACT
CCTAATTCCTTGTCAACCAGCTACAAGACAGTGTCATTGCCATTAAGCTCTCCAAACATAAAGCTGAATCTCACTAGCCCTAAAAGGGGT
CAGAAAAGAGAAGAAGGGTGGAAAGAAGTTGTACGAAGGTCAAAGAAATTGTCTGTTCCAGCCTCAGTGGTGTCGAGGATAATGGGAAGA
GGAGGATGCAACATCACTGCAATACAGGATGTTACTGGTGCCCATATTGATGTGGATAAACAAAAAGATAAGAATGGCGAGAGAATGATC
ACAATAAGGGGTGGCACAGAATCAACAAGATATGCAGTTCAACTAATCAATGCACTCATTCAAGATCCTGCTAAGGAACTGGAAGACTTG
ATTCCTAAAAATCATATCAGAACACCTGCCAGCACCAAATCAATTCATGCTAACTTCTCATCTGGAGTAGGTACCACAGCAGCTTCCAGT
AAAAATGCATTTCCTTTGGGTGCTCCAACTCTTGTAACTTCACAGGCAACAACGTTATCTACGTTCCAGCCCGCTAATAAACTTAATAAG
AATGTTCCAACAAATGTACGTTCTTCTTTCCCAGTTTCTCTACCCTTAGCTTATCCTCACCCTCATTTTGCCCTGCTGGCTGCTCAAACT
ATGCAACAGATTCGGCATCCTCGCTTACCCATGGCCCAGTTTGGAGGAACCTTCTCACCTTCTCCTAACACATGGGGACCATTCCCAGTG
AGACCTGTGAATCCTGGCAACACAAATAGCTCTCCAAAGCATAATAACACAAGCCGTCTACCTAACCAGAACGGGACTGTTTTACCCTCA
GAGTCTGCTGGACTAGCTACTGCCAGTTGTCCTATCACTGTCTCTTCTGTAGTTGCTGCCAGTCAGCAACTGTGTGTCACTAATACCCGG
ACTCCTTCATCAGTCAGAAAGCAGTTGTTTGCCTGTGTGCCTAAGACAAGTCCTCCAGCAACAGTGATTTCTTCTGTGACAAGCACTTGT
AGTTCCCTGCCTTCTGTCTCCTCTGCACCTATCACTAGCGGGCAAGCTCCCACCACATTTCTACCTGCAAGTACTTCTCAAGCACAGCTT
TCTTCACAAAAGATGGAGTCTTTCTCTGCTGTGCCACCCACCAAAGAGAAAGTGTCCACACAGGACCAGCCCATGGCAAACCTATGTACC
CCATCTTCAACTGCAAACAGTTGCAGTAGCTCTGCCAGCAACACCCCGGGAGCTCCAGAAACTCACCCATCCAGTAGTCCCACTCCTACT
TCCAGTAACACACAAGAGGAGGCACAGCCATCCAGTGTGTCTGATTTAAGTCCTATGTCAATGCCTTTTGCATCTAACTCAGAACCTGCT
CCATTGACTTTGACATCACCCAGAATGGTTGCTGCTGATAATCAGGACACCAGTAATTTACCTCAGTTAGCTGTACCAGCACCTCGAGTT
TCTCATCGAATGCAGCCCAGAGGTTCTTTTTACTCCATGGTACCAAATGCAACTATTCACCAGGATCCCCAGTCTATTTTTGTTACGAAT
CCAGTTACTTTAACACCACCTCAAGGCCCACCAGCTGCAGTGCAGCTTTCTTCAGCTGTGAACATTATGAATGGTTCTCAGATGCACATA
AACCCAGCAAATAAGTCTTTGCCACCTACATTTGGCCCAGCCACACTTTTCAATCACTTCAGCAGTCTTTTTGATAGTAGTCAGGTGCCA
GCTAACCAGGGCTGGGGAGATGGTCCACTGTCCTCACGAGTTGCTACAGATGCCTCTTTCACTGTTCAGTCAGCGTTCCTGGGTAACTCA
GTGCTTGGACACTTGGAAAACATGCACCCTGATAACTCAAAGGCACCTGGCTTCAGACCACCTTCCCAGCGAGTTTCTACTAGTCCAGTT
GGGTTACCATCCATTGACCCATCAGGCAGCTCCCCATCTTCCTCTTCTGCTCCTCTGGCAAGTTTTTCCGGCATACCAGGAACAAGGGTT
