FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2618

FusionGeneSummary for ARID1A_THBS3

check button Fusion gene summary
Fusion gene informationFusion gene name: ARID1A_THBS3
Fusion gene ID: 2618
HgeneTgene
Gene symbol

ARID1A

THBS3

Gene ID

8289

7059

Gene nameAT-rich interaction domain 1Athrombospondin 3
SynonymsB120|BAF250|BAF250a|BM029|C1orf4|CSS2|ELD|MRD14|OSA1|P270|SMARCF1|hELD|hOSA1TSP3
Cytomap

1p36.11

1q22

Type of geneprotein-codingprotein-coding
DescriptionAT-rich interactive domain-containing protein 1AARID domain-containing protein 1AAT rich interactive domain 1A (SWI-like)BRG1-associated factor 250aOSA1 nuclear proteinSWI-like proteinSWI/SNF complex protein p270SWI/SNF-related, matrix-associated, thrombospondin-3
Modification date2018051920180519
UniProtAcc

O14497

P49746

Ensembl transtripts involved in fusion geneENST00000324856, ENST00000457599, 
ENST00000374152, ENST00000540690, 
ENST00000368378, ENST00000541576, 
ENST00000457183, ENST00000541990, 
ENST00000486260, 
Fusion gene scores* DoF score21 X 13 X 13=35496 X 6 X 2=72
# samples 317
** MAII scorelog2(31/3549*10)=-3.51707245378671
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/72*10)=-0.0406419844973459
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARID1A [Title/Abstract] AND THBS3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARID1A

GO:0006337

nucleosome disassembly

8895581

HgeneARID1A

GO:0006338

chromatin remodeling

11726552

HgeneARID1A

GO:0030520

intracellular estrogen receptor signaling pathway

12200431

HgeneARID1A

GO:0030521

androgen receptor signaling pathway

12200431

HgeneARID1A

GO:0042921

glucocorticoid receptor signaling pathway

12200431

HgeneARID1A

GO:0045893

positive regulation of transcription, DNA-templated

12200431


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A12V-01AARID1Achr1

27059283

+THBS3chr1

155172928

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000324856ENST00000368378ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-intronENST00000324856ENST00000541576ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-intronENST00000324856ENST00000457183ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-5UTRENST00000324856ENST00000541990ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-5UTRENST00000324856ENST00000486260ARID1Achr1

27059283

+THBS3chr1

155172928

-
In-frameENST00000457599ENST00000368378ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-intronENST00000457599ENST00000541576ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-intronENST00000457599ENST00000457183ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-5UTRENST00000457599ENST00000541990ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-5UTRENST00000457599ENST00000486260ARID1Achr1

27059283

+THBS3chr1

155172928

-
In-frameENST00000374152ENST00000368378ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-intronENST00000374152ENST00000541576ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-intronENST00000374152ENST00000457183ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-5UTRENST00000374152ENST00000541990ARID1Achr1

27059283

+THBS3chr1

155172928

-
5CDS-5UTRENST00000374152ENST00000486260ARID1Achr1

27059283

+THBS3chr1

155172928

-
intron-3CDSENST00000540690ENST00000368378ARID1Achr1

27059283

+THBS3chr1

155172928

-
intron-intronENST00000540690ENST00000541576ARID1Achr1

27059283

+THBS3chr1

155172928

-
intron-intronENST00000540690ENST00000457183ARID1Achr1

27059283

+THBS3chr1

155172928

-
intron-5UTRENST00000540690ENST00000541990ARID1Achr1

27059283

+THBS3chr1

155172928

-
intron-5UTRENST00000540690ENST00000486260ARID1Achr1

27059283

+THBS3chr1

155172928

-

Top

FusionProtFeatures for ARID1A_THBS3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARID1A

O14497

THBS3

P49746

Adhesive glycoprotein that mediates cell-to-cell andcell-to-matrix interactions. Can bind to fibrinogen, fibronectin,laminin and type V collagen.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+420479_4826402286Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+420561_5676402286Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+420479_4826402069Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+420561_5676402069Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+420295_2996402286MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+420295_2996402069MotifNote=LXXLL
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523316_354252957DomainEGF-like 1%3B calcium-binding
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523370_410252957DomainEGF-like 2%3B calcium-binding
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523414_456252957DomainEGF-like 3
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523727_941252957DomainTSP C-terminal
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321316_354132837DomainEGF-like 1%3B calcium-binding
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321370_410132837DomainEGF-like 2%3B calcium-binding
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321414_456132837DomainEGF-like 3
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321727_941132837DomainTSP C-terminal
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523457_491252957RepeatNote=TSP type-3 1
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523492_527252957RepeatNote=TSP type-3 2
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523528_550252957RepeatNote=TSP type-3 3
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523551_586252957RepeatNote=TSP type-3 4
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523587_609252957RepeatNote=TSP type-3 5
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523610_647252957RepeatNote=TSP type-3 6
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523648_687252957RepeatNote=TSP type-3 7
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-523688_723252957RepeatNote=TSP type-3 8
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321457_491132837RepeatNote=TSP type-3 1
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321492_527132837RepeatNote=TSP type-3 2
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321528_550132837RepeatNote=TSP type-3 3
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321551_586132837RepeatNote=TSP type-3 4
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321587_609132837RepeatNote=TSP type-3 5
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321610_647132837RepeatNote=TSP type-3 6
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321648_687132837RepeatNote=TSP type-3 7
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-321688_723132837RepeatNote=TSP type-3 8