TTCCTGCAAGGGCCAGCTCCTGTTGGGACTCCTAGTTTCAACAGACAACATTTTTCTCCCCATCCTTGGACAAGCGCCTCAAACTCATCC
ACTTCTGCCCCACCAACGTTGGGCCAACCAAAAGGAGTCAGTGCCAGTCAAGATCGAAAGATACCTCCCCCAATTGGAACAGAGAGACTG
GCCCGAATTCGGCAAGGAGGGTCTGTTGCACAAGCCCCGGCGGGGACCAGTTTTGTCGCTCCCGTTGGACACAGTGGAATCTGGTCATTT
GGTGTCAATGCTGTGTCAGAAGGCTTATCAGGTTGGTCGCAATCTGTGATGGGGAACCATCCAATGCATCAACAATTATCAGACCCAAGC
ACATTCTCCCAACATCAGCCAATGGAGAGAGATGATTCTGGAATGGTAGCCCCCTCTAACATTTTTCATCAGCCTATGGCAAGTGGTTTT
GTGGATTTTTCTAAAGGTCTGCCAATTTCCATGTATGGAGGCACCATAATACCCTCTCATCCTCAGCTTGCTGATGTTCCAGGAGGCCCT
CTGTTTAATGGACTTCACAATCCAGATCCTGCTTGGAACCCTATGATAAAAGTTATCCAAAATTCAACTGAATGCACTGATGCCCAGCAG
GCCAGTCTGCTTCCTTCAGTCCCTGCTCTCAAAGGGGAAATCCCATCACCTCAGCTAACCAGACCGAAGAAGAGAATTGGACGGCCGATG
GTGGCCTCTCCTAACCAGAGGCACCAGGATCATCTACGACCGAAAGTTCCTGCTGGAGTGCAAGAACTCACCCATTGCCCGGACACCCCC
CTGCTGCCTCCCTCAGATTCCCGGGGTCACAACTCCTCCAACAGCCCCTCTCTCCAAGCTGGAGGAGCTGAAGGAGCAGGAGACAGAGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PCDHA11_ENST00000398640_chr5_140251079_+_ANKHD1_ENST00000360839_chr5_139892948_+_6258nt
ATGTTTGGTTTTCAGAGAAGGGGATTGGGCACCCCACGACTACAGCTCTGGCTTCTCCTCCTCGAATTCTGGGAGGTGGGGAGCGGCCAG
CTCCACTACTCCGTCTCGGAGGAGGCCAAACACGGCACCTTCGTGGGCCGCATCGCGCAGGACCTGGGGCTGGAGCTGGCGGAGCTGGTG
CAGCGCCTGTTCCGGGTGGCGTCCAAAACACATGGGGACCTTCTGGAGGTAAATCTGCAGAATGGCATTTTGTTTGTGAATTCTCGGATC
GACCGCGAGGAGCTGTGCGGGCAGAGCGCGGAGTGCAGCATCCACCTGGAGGTGATCGTGGACAGGCCGCTGCAGGTTTTCCATGTGAAC
GTGGAGGTGAAGGACATTAACGACAACCCGCCGGTGTTCTCGCTCAGAGAACAAAAGCTGCTGATTGCGGAATCTAAGCAATCGGACTCG
CGTTTTCCACTAGAGGGAGCTTCTGATGCTGACATTGAAGAGAATGCTCTATTGACCTACAGGCTAAGTAAAAATGAGTATTTTTCTTTA
GATTCACCAACAAATGGTAAGCAGATTAAAAGACTGTCACTTATTTTAAAGAAGTCTCTGGATAGAGAGAAAACTCCGGAACTTAATTTG
CTGCTAACAGCTACAGACGGGGGAAAACCAGAGCTTACTGGCACCGTTCGGCTGTTAGTCCAAGTCTTGGATGTCAACGACAATGATCCA
GAGTTTGATAAATCAGAATATAAGGTGAGCCTTATGGAAAATGCTGCTAAAGAAACTCTTGTGCTCAAACTAAACGCCACAGACCGAGAC
GAAGGAGTCAATGGAGAGGTAACATACTCCTTAATGTCAATTAAGCCCAATGGAAGACACTTATTTACACTAGATCAAAATAATGGAGAA
GTGAGGGTCAATGGAACTTTAGATTATGAAGAAAACAAGTTTTATAAAATTGAAGTACAGGCTACAGATAAGGGGACTCCCCCAATGGCA
GGTCACTGTACAGTCTGGGTGGAAATCTTGGACACCAACGATAACTCTCCTGAAGTCGCCGTGACTTCCTTGTCCCTCCCAGTACGAGAG
GACGCTCAGCCCAGCACGGTCATTGCCCTGATCAGCGTGTCTGACCGTGACTCAGGTGTCAACGGACAGGTGACCTGCTCGCTGACGCCC
CACGTTCCCTTCAAGCTGGTGTCCACCTTCAAGAATTACTACTCGTTGGTGCTGGACAGCGCCCTGGACCGCGAGAACGTGTGGGCCTAT
GAACTGGTGGTGACTGCGCGGGATGGGGGTTCGCCTTCTCTGTGGGCCACGGCCAGGGTATCCGTGGAGGTGGCCGACGTGAACGACAAT
GCGCCTGCGTTCGCACAGCCCGAGTACACCGTGTTCGTGAAGGAGAACAACCCACCAGGCTGCCACATCTTCACAGTGTCGGCGCGGGAC
GCGGACGCGCAGGAGAACGCGCTGGTGTCCTACTCGCTGGTGGAGCGGCGGTTGGGCGACCGCGCGCTGTCGAGCTACGTGTCGGTGCAC
GCGGAGAGCGGCAAGGTGTACGCGCTGCAGCCGTTGGACCACGAGGAGCTGGAGCTGCTACAGTTCCAGGTGAGCGCGCGCGATGCGGGC
GTGCCGCCTCTGAGCAGCAACGTGACGCTGCAGGTGTTCGTGCTGGACGAGAACGACAACGCGCCGGCACTGCTGGCGACTCAGGCTGGC
AGCGCGGGAGGCGCAGTTAACAAGCTAGTACCGCGGTCGGTGGGTGCGGGCCACGTGGTGGCGAAGGTGCGCGCAGTGGATGCGGACTCA
GGCTACAACGCGTGGCTTTCATATGAATTGCAGCCGGCGGCGGGCGGCTCGCGCATCCCGTTCCGCGTGGGGCTGTACACGGGCGAGATA
AGCACAACGCGTGCCCTGGACGAGGCAGACTCGCCGCGCCACCGACTTCTAGTACTGGTGAAGGATCACGGTGAGCCGGCGCTGACGGCC
ACGGCCACCGTGCTGGTGTCGTTGGTGGAGAGCGGACAGGCGCCAAAGGCCTCTTCCCGGACTTTGGCGGGCGCCGCGAGCCCAGAGGCT
GCGCTGGTGGATGTCAACGTGTACCTGATCATCGCCATCTGCGTGGTGTCCAGCCTCCTGGTACTCACGCTGCTGCTGTATACGGCGCTG
TGGTGGTCGGCAACGCCCACTGAGGGCGCGTGCGCGCCGGGGAAGCCCACGCTGGTGTGCTCCCGCGCGGTGGGGAGCTGGTCATACTCG
CAGCAGAGGCGGCAGAGGGTGTGCTCTGAGGAGGGCCCACCTAAGACGGACCTCATGGCCTTCAGCCCCAGTCTTCCTCTAGGTCTGAAT
AAAGAGGAGGAAGGGGAAAGACAGGAGCCAGGGTCAAATCACCCCGGACAGGAACTGTTGAAAAAATGTCATCAATGTGTCGAAACCATT
GTGAAGGCTAAAGACCAGCAAGCTGCAGAAGCAAATAAGAATGCGAGTATTCTTTTAAAGGAACTTGATCTGGAAAAGTCAAGAGAAGAG
AGCAGAAAGCAGGCTCTTGCTGCTAAAAGAGAAAAAAGAAAAGAAAAGAGAAAAAAGAAAAAAGAGGAACAGAAAAGGAAACAGGAAGAA
GATGAAGAAAACAAACCTAAGGAGAATTCGGAACTACCAGAGGATGAAGATGAAGAGGAGAATGATGAAGATGTGGAGCAAGAAGTTCCC
ATAGAACCTCCTAGTGCAACCACCACCACTACGATTGGAATCTCTGCAACATCTGCAACATTCACAAATGTGTTTGGGAAAAAAAGGGCC
AATGTGGTGACAACTCCCAGCACCAATCGGAAAAATAAGAAGAACAAAACAAAAGAAACCCCTCCTACAGCACATTTAATTTTACCAGAA
CAACATATGTCTTTAGCCCAACAAAAGGCAGATAAAAATAAAATAAATGGAGAACCTAGAGGTGGTGGTGCAGGTGGGAATAGTGATTCA
GATAACTTGGACAGCACAGACTGCAACAGTGAGAGTAGCAGTGGTGGTAAAAGCCAAGAGTTAAATTTTGTGATGGATGTGAATTCCTCT