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+4201327_14046402286Compositional biasNote=Gln-rich
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+420998_10016402286Compositional biasNote=Poly-Ser
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+3191327_14042571903Compositional biasNote=Gln-rich
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+319479_4822571903Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+319561_5672571903Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+319998_10012571903Compositional biasNote=Poly-Ser
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+4201327_14046402069Compositional biasNote=Gln-rich
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+420998_10016402069Compositional biasNote=Poly-Ser
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+4201017_11086402286DomainARID
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+3191017_11082571903DomainARID
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+4201017_11086402069DomainARID
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+4201368_13876402286MotifNuclear localization signal
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+4201709_17136402286MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+4201967_19716402286MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000324856+4202085_20896402286MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+3191368_13872571903MotifNuclear localization signal
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+3191709_17132571903MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+3191967_19712571903MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+3192085_20892571903MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000374152+319295_2992571903MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+4201368_13876402069MotifNuclear localization signal
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+4201709_17136402069MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+4201967_19716402069MotifNote=LXXLL
HgeneARID1Achr1:27059283chr1:155172928ENST00000457599+4202085_20896402069MotifNote=LXXLL
TgeneTHBS3chr1:27059283chr1:155172928ENST00000368378-52323_193252957DomainNote=Laminin G-like
TgeneTHBS3chr1:27059283chr1:155172928ENST00000457183-32123_193132837DomainNote=Laminin G-like


Top

FusionGeneSequence for ARID1A_THBS3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARID1A_ENST00000324856_chr1_27059283_+_THBS3_ENST00000368378_chr1_155172928_-_1345aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPTGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSTTQQ
IPPTGQQGPSGTGQQGQTPTYNQQSPHPQQQQPPYSQQPPSQTPHAQPSTQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAATPQPQSQQSQQTATSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRCGPCPPGLQGNGTHCSDINECAHADPCFPGSSC
INTMPGFHCEACPRGYKGTQVSGVGIDTARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHSPA
HSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQDNCLLTPNSGQEDADNDGVGDQCDDDADGDGI
KNVEDNCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDSCP
EMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECDGDDDNDGIPDTVPPGPDNCRLVPNPNQKDSDG
NGVGDVCEDDFDNDAVVDPLDVCPESAEVTLTDFRATQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFH
VNTVTDDDYAGFLFSTQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWR

>In-frame_ARID1A_ENST00000457599_chr1_27059283_+_THBS3_ENST00000368378_chr1_155172928_-_1345aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPTGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSTTQQ
IPPTGQQGPSGTGQQGQTPTYNQQSPHPQQQQPPYSQQPPSQTPHAQPSTQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAATPQPQSQQSQQTATSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRCGPCPPGLQGNGTHCSDINECAHADPCFPGSSC
INTMPGFHCEACPRGYKGTQVSGVGIDTARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHSPA
HSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQDNCLLTPNSGQEDADNDGVGDQCDDDADGDGI
KNVEDNCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDSCP
EMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECDGDDDNDGIPDTVPPGPDNCRLVPNPNQKDSDG
NGVGDVCEDDFDNDAVVDPLDVCPESAEVTLTDFRATQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFH
VNTVTDDDYAGFLFSTQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWR

>In-frame_ARID1A_ENST00000374152_chr1_27059283_+_THBS3_ENST00000368378_chr1_155172928_-_962aa
MDQMGKMRPQPTGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSTTQQIPPTGQQGPSGTGQQGQTPTYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSTQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ
QPQQPAPSTLSQQAATPQPQSQQSQQTATSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPVKEMSLIRNTIME
CQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRCGPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSG
VGIDTARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHSPAHSPCHIHAHCLFERNGAVSCQCN
VGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSF
GDACDNCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDSCPEMSNPTQTDADSDLVGDVCDTNE
DSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECDGDDDNDGIPDTVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVC
PESAEVTLTDFRATQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFLFSTQDSGRFY
VVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSTRWQLLHRPQVGYIRVKLT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARID1A_ENST00000324856_chr1_27059283_+_THBS3_ENST00000368378_chr1_155172928_-_4035nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGTGAAGGAAATGTCCCTGATCCGAAACACCATTATGGAGTGTCAGGTGTGCGGCTTCCAT
GAGCAGCGTTCCCACTGCAGCCCCAATCCCTGCTTCCGAGGTGTGGACTGCATGGAAGTGTACGAGTACCCAGGCTACCGCTGTGGGCCC
TGCCCCCCTGGCCTGCAGGGCAACGGCACCCACTGCAGTGACATCAATGAGTGTGCTCACGCTGACCCCTGTTTCCCGGGCTCCAGCTGC
ATCAACACCATGCCCGGCTTCCACTGTGAGGCCTGTCCTCGAGGGTACAAGGGCACACAGGTGTCTGGTGTGGGCATTGACTATGCCCGG
GCCAGCAAACAGGTCTGCAATGACATCGATGAATGCAACGATGGCAACAATGGTGGCTGTGACCCAAACTCCATCTGCACCAACACTGTG
GGCTCTTTCAAGTGTGGTCCCTGCCGCCTGGGTTTCCTGGGCAACCAGAGCCAGGGCTGCCTCCCAGCCCGGACCTGCCACAGCCCAGCC
CACAGCCCCTGCCACATCCATGCTCACTGTCTCTTTGAACGCAATGGTGCAGTGTCCTGCCAGTGTAACGTGGGCTGGGCTGGGAATGGG
AACGTGTGTGGGACTGACACAGACATCGATGGCTACCCAGACCAAGCACTGCCCTGCATGGACAACAACAAACACTGCAAACAGGACAAC
TGCCTTTTGACACCCAACTCTGGGCAGGAAGATGCTGATAATGATGGTGTGGGGGACCAGTGTGATGATGATGCTGATGGGGATGGGATC
AAGAATGTTGAGGACAACTGCCGGCTGTTCCCCAACAAAGACCAGCAGAACTCAGATACAGATTCATTTGGTGATGCCTGTGACAATTGC
CCCAACGTTCCCAACAATGACCAGAAGGACACAGATGGCAATGGGGAAGGAGATGCCTGTGACAACGACGTGGATGGGGATGGCATCCCC
AATGGATTGGACAATTGCCCTAAAGTCCCCAACCCACTACAGACAGACAGGGATGAGGACGGGGTGGGAGATGCTTGCGACAGCTGCCCT
GAAATGAGCAATCCTACCCAGACAGATGCAGACAGCGACCTGGTGGGGGATGTCTGTGATACTAATGAAGACAGCGATGGGGATGGGCAT
CAGGACACCAAGGACAACTGCCCACAGCTGCCAAATAGCTCCCAGCTGGACTCTGATAACGATGGACTTGGAGATGAGTGTGATGGGGAT
GATGACAATGATGGCATCCCAGATTATGTGCCTCCTGGTCCCGATAACTGCCGCCTGGTACCCAATCCCAATCAGAAGGACTCAGATGGC
AATGGCGTTGGTGATGTGTGTGAGGATGACTTTGACAATGATGCTGTGGTCGACCCCCTGGATGTGTGTCCTGAAAGTGCAGAGGTAACG
CTTACGGATTTTCGGGCCTATCAGACCGTCGTCCTGGATCCTGAGGGTGATGCTCAGATTGACCCAAACTGGGTTGTGCTCAACCAGGGC
ATGGAAATCGTTCAGACCATGAACAGTGACCCTGGCTTGGCAGTTGGATACACGGCCTTCAATGGTGTGGACTTTGAAGGCACCTTCCAT
GTGAACACAGTGACTGATGATGACTACGCAGGCTTTCTCTTCAGTTATCAAGACAGTGGCCGCTTCTACGTAGTCATGTGGAAGCAGACC
GAGCAGACCTACTGGCAGGCTACACCCTTCCGGGCGGTTGCCCAGCCCGGGCTGCAGCTCAAGGCAGTGACATCAGTGTCTGGCCCAGGT
GAGCACCTCCGAAATGCCCTGTGGCATACTGGCCACACCCCTGATCAGGTACGACTGCTGTGGACAGACCCACGAAATGTGGGCTGGCGG
GACAAGACCTCCTATCGCTGGCAGCTTCTGCACCGGCCTCAAGTTGGCTACATTCGGGTGAAGCTCTATGAGGGACCCCAGCTTGTGGCG
GATTCTGGGGTGATCATTGACACATCCATGCGAGGGGGGCGTCTTGGTGTATTCTGCTTCTCCCAAGAAAACATAATTTGGTCCAATCTC

>In-frame_ARID1A_ENST00000457599_chr1_27059283_+_THBS3_ENST00000368378_chr1_155172928_-_4035nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGTGAAGGAAATGTCCCTGATCCGAAACACCATTATGGAGTGTCAGGTGTGCGGCTTCCAT
GAGCAGCGTTCCCACTGCAGCCCCAATCCCTGCTTCCGAGGTGTGGACTGCATGGAAGTGTACGAGTACCCAGGCTACCGCTGTGGGCCC
TGCCCCCCTGGCCTGCAGGGCAACGGCACCCACTGCAGTGACATCAATGAGTGTGCTCACGCTGACCCCTGTTTCCCGGGCTCCAGCTGC
ATCAACACCATGCCCGGCTTCCACTGTGAGGCCTGTCCTCGAGGGTACAAGGGCACACAGGTGTCTGGTGTGGGCATTGACTATGCCCGG
GCCAGCAAACAGGTCTGCAATGACATCGATGAATGCAACGATGGCAACAATGGTGGCTGTGACCCAAACTCCATCTGCACCAACACTGTG
GGCTCTTTCAAGTGTGGTCCCTGCCGCCTGGGTTTCCTGGGCAACCAGAGCCAGGGCTGCCTCCCAGCCCGGACCTGCCACAGCCCAGCC
CACAGCCCCTGCCACATCCATGCTCACTGTCTCTTTGAACGCAATGGTGCAGTGTCCTGCCAGTGTAACGTGGGCTGGGCTGGGAATGGG
AACGTGTGTGGGACTGACACAGACATCGATGGCTACCCAGACCAAGCACTGCCCTGCATGGACAACAACAAACACTGCAAACAGGACAAC
TGCCTTTTGACACCCAACTCTGGGCAGGAAGATGCTGATAATGATGGTGTGGGGGACCAGTGTGATGATGATGCTGATGGGGATGGGATC
AAGAATGTTGAGGACAACTGCCGGCTGTTCCCCAACAAAGACCAGCAGAACTCAGATACAGATTCATTTGGTGATGCCTGTGACAATTGC
CCCAACGTTCCCAACAATGACCAGAAGGACACAGATGGCAATGGGGAAGGAGATGCCTGTGACAACGACGTGGATGGGGATGGCATCCCC
AATGGATTGGACAATTGCCCTAAAGTCCCCAACCCACTACAGACAGACAGGGATGAGGACGGGGTGGGAGATGCTTGCGACAGCTGCCCT
GAAATGAGCAATCCTACCCAGACAGATGCAGACAGCGACCTGGTGGGGGATGTCTGTGATACTAATGAAGACAGCGATGGGGATGGGCAT
CAGGACACCAAGGACAACTGCCCACAGCTGCCAAATAGCTCCCAGCTGGACTCTGATAACGATGGACTTGGAGATGAGTGTGATGGGGAT
GATGACAATGATGGCATCCCAGATTATGTGCCTCCTGGTCCCGATAACTGCCGCCTGGTACCCAATCCCAATCAGAAGGACTCAGATGGC
AATGGCGTTGGTGATGTGTGTGAGGATGACTTTGACAATGATGCTGTGGTCGACCCCCTGGATGTGTGTCCTGAAAGTGCAGAGGTAACG
CTTACGGATTTTCGGGCCTATCAGACCGTCGTCCTGGATCCTGAGGGTGATGCTCAGATTGACCCAAACTGGGTTGTGCTCAACCAGGGC
ATGGAAATCGTTCAGACCATGAACAGTGACCCTGGCTTGGCAGTTGGATACACGGCCTTCAATGGTGTGGACTTTGAAGGCACCTTCCAT
GTGAACACAGTGACTGATGATGACTACGCAGGCTTTCTCTTCAGTTATCAAGACAGTGGCCGCTTCTACGTAGTCATGTGGAAGCAGACC
GAGCAGACCTACTGGCAGGCTACACCCTTCCGGGCGGTTGCCCAGCCCGGGCTGCAGCTCAAGGCAGTGACATCAGTGTCTGGCCCAGGT
GAGCACCTCCGAAATGCCCTGTGGCATACTGGCCACACCCCTGATCAGGTACGACTGCTGTGGACAGACCCACGAAATGTGGGCTGGCGG
GACAAGACCTCCTATCGCTGGCAGCTTCTGCACCGGCCTCAAGTTGGCTACATTCGGGTGAAGCTCTATGAGGGACCCCAGCTTGTGGCG
GATTCTGGGGTGATCATTGACACATCCATGCGAGGGGGGCGTCTTGGTGTATTCTGCTTCTCCCAAGAAAACATAATTTGGTCCAATCTC