AAATACCCCTCACTGCTCCTTCATTCCCAAGAAGAAAAGACAAGTACTGCTACTTCCAAAACTCAGACACGACTTGAAGGTGAAGTGACT
CCTAATTCCTTGTCAACCAGCTACAAGACAGTGTCATTGCCATTAAGCTCTCCAAACATAAAGCTGAATCTCACTAGCCCTAAAAGGGGT
CAGAAAAGAGAAGAAGGGTGGAAAGAAGTTGTACGAAGGTCAAAGAAATTGTCTGTTCCAGCCTCAGTGGTGTCGAGGATAATGGGAAGA
GGAGGATGCAACATCACTGCAATACAGGATGTTACTGGTGCCCATATTGATGTGGATAAACAAAAAGATAAGAATGGCGAGAGAATGATC
ACAATAAGGGGTGGCACAGAATCAACAAGATATGCAGTTCAACTAATCAATGCACTCATTCAAGATCCTGCTAAGGAACTGGAAGACTTG
ATTCCTAAAAATCATATCAGAACACCTGCCAGCACCAAATCAATTCATGCTAACTTCTCATCTGGAGTAGGTACCACAGCAGCTTCCAGT
AAAAATGCATTTCCTTTGGGTGCTCCAACTCTTGTAACTTCACAGGCAACAACGTTATCTACGTTCCAGCCCGCTAATAAACTTAATAAG
AATGTTCCAACAAATGTACGTTCTTCTTTCCCAGTTTCTCTACCCTTAGCTTATCCTCACCCTCATTTTGCCCTGCTGGCTGCTCAAACT
ATGCAACAGATTCGGCATCCTCGCTTACCCATGGCCCAGTTTGGAGGAACCTTCTCACCTTCTCCTAACACATGGGGACCATTCCCAGTG
AGACCTGTGAATCCTGGCAACACAAATAGCTCTCCAAAGCATAATAACACAAGCCGTCTACCTAACCAGAACGGGACTGTTTTACCCTCA
GAGTCTGCTGGACTAGCTACTGCCAGTTGTCCTATCACTGTCTCTTCTGTAGTTGCTGCCAGTCAGCAACTGTGTGTCACTAATACCCGG
ACTCCTTCATCAGTCAGAAAGCAGTTGTTTGCCTGTGTGCCTAAGACAAGTCCTCCAGCAACAGTGATTTCTTCTGTGACAAGCACTTGT
AGTTCCCTGCCTTCTGTCTCCTCTGCACCTATCACTAGCGGGCAAGCTCCCACCACATTTCTACCTGCAAGTACTTCTCAAGCACAGCTT
TCTTCACAAAAGATGGAGTCTTTCTCTGCTGTGCCACCCACCAAAGAGAAAGTGTCCACACAGGACCAGCCCATGGCAAACCTATGTACC
CCATCTTCAACTGCAAACAGTTGCAGTAGCTCTGCCAGCAACACCCCGGGAGCTCCAGAAACTCACCCATCCAGTAGTCCCACTCCTACT
TCCAGTAACACACAAGAGGAGGCACAGCCATCCAGTGTGTCTGATTTAAGTCCTATGTCAATGCCTTTTGCATCTAACTCAGAACCTGCT
CCATTGACTTTGACATCACCCAGAATGGTTGCTGCTGATAATCAGGACACCAGTAATTTACCTCAGTTAGCTGTACCAGCACCTCGAGTT
TCTCATCGAATGCAGCCCAGAGGTTCTTTTTACTCCATGGTACCAAATGCAACTATTCACCAGGATCCCCAGTCTATTTTTGTTACGAAT
CCAGTTACTTTAACACCACCTCAAGGCCCACCAGCTGCAGTGCAGCTTTCTTCAGCTGTGAACATTATGAATGGTTCTCAGATGCACATA
AACCCAGCAAATAAGTCTTTGCCACCTACATTTGGCCCAGCCACACTTTTCAATCACTTCAGCAGTCTTTTTGATAGTAGTCAGGTGCCA
GCTAACCAGGGCTGGGGAGATGGTCCACTGTCCTCACGAGTTGCTACAGATGCCTCTTTCACTGTTCAGTCAGCGTTCCTGGGTAACTCA
GTGCTTGGACACTTGGAAAACATGCACCCTGATAACTCAAAGGCACCTGGCTTCAGACCACCTTCCCAGCGAGTTTCTACTAGTCCAGTT
GGGTTACCATCCATTGACCCATCAGGCAGCTCCCCATCTTCCTCTTCTGCTCCTCTGGCAAGTTTTTCCGGCATACCAGGAACAAGGGTT
TTCCTGCAAGGGCCAGCTCCTGTTGGGACTCCTAGTTTCAACAGACAACATTTTTCTCCCCATCCTTGGACAAGCGCCTCAAACTCATCC
ACTTCTGCCCCACCAACGTTGGGCCAACCAAAAGGAGTCAGTGCCAGTCAAGATCGAAAGATACCTCCCCCAATTGGAACAGAGAGACTG
GCCCGAATTCGGCAAGGAGGGTCTGTTGCACAAGCCCCGGCGGGGACCAGTTTTGTCGCTCCCGTTGGACACAGTGGAATCTGGTCATTT
GGTGTCAATGCTGTGTCAGAAGGCTTATCAGGTTGGTCGCAATCTGTGATGGGGAACCATCCAATGCATCAACAATTATCAGACCCAAGC
ACATTCTCCCAACATCAGCCAATGGAGAGAGATGATTCTGGAATGGTAGCCCCCTCTAACATTTTTCATCAGCCTATGGCAAGTGGTTTT
GTGGATTTTTCTAAAGGTCTGCCAATTTCCATGTATGGAGGCACCATAATACCCTCTCATCCTCAGCTTGCTGATGTTCCAGGAGGCCCT
CTGTTTAATGGACTTCACAATCCAGATCCTGCTTGGAACCCTATGATAAAAGTTATCCAAAATTCAACTGAATGCACTGATGCCCAGCAG
ATTTGGCCTGGCACGTGGGCACCTCATATTGGAAACATGCATCTCAAATATGTCAACTAAGTTAGAAGGTCTTTACTCTTTAGCCTTGTT
TAAGAAACCTATGACCTTGGAAGAACCATGGGGATTTTTTTTTAATGTGCCTAAGAAATTTTCTCTGAGGCTTTAGCAATGGAAATTTGA
TTGCCCATTGTATAAGAACAAATTGATTTCCTATCCACCTGATTATGTTCTCTGGTTAGTTTAGCCATTTTGAACTTAAGATCATATGAC
CTTAGTGCTTTTGGCTAAACATACAGAATACTACTTGTATGCAGAAGAGAATTAGTTGATTACATGTTTCAACCTTTTAGGGTGATAAAT
ACATGTATAATTGTTTACATACTTAAAAGGAAAAAGTTGAGTAAATTTCTTGTCATATAGTGGCTCTACGTAATGTAGCCTGTATTAATG

>In-frame_PCDHA11_ENST00000398640_chr5_140251079_+_ANKHD1_ENST00000297183_chr5_139892948_+_6386nt
ATGTTTGGTTTTCAGAGAAGGGGATTGGGCACCCCACGACTACAGCTCTGGCTTCTCCTCCTCGAATTCTGGGAGGTGGGGAGCGGCCAG
CTCCACTACTCCGTCTCGGAGGAGGCCAAACACGGCACCTTCGTGGGCCGCATCGCGCAGGACCTGGGGCTGGAGCTGGCGGAGCTGGTG
CAGCGCCTGTTCCGGGTGGCGTCCAAAACACATGGGGACCTTCTGGAGGTAAATCTGCAGAATGGCATTTTGTTTGTGAATTCTCGGATC
GACCGCGAGGAGCTGTGCGGGCAGAGCGCGGAGTGCAGCATCCACCTGGAGGTGATCGTGGACAGGCCGCTGCAGGTTTTCCATGTGAAC
GTGGAGGTGAAGGACATTAACGACAACCCGCCGGTGTTCTCGCTCAGAGAACAAAAGCTGCTGATTGCGGAATCTAAGCAATCGGACTCG
CGTTTTCCACTAGAGGGAGCTTCTGATGCTGACATTGAAGAGAATGCTCTATTGACCTACAGGCTAAGTAAAAATGAGTATTTTTCTTTA
GATTCACCAACAAATGGTAAGCAGATTAAAAGACTGTCACTTATTTTAAAGAAGTCTCTGGATAGAGAGAAAACTCCGGAACTTAATTTG
CTGCTAACAGCTACAGACGGGGGAAAACCAGAGCTTACTGGCACCGTTCGGCTGTTAGTCCAAGTCTTGGATGTCAACGACAATGATCCA
GAGTTTGATAAATCAGAATATAAGGTGAGCCTTATGGAAAATGCTGCTAAAGAAACTCTTGTGCTCAAACTAAACGCCACAGACCGAGAC