>In-frame_ARID1A_ENST00000374152_chr1_27059283_+_THBS3_ENST00000368378_chr1_155172928_-_2886nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA
GGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGTGAAGGAAATGTCCCTGATCCGAAACACCATTATGGAG
TGTCAGGTGTGCGGCTTCCATGAGCAGCGTTCCCACTGCAGCCCCAATCCCTGCTTCCGAGGTGTGGACTGCATGGAAGTGTACGAGTAC
CCAGGCTACCGCTGTGGGCCCTGCCCCCCTGGCCTGCAGGGCAACGGCACCCACTGCAGTGACATCAATGAGTGTGCTCACGCTGACCCC
TGTTTCCCGGGCTCCAGCTGCATCAACACCATGCCCGGCTTCCACTGTGAGGCCTGTCCTCGAGGGTACAAGGGCACACAGGTGTCTGGT
GTGGGCATTGACTATGCCCGGGCCAGCAAACAGGTCTGCAATGACATCGATGAATGCAACGATGGCAACAATGGTGGCTGTGACCCAAAC
TCCATCTGCACCAACACTGTGGGCTCTTTCAAGTGTGGTCCCTGCCGCCTGGGTTTCCTGGGCAACCAGAGCCAGGGCTGCCTCCCAGCC
CGGACCTGCCACAGCCCAGCCCACAGCCCCTGCCACATCCATGCTCACTGTCTCTTTGAACGCAATGGTGCAGTGTCCTGCCAGTGTAAC
GTGGGCTGGGCTGGGAATGGGAACGTGTGTGGGACTGACACAGACATCGATGGCTACCCAGACCAAGCACTGCCCTGCATGGACAACAAC
AAACACTGCAAACAGGACAACTGCCTTTTGACACCCAACTCTGGGCAGGAAGATGCTGATAATGATGGTGTGGGGGACCAGTGTGATGAT
GATGCTGATGGGGATGGGATCAAGAATGTTGAGGACAACTGCCGGCTGTTCCCCAACAAAGACCAGCAGAACTCAGATACAGATTCATTT
GGTGATGCCTGTGACAATTGCCCCAACGTTCCCAACAATGACCAGAAGGACACAGATGGCAATGGGGAAGGAGATGCCTGTGACAACGAC
GTGGATGGGGATGGCATCCCCAATGGATTGGACAATTGCCCTAAAGTCCCCAACCCACTACAGACAGACAGGGATGAGGACGGGGTGGGA
GATGCTTGCGACAGCTGCCCTGAAATGAGCAATCCTACCCAGACAGATGCAGACAGCGACCTGGTGGGGGATGTCTGTGATACTAATGAA
GACAGCGATGGGGATGGGCATCAGGACACCAAGGACAACTGCCCACAGCTGCCAAATAGCTCCCAGCTGGACTCTGATAACGATGGACTT
GGAGATGAGTGTGATGGGGATGATGACAATGATGGCATCCCAGATTATGTGCCTCCTGGTCCCGATAACTGCCGCCTGGTACCCAATCCC
AATCAGAAGGACTCAGATGGCAATGGCGTTGGTGATGTGTGTGAGGATGACTTTGACAATGATGCTGTGGTCGACCCCCTGGATGTGTGT
CCTGAAAGTGCAGAGGTAACGCTTACGGATTTTCGGGCCTATCAGACCGTCGTCCTGGATCCTGAGGGTGATGCTCAGATTGACCCAAAC
TGGGTTGTGCTCAACCAGGGCATGGAAATCGTTCAGACCATGAACAGTGACCCTGGCTTGGCAGTTGGATACACGGCCTTCAATGGTGTG
GACTTTGAAGGCACCTTCCATGTGAACACAGTGACTGATGATGACTACGCAGGCTTTCTCTTCAGTTATCAAGACAGTGGCCGCTTCTAC
GTAGTCATGTGGAAGCAGACCGAGCAGACCTACTGGCAGGCTACACCCTTCCGGGCGGTTGCCCAGCCCGGGCTGCAGCTCAAGGCAGTG
ACATCAGTGTCTGGCCCAGGTGAGCACCTCCGAAATGCCCTGTGGCATACTGGCCACACCCCTGATCAGGTACGACTGCTGTGGACAGAC
CCACGAAATGTGGGCTGGCGGGACAAGACCTCCTATCGCTGGCAGCTTCTGCACCGGCCTCAAGTTGGCTACATTCGGGTGAAGCTCTAT
GAGGGACCCCAGCTTGTGGCGGATTCTGGGGTGATCATTGACACATCCATGCGAGGGGGGCGTCTTGGTGTATTCTGCTTCTCCCAAGAA
AACATAATTTGGTCCAATCTCCAGTATCGATGCAATGACACAGTGCCTGAGGACTTTGAGCCATTCCGGAGGCAGCTGCTCCAGGGAAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARID1A_ENST00000324856_chr1_27059283_+_THBS3_ENST00000368378_chr1_155172928_-_4659nt
GAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGGCAAGGGCTTGGGGGGAATGAG
CCGGGAGAGCCGGGTCCCGAGCCTACAGAGCCGGGAGCAGCTGAGCCGCCGGCGCCTCGGCCGCCGCCGCCGCCTCCTCCTCCTCCGCCG
CCGCCAGCCCGGAGCCTGAGCCGGCGGGGCGGGGGGGAGAGGAGCGAGCGCAGCGCAGCAGCGGAGCCCCGCGAGGCCCGCCCGGGCGGG
TGGGGAGGGCAGCCCGGGGGACTGGGCCCCGGGGCGGGGTGGGAGGGGGGGAGAAGACGAAGACAGGGCCGGGTCTCTCCGCGGACGAGA
CAGCGGGGATCATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAG
CCGAGCAGCAGCAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGG
AAAGCGAGGGCCCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCG
GAGCCGGCAGCGGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACC
TCACGGAGCCGCCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAG
CCTACGGCTTCGGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAAC
AAAGCCCTGGCCTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCT
TCCCCAACCACCAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTG
GCACTCCGGGCTCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCG
CTCAGCAGCGCTTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACC
AACTGCTCACGTCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCA
AGGGCCCGGCGGACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGA
GCCACCACGCGCCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGA
TGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGT
ACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTT
ATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTC
ACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTC
AACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCC
AGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGC
AGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCT
TCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAG
ATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGTGAAGGAAATGTCCCTGATCCGAAACACCATTATGGAGTGTCAGGTGT
GCGGCTTCCATGAGCAGCGTTCCCACTGCAGCCCCAATCCCTGCTTCCGAGGTGTGGACTGCATGGAAGTGTACGAGTACCCAGGCTACC
GCTGTGGGCCCTGCCCCCCTGGCCTGCAGGGCAACGGCACCCACTGCAGTGACATCAATGAGTGTGCTCACGCTGACCCCTGTTTCCCGG
GCTCCAGCTGCATCAACACCATGCCCGGCTTCCACTGTGAGGCCTGTCCTCGAGGGTACAAGGGCACACAGGTGTCTGGTGTGGGCATTG
ACTATGCCCGGGCCAGCAAACAGGTCTGCAATGACATCGATGAATGCAACGATGGCAACAATGGTGGCTGTGACCCAAACTCCATCTGCA
CCAACACTGTGGGCTCTTTCAAGTGTGGTCCCTGCCGCCTGGGTTTCCTGGGCAACCAGAGCCAGGGCTGCCTCCCAGCCCGGACCTGCC
ACAGCCCAGCCCACAGCCCCTGCCACATCCATGCTCACTGTCTCTTTGAACGCAATGGTGCAGTGTCCTGCCAGTGTAACGTGGGCTGGG
CTGGGAATGGGAACGTGTGTGGGACTGACACAGACATCGATGGCTACCCAGACCAAGCACTGCCCTGCATGGACAACAACAAACACTGCA
AACAGGACAACTGCCTTTTGACACCCAACTCTGGGCAGGAAGATGCTGATAATGATGGTGTGGGGGACCAGTGTGATGATGATGCTGATG
GGGATGGGATCAAGAATGTTGAGGACAACTGCCGGCTGTTCCCCAACAAAGACCAGCAGAACTCAGATACAGATTCATTTGGTGATGCCT
GTGACAATTGCCCCAACGTTCCCAACAATGACCAGAAGGACACAGATGGCAATGGGGAAGGAGATGCCTGTGACAACGACGTGGATGGGG
ATGGCATCCCCAATGGATTGGACAATTGCCCTAAAGTCCCCAACCCACTACAGACAGACAGGGATGAGGACGGGGTGGGAGATGCTTGCG
ACAGCTGCCCTGAAATGAGCAATCCTACCCAGACAGATGCAGACAGCGACCTGGTGGGGGATGTCTGTGATACTAATGAAGACAGCGATG
GGGATGGGCATCAGGACACCAAGGACAACTGCCCACAGCTGCCAAATAGCTCCCAGCTGGACTCTGATAACGATGGACTTGGAGATGAGT
GTGATGGGGATGATGACAATGATGGCATCCCAGATTATGTGCCTCCTGGTCCCGATAACTGCCGCCTGGTACCCAATCCCAATCAGAAGG
ACTCAGATGGCAATGGCGTTGGTGATGTGTGTGAGGATGACTTTGACAATGATGCTGTGGTCGACCCCCTGGATGTGTGTCCTGAAAGTG
CAGAGGTAACGCTTACGGATTTTCGGGCCTATCAGACCGTCGTCCTGGATCCTGAGGGTGATGCTCAGATTGACCCAAACTGGGTTGTGC
TCAACCAGGGCATGGAAATCGTTCAGACCATGAACAGTGACCCTGGCTTGGCAGTTGGATACACGGCCTTCAATGGTGTGGACTTTGAAG
GCACCTTCCATGTGAACACAGTGACTGATGATGACTACGCAGGCTTTCTCTTCAGTTATCAAGACAGTGGCCGCTTCTACGTAGTCATGT
GGAAGCAGACCGAGCAGACCTACTGGCAGGCTACACCCTTCCGGGCGGTTGCCCAGCCCGGGCTGCAGCTCAAGGCAGTGACATCAGTGT
CTGGCCCAGGTGAGCACCTCCGAAATGCCCTGTGGCATACTGGCCACACCCCTGATCAGGTACGACTGCTGTGGACAGACCCACGAAATG
TGGGCTGGCGGGACAAGACCTCCTATCGCTGGCAGCTTCTGCACCGGCCTCAAGTTGGCTACATTCGGGTGAAGCTCTATGAGGGACCCC
AGCTTGTGGCGGATTCTGGGGTGATCATTGACACATCCATGCGAGGGGGGCGTCTTGGTGTATTCTGCTTCTCCCAAGAAAACATAATTT
GGTCCAATCTCCAGTATCGATGCAATGACACAGTGCCTGAGGACTTTGAGCCATTCCGGAGGCAGCTGCTCCAGGGAAGGGTGTGAGGAG
GAGGCCACCAGATTCAGAATTCAGAATTTTAGACCCTTTGGCCTTGGGGTCCATCCTGGAGACCCTGAGGTCTAAGCTACAGCCCCTCAG
CCAACCACAGACCCTTCTCTGGCTCCCAAAAGGAGTTCAGTCCCAGAGGGGTGGTCACCCCACCCTTCAGGGGATGAGAAGTTTTCAAGG

>In-frame_ARID1A_ENST00000457599_chr1_27059283_+_THBS3_ENST00000368378_chr1_155172928_-_4288nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGTGAAGGAAATGTCCCTGATCCGAAACACCATTATGGAGTGTCAGGTGTGCGGCTTCCAT
GAGCAGCGTTCCCACTGCAGCCCCAATCCCTGCTTCCGAGGTGTGGACTGCATGGAAGTGTACGAGTACCCAGGCTACCGCTGTGGGCCC
TGCCCCCCTGGCCTGCAGGGCAACGGCACCCACTGCAGTGACATCAATGAGTGTGCTCACGCTGACCCCTGTTTCCCGGGCTCCAGCTGC
ATCAACACCATGCCCGGCTTCCACTGTGAGGCCTGTCCTCGAGGGTACAAGGGCACACAGGTGTCTGGTGTGGGCATTGACTATGCCCGG
GCCAGCAAACAGGTCTGCAATGACATCGATGAATGCAACGATGGCAACAATGGTGGCTGTGACCCAAACTCCATCTGCACCAACACTGTG
GGCTCTTTCAAGTGTGGTCCCTGCCGCCTGGGTTTCCTGGGCAACCAGAGCCAGGGCTGCCTCCCAGCCCGGACCTGCCACAGCCCAGCC
CACAGCCCCTGCCACATCCATGCTCACTGTCTCTTTGAACGCAATGGTGCAGTGTCCTGCCAGTGTAACGTGGGCTGGGCTGGGAATGGG
AACGTGTGTGGGACTGACACAGACATCGATGGCTACCCAGACCAAGCACTGCCCTGCATGGACAACAACAAACACTGCAAACAGGACAAC
TGCCTTTTGACACCCAACTCTGGGCAGGAAGATGCTGATAATGATGGTGTGGGGGACCAGTGTGATGATGATGCTGATGGGGATGGGATC
AAGAATGTTGAGGACAACTGCCGGCTGTTCCCCAACAAAGACCAGCAGAACTCAGATACAGATTCATTTGGTGATGCCTGTGACAATTGC
CCCAACGTTCCCAACAATGACCAGAAGGACACAGATGGCAATGGGGAAGGAGATGCCTGTGACAACGACGTGGATGGGGATGGCATCCCC
AATGGATTGGACAATTGCCCTAAAGTCCCCAACCCACTACAGACAGACAGGGATGAGGACGGGGTGGGAGATGCTTGCGACAGCTGCCCT
GAAATGAGCAATCCTACCCAGACAGATGCAGACAGCGACCTGGTGGGGGATGTCTGTGATACTAATGAAGACAGCGATGGGGATGGGCAT
CAGGACACCAAGGACAACTGCCCACAGCTGCCAAATAGCTCCCAGCTGGACTCTGATAACGATGGACTTGGAGATGAGTGTGATGGGGAT
GATGACAATGATGGCATCCCAGATTATGTGCCTCCTGGTCCCGATAACTGCCGCCTGGTACCCAATCCCAATCAGAAGGACTCAGATGGC
AATGGCGTTGGTGATGTGTGTGAGGATGACTTTGACAATGATGCTGTGGTCGACCCCCTGGATGTGTGTCCTGAAAGTGCAGAGGTAACG
CTTACGGATTTTCGGGCCTATCAGACCGTCGTCCTGGATCCTGAGGGTGATGCTCAGATTGACCCAAACTGGGTTGTGCTCAACCAGGGC
ATGGAAATCGTTCAGACCATGAACAGTGACCCTGGCTTGGCAGTTGGATACACGGCCTTCAATGGTGTGGACTTTGAAGGCACCTTCCAT
GTGAACACAGTGACTGATGATGACTACGCAGGCTTTCTCTTCAGTTATCAAGACAGTGGCCGCTTCTACGTAGTCATGTGGAAGCAGACC
GAGCAGACCTACTGGCAGGCTACACCCTTCCGGGCGGTTGCCCAGCCCGGGCTGCAGCTCAAGGCAGTGACATCAGTGTCTGGCCCAGGT
GAGCACCTCCGAAATGCCCTGTGGCATACTGGCCACACCCCTGATCAGGTACGACTGCTGTGGACAGACCCACGAAATGTGGGCTGGCGG
GACAAGACCTCCTATCGCTGGCAGCTTCTGCACCGGCCTCAAGTTGGCTACATTCGGGTGAAGCTCTATGAGGGACCCCAGCTTGTGGCG
GATTCTGGGGTGATCATTGACACATCCATGCGAGGGGGGCGTCTTGGTGTATTCTGCTTCTCCCAAGAAAACATAATTTGGTCCAATCTC
CAGTATCGATGCAATGACACAGTGCCTGAGGACTTTGAGCCATTCCGGAGGCAGCTGCTCCAGGGAAGGGTGTGAGGAGGAGGCCACCAG
ATTCAGAATTCAGAATTTTAGACCCTTTGGCCTTGGGGTCCATCCTGGAGACCCTGAGGTCTAAGCTACAGCCCCTCAGCCAACCACAGA
CCCTTCTCTGGCTCCCAAAAGGAGTTCAGTCCCAGAGGGGTGGTCACCCCACCCTTCAGGGGATGAGAAGTTTTCAAGGGGTATTACTCA