GAAGGAGTCAATGGAGAGGTAACATACTCCTTAATGTCAATTAAGCCCAATGGAAGACACTTATTTACACTAGATCAAAATAATGGAGAA
GTGAGGGTCAATGGAACTTTAGATTATGAAGAAAACAAGTTTTATAAAATTGAAGTACAGGCTACAGATAAGGGGACTCCCCCAATGGCA
GGTCACTGTACAGTCTGGGTGGAAATCTTGGACACCAACGATAACTCTCCTGAAGTCGCCGTGACTTCCTTGTCCCTCCCAGTACGAGAG
GACGCTCAGCCCAGCACGGTCATTGCCCTGATCAGCGTGTCTGACCGTGACTCAGGTGTCAACGGACAGGTGACCTGCTCGCTGACGCCC
CACGTTCCCTTCAAGCTGGTGTCCACCTTCAAGAATTACTACTCGTTGGTGCTGGACAGCGCCCTGGACCGCGAGAACGTGTGGGCCTAT
GAACTGGTGGTGACTGCGCGGGATGGGGGTTCGCCTTCTCTGTGGGCCACGGCCAGGGTATCCGTGGAGGTGGCCGACGTGAACGACAAT
GCGCCTGCGTTCGCACAGCCCGAGTACACCGTGTTCGTGAAGGAGAACAACCCACCAGGCTGCCACATCTTCACAGTGTCGGCGCGGGAC
GCGGACGCGCAGGAGAACGCGCTGGTGTCCTACTCGCTGGTGGAGCGGCGGTTGGGCGACCGCGCGCTGTCGAGCTACGTGTCGGTGCAC
GCGGAGAGCGGCAAGGTGTACGCGCTGCAGCCGTTGGACCACGAGGAGCTGGAGCTGCTACAGTTCCAGGTGAGCGCGCGCGATGCGGGC
GTGCCGCCTCTGAGCAGCAACGTGACGCTGCAGGTGTTCGTGCTGGACGAGAACGACAACGCGCCGGCACTGCTGGCGACTCAGGCTGGC
AGCGCGGGAGGCGCAGTTAACAAGCTAGTACCGCGGTCGGTGGGTGCGGGCCACGTGGTGGCGAAGGTGCGCGCAGTGGATGCGGACTCA
GGCTACAACGCGTGGCTTTCATATGAATTGCAGCCGGCGGCGGGCGGCTCGCGCATCCCGTTCCGCGTGGGGCTGTACACGGGCGAGATA
AGCACAACGCGTGCCCTGGACGAGGCAGACTCGCCGCGCCACCGACTTCTAGTACTGGTGAAGGATCACGGTGAGCCGGCGCTGACGGCC
ACGGCCACCGTGCTGGTGTCGTTGGTGGAGAGCGGACAGGCGCCAAAGGCCTCTTCCCGGACTTTGGCGGGCGCCGCGAGCCCAGAGGCT
GCGCTGGTGGATGTCAACGTGTACCTGATCATCGCCATCTGCGTGGTGTCCAGCCTCCTGGTACTCACGCTGCTGCTGTATACGGCGCTG
TGGTGGTCGGCAACGCCCACTGAGGGCGCGTGCGCGCCGGGGAAGCCCACGCTGGTGTGCTCCCGCGCGGTGGGGAGCTGGTCATACTCG
CAGCAGAGGCGGCAGAGGGTGTGCTCTGAGGAGGGCCCACCTAAGACGGACCTCATGGCCTTCAGCCCCAGTCTTCCTCTAGGTCTGAAT
AAAGAGGAGGAAGGGGAAAGACAGGAGCCAGGGTCAAATCACCCCGGACAGGAACTGTTGAAAAAATGTCATCAATGTGTCGAAACCATT
GTGAAGGCTAAAGACCAGCAAGCTGCAGAAGCAAATAAGAATGCGAGTATTCTTTTAAAGGAACTTGATCTGGAAAAGTCAAGAGAAGAG
AGCAGAAAGCAGGCTCTTGCTGCTAAAAGAGAAAAAAGAAAAGAAAAGAGAAAAAAGAAAAAAGAGGAACAGAAAAGGAAACAGGAAGAA
GATGAAGAAAACAAACCTAAGGAGAATTCGGAACTACCAGAGGATGAAGATGAAGAGGAGAATGATGAAGATGTGGAGCAAGAAGTTCCC
ATAGAACCTCCTAGTGCAACCACCACCACTACGATTGGAATCTCTGCAACATCTGCAACATTCACAAATGTGTTTGGGAAAAAAAGGGCC
AATGTGGTGACAACTCCCAGCACCAATCGGAAAAATAAGAAGAACAAAACAAAAGAAACCCCTCCTACAGCACATTTAATTTTACCAGAA
CAACATATGTCTTTAGCCCAACAAAAGGCAGATAAAAATAAAATAAATGGAGAACCTAGAGGTGGTGGTGCAGGTGGGAATAGTGATTCA
GATAACTTGGACAGCACAGACTGCAACAGTGAGAGTAGCAGTGGTGGTAAAAGCCAAGAGTTAAATTTTGTGATGGATGTGAATTCCTCT
AAATACCCCTCACTGCTCCTTCATTCCCAAGAAGAAAAGACAAGTACTGCTACTTCCAAAACTCAGACACGACTTGAAGGTGAAGTGACT
CCTAATTCCTTGTCAACCAGCTACAAGACAGTGTCATTGCCATTAAGCTCTCCAAACATAAAGCTGAATCTCACTAGCCCTAAAAGGGGT
CAGAAAAGAGAAGAAGGGTGGAAAGAAGTTGTACGAAGGTCAAAGAAATTGTCTGTTCCAGCCTCAGTGGTGTCGAGGATAATGGGAAGA
GGAGGATGCAACATCACTGCAATACAGGATGTTACTGGTGCCCATATTGATGTGGATAAACAAAAAGATAAGAATGGCGAGAGAATGATC
ACAATAAGGGGTGGCACAGAATCAACAAGATATGCAGTTCAACTAATCAATGCACTCATTCAAGATCCTGCTAAGGAACTGGAAGACTTG
ATTCCTAAAAATCATATCAGAACACCTGCCAGCACCAAATCAATTCATGCTAACTTCTCATCTGGAGTAGGTACCACAGCAGCTTCCAGT
AAAAATGCATTTCCTTTGGGTGCTCCAACTCTTGTAACTTCACAGGCAACAACGTTATCTACGTTCCAGCCCGCTAATAAACTTAATAAG
AATGTTCCAACAAATGTACGTTCTTCTTTCCCAGTTTCTCTACCCTTAGCTTATCCTCACCCTCATTTTGCCCTGCTGGCTGCTCAAACT
ATGCAACAGATTCGGCATCCTCGCTTACCCATGGCCCAGTTTGGAGGAACCTTCTCACCTTCTCCTAACACATGGGGACCATTCCCAGTG
AGACCTGTGAATCCTGGCAACACAAATAGCTCTCCAAAGCATAATAACACAAGCCGTCTACCTAACCAGAACGGGACTGTTTTACCCTCA
GAGTCTGCTGGACTAGCTACTGCCAGTTGTCCTATCACTGTCTCTTCTGTAGTTGCTGCCAGTCAGCAACTGTGTGTCACTAATACCCGG
ACTCCTTCATCAGTCAGAAAGCAGTTGTTTGCCTGTGTGCCTAAGACAAGTCCTCCAGCAACAGTGATTTCTTCTGTGACAAGCACTTGT
AGTTCCCTGCCTTCTGTCTCCTCTGCACCTATCACTAGCGGGCAAGCTCCCACCACATTTCTACCTGCAAGTACTTCTCAAGCACAGCTT
TCTTCACAAAAGATGGAGTCTTTCTCTGCTGTGCCACCCACCAAAGAGAAAGTGTCCACACAGGACCAGCCCATGGCAAACCTATGTACC
CCATCTTCAACTGCAAACAGTTGCAGTAGCTCTGCCAGCAACACCCCGGGAGCTCCAGAAACTCACCCATCCAGTAGTCCCACTCCTACT
TCCAGTAACACACAAGAGGAGGCACAGCCATCCAGTGTGTCTGATTTAAGTCCTATGTCAATGCCTTTTGCATCTAACTCAGAACCTGCT
CCATTGACTTTGACATCACCCAGAATGGTTGCTGCTGATAATCAGGACACCAGTAATTTACCTCAGTTAGCTGTACCAGCACCTCGAGTT
TCTCATCGAATGCAGCCCAGAGGTTCTTTTTACTCCATGGTACCAAATGCAACTATTCACCAGGATCCCCAGTCTATTTTTGTTACGAAT
CCAGTTACTTTAACACCACCTCAAGGCCCACCAGCTGCAGTGCAGCTTTCTTCAGCTGTGAACATTATGAATGGTTCTCAGATGCACATA
AACCCAGCAAATAAGTCTTTGCCACCTACATTTGGCCCAGCCACACTTTTCAATCACTTCAGCAGTCTTTTTGATAGTAGTCAGGTGCCA