>In-frame_ARID1A_ENST00000374152_chr1_27059283_+_THBS3_ENST00000368378_chr1_155172928_-_3422nt
TGGATCTCAAGCAGTACCACAGTTACAAAGTAGTTTTTAGCTTACAAGGTGTTTTCACAAATAGGTGGTATTTTCATTTTTCAAATGACA
AAATTAGGGTTCTGAGGCGGGTCAGTTGACTTAAAGGTTACTAGGTTGGTCTCATTGCTCTTTCAAAGTAACTGTATTTCTTTATAGCAT
ACAGACTAAAAAAACCTGTGTACTTGGGTTATATATTCAGTGGCCAGAGGCCATCAAAGCTCAGGTTAATGAAATGCTCTTTATTTTGTA
GCCATCCAGTCCAATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTC
AGGACCGCAGCAAGGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCA
GAGTGCCATGGGCGGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCC
ATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTC
GTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCA
GTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCC
TTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCA
AACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGAC
CTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGTGAAGGAAATGTCCCTGATCCGAAA
CACCATTATGGAGTGTCAGGTGTGCGGCTTCCATGAGCAGCGTTCCCACTGCAGCCCCAATCCCTGCTTCCGAGGTGTGGACTGCATGGA
AGTGTACGAGTACCCAGGCTACCGCTGTGGGCCCTGCCCCCCTGGCCTGCAGGGCAACGGCACCCACTGCAGTGACATCAATGAGTGTGC
TCACGCTGACCCCTGTTTCCCGGGCTCCAGCTGCATCAACACCATGCCCGGCTTCCACTGTGAGGCCTGTCCTCGAGGGTACAAGGGCAC
ACAGGTGTCTGGTGTGGGCATTGACTATGCCCGGGCCAGCAAACAGGTCTGCAATGACATCGATGAATGCAACGATGGCAACAATGGTGG
CTGTGACCCAAACTCCATCTGCACCAACACTGTGGGCTCTTTCAAGTGTGGTCCCTGCCGCCTGGGTTTCCTGGGCAACCAGAGCCAGGG
CTGCCTCCCAGCCCGGACCTGCCACAGCCCAGCCCACAGCCCCTGCCACATCCATGCTCACTGTCTCTTTGAACGCAATGGTGCAGTGTC
CTGCCAGTGTAACGTGGGCTGGGCTGGGAATGGGAACGTGTGTGGGACTGACACAGACATCGATGGCTACCCAGACCAAGCACTGCCCTG
CATGGACAACAACAAACACTGCAAACAGGACAACTGCCTTTTGACACCCAACTCTGGGCAGGAAGATGCTGATAATGATGGTGTGGGGGA
CCAGTGTGATGATGATGCTGATGGGGATGGGATCAAGAATGTTGAGGACAACTGCCGGCTGTTCCCCAACAAAGACCAGCAGAACTCAGA
TACAGATTCATTTGGTGATGCCTGTGACAATTGCCCCAACGTTCCCAACAATGACCAGAAGGACACAGATGGCAATGGGGAAGGAGATGC
CTGTGACAACGACGTGGATGGGGATGGCATCCCCAATGGATTGGACAATTGCCCTAAAGTCCCCAACCCACTACAGACAGACAGGGATGA
GGACGGGGTGGGAGATGCTTGCGACAGCTGCCCTGAAATGAGCAATCCTACCCAGACAGATGCAGACAGCGACCTGGTGGGGGATGTCTG
TGATACTAATGAAGACAGCGATGGGGATGGGCATCAGGACACCAAGGACAACTGCCCACAGCTGCCAAATAGCTCCCAGCTGGACTCTGA
TAACGATGGACTTGGAGATGAGTGTGATGGGGATGATGACAATGATGGCATCCCAGATTATGTGCCTCCTGGTCCCGATAACTGCCGCCT
GGTACCCAATCCCAATCAGAAGGACTCAGATGGCAATGGCGTTGGTGATGTGTGTGAGGATGACTTTGACAATGATGCTGTGGTCGACCC
CCTGGATGTGTGTCCTGAAAGTGCAGAGGTAACGCTTACGGATTTTCGGGCCTATCAGACCGTCGTCCTGGATCCTGAGGGTGATGCTCA
GATTGACCCAAACTGGGTTGTGCTCAACCAGGGCATGGAAATCGTTCAGACCATGAACAGTGACCCTGGCTTGGCAGTTGGATACACGGC
CTTCAATGGTGTGGACTTTGAAGGCACCTTCCATGTGAACACAGTGACTGATGATGACTACGCAGGCTTTCTCTTCAGTTATCAAGACAG
TGGCCGCTTCTACGTAGTCATGTGGAAGCAGACCGAGCAGACCTACTGGCAGGCTACACCCTTCCGGGCGGTTGCCCAGCCCGGGCTGCA
GCTCAAGGCAGTGACATCAGTGTCTGGCCCAGGTGAGCACCTCCGAAATGCCCTGTGGCATACTGGCCACACCCCTGATCAGGTACGACT
GCTGTGGACAGACCCACGAAATGTGGGCTGGCGGGACAAGACCTCCTATCGCTGGCAGCTTCTGCACCGGCCTCAAGTTGGCTACATTCG
GGTGAAGCTCTATGAGGGACCCCAGCTTGTGGCGGATTCTGGGGTGATCATTGACACATCCATGCGAGGGGGGCGTCTTGGTGTATTCTG
CTTCTCCCAAGAAAACATAATTTGGTCCAATCTCCAGTATCGATGCAATGACACAGTGCCTGAGGACTTTGAGCCATTCCGGAGGCAGCT
GCTCCAGGGAAGGGTGTGAGGAGGAGGCCACCAGATTCAGAATTCAGAATTTTAGACCCTTTGGCCTTGGGGTCCATCCTGGAGACCCTG
AGGTCTAAGCTACAGCCCCTCAGCCAACCACAGACCCTTCTCTGGCTCCCAAAAGGAGTTCAGTCCCAGAGGGGTGGTCACCCCACCCTT
CAGGGGATGAGAAGTTTTCAAGGGGTATTACTCAGGCACTAACCCCAGGAAAGATGACAGCACATTGCCATAAAGTTTTGGTTGTTTTCT


Top

FusionGenePPI for ARID1A_THBS3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARID1AKLF1, GATA1, SMARCB1, SMARCA4, SMARCA2, ING1, SMARCE1, PBRM1, SMARCC2, SMARCC1, PGR, BCL7C, HIC1, CUL2, ARID1B, SMAD2, SMAD3, CARM1, ADNP, RARA, SOX2, CHD7, SMARCD1, TP53, ELAVL1, SIRT7, TFAP4, CUL3, SMARCD2, ACTL6A, SMARCD3, PHF10, ECT2, YAP1, ITCH, NEDD4, SHMT2, MOV10, NXF1, EED, DPF3, DPF2, SS18, UNK, BCL7A, BCL7B, ESR1, NCOA1, RARB, RARG, EWSR1, SNW1, CDC5L, CUL1, SKP1, NFATC1, NFATC2, TOP1, CHEK1, VHL, EYA2, NR3C1, AR, ALDH2, TRIM25THBS3THBS3, HSPD1, BBS2, CPS1, RFC1, SMG8, ASCC3, PC, CCT7, RIC8B, TRO, GTPBP6, METTL13, CCZ1, NDUFA3, PKN2, THBS1, THBS4, TUBA4A, TUBA1A, LRWD1, NSUN2, RPL23, PIK3C2A, TUBB3, TUBB8, PEX1, MTPAP, PEX6, CPSF3L, HPS3, BLVRA, PLD2, PCCA, MTO1, IQSEC2, TOP2A, DDX11, DIP2A, CIRH1A, BBS7, DNM3, RAD21, TIGD5, FANCB, C5orf34, APBB1, TTLL5, BDH1, PDE7A, FDXR, NOL11, ARHGEF1, SH3BP4, MKS1, TBC1D2B, TRMT44, CWF19L1, PPOX, RAD51C, RIPK4, MCM9, RTEL1, CORO7, MAP3K7, CCT2, SLC25A6, DNAJA3, GSG2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARID1A_THBS3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARID1A_THBS3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneARID1AC0038356Stomach Neoplasms3CTD_human
HgeneARID1AC2239176Liver carcinoma3CTD_human
HgeneARID1AC0001418Adenocarcinoma1CTD_human
HgeneARID1AC0005695Bladder Neoplasm1CTD_human
HgeneARID1AC0006413Burkitt Lymphoma1CTD_human
HgeneARID1AC0007138Carcinoma, Transitional Cell1CTD_human
HgeneARID1AC0010606Adenoid Cystic Carcinoma1CTD_human
HgeneARID1AC0014170Endometrial Neoplasms1CTD_human
HgeneARID1AC0027819Neuroblastoma1CTD_human
HgeneARID1AC0036920Sezary Syndrome1CTD_human
HgeneARID1AC0079772T-Cell Lymphoma1CTD_human
HgeneARID1AC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
HgeneARID1AC0206698Cholangiocarcinoma1CTD_human
HgeneARID1AC0265338Coffin-Siris syndrome1CTD_human;ORPHANET
HgeneARID1AC0279628Adenocarcinoma Of Esophagus1CTD_human
HgeneARID1AC0920269Microsatellite Instability1CTD_human
HgeneARID1AC2931822Nasopharyngeal carcinoma1CTD_human