GCTAACCAGGGCTGGGGAGATGGTCCACTGTCCTCACGAGTTGCTACAGATGCCTCTTTCACTGTTCAGTCAGCGTTCCTGGGTAACTCA
GTGCTTGGACACTTGGAAAACATGCACCCTGATAACTCAAAGGCACCTGGCTTCAGACCACCTTCCCAGCGAGTTTCTACTAGTCCAGTT
GGGTTACCATCCATTGACCCATCAGGCAGCTCCCCATCTTCCTCTTCTGCTCCTCTGGCAAGTTTTTCCGGCATACCAGGAACAAGGGTT
TTCCTGCAAGGGCCAGCTCCTGTTGGGACTCCTAGTTTCAACAGACAACATTTTTCTCCCCATCCTTGGACAAGCGCCTCAAACTCATCC
ACTTCTGCCCCACCAACGTTGGGCCAACCAAAAGGAGTCAGTGCCAGTCAAGATCGAAAGATACCTCCCCCAATTGGAACAGAGAGACTG
GCCCGAATTCGGCAAGGAGGGTCTGTTGCACAAGCCCCGGCGGGGACCAGTTTTGTCGCTCCCGTTGGACACAGTGGAATCTGGTCATTT
GGTGTCAATGCTGTGTCAGAAGGCTTATCAGGTTGGTCGCAATCTGTGATGGGGAACCATCCAATGCATCAACAATTATCAGACCCAAGC
ACATTCTCCCAACATCAGCCAATGGAGAGAGATGATTCTGGAATGGTAGCCCCCTCTAACATTTTTCATCAGCCTATGGCAAGTGGTTTT
GTGGATTTTTCTAAAGGTCTGCCAATTTCCATGTATGGAGGCACCATAATACCCTCTCATCCTCAGCTTGCTGATGTTCCAGGAGGCCCT
CTGTTTAATGGACTTCACAATCCAGATCCTGCTTGGAACCCTATGATAAAAGTTATCCAAAATTCAACTGAATGCACTGATGCCCAGCAG
GCCAGTCTGCTTCCTTCAGTCCCTGCTCTCAAAGGGGAAATCCCATCACCTCAGCTAACCAGACCGAAGAAGAGAATTGGACGGCCGATG
GTGGCCTCTCCTAACCAGAGGCACCAGGATCATCTACGACCGAAAGTTCCTGCTGGAGTGCAAGAACTCACCCATTGCCCGGACACCCCC
CTGCTGCCTCCCTCAGATTCCCGGGGTCACAACTCCTCCAACAGCCCCTCTCTCCAAGCTGGAGGAGCTGAAGGAGCAGGAGACAGAGGA
AGAGATACCCGATGACGCACAATTTGAAATGGACATCTAATCCAGTGCAGATGACCTGGCATGTGGAGTTACAGAGGGATCCCTCATGCC
ACTGCTGCCACCACCTCTTCCTGGGGCATCCAAAGGCCAGCTGGCCTCATCTAATCTGGAAGGGAGTGACTTGTTAGTTCCAGGCCTCCT
TTAGTTCTGAGGCAGCTAGACCAGGGATAGGAGTGGGCAACTTGCCAAGCCCTTAACTCTACTTCCTCTTCAGTCTGTGGTACTCCTCCT


Top

FusionGenePPI for PCDHA11_ANKHD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PCDHA11PCDHA10, PCDHA3, PCDHA4, PCDHA12ANKHD1POLR2M, UNC93B1, SIRT7, CAND1, ATXN1, ATXN1L, VCP, NFKBIE, ZNF346, ADARB2, MOV10, NXF1, HOXC4, MAGEA1, ZC3H3, FOSL2, SFRP4, RBM23, SEC16A, CDT1, SKA3, FOS, FOXQ1, STX11, FGF8, TRIM41, FGF3, SIX2, HOXD4, IRF9, AKAP17A, ZNF263, ZNF433, IL17RA, H2AFX, NOB1, C6orf141, TULP3, CERKL, CDX1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PCDHA11_ANKHD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PCDHA11_ANKHD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource