FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26087

FusionGeneSummary for PAX8_NFE2L2

check button Fusion gene summary
Fusion gene informationFusion gene name: PAX8_NFE2L2
Fusion gene ID: 26087
HgeneTgene
Gene symbol

PAX8

NFE2L2

Gene ID

7849

4780

Gene namepaired box 8nuclear factor, erythroid 2 like 2
Synonyms-HEBP1|IMDDHH|NRF2
Cytomap

2q14.1

2q31.2

Type of geneprotein-codingprotein-coding
Descriptionpaired box protein Pax-8paired domain gene 8nuclear factor erythroid 2-related factor 2nuclear factor erythroid-derived 2-like 2
Modification date2018051920180527
UniProtAcc

Q06710

Q16236

Ensembl transtripts involved in fusion geneENST00000348715, ENST00000397647, 
ENST00000263335, ENST00000429538, 
ENST00000263334, 
ENST00000397063, 
ENST00000397062, ENST00000446151, 
ENST00000464747, ENST00000423513, 
Fusion gene scores* DoF score7 X 8 X 4=2249 X 14 X 5=630
# samples 1315
** MAII scorelog2(13/224*10)=-0.784987109029149
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/630*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PAX8 [Title/Abstract] AND NFE2L2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePAX8

GO:0006351

transcription, DNA-templated

9590296

HgenePAX8

GO:0045893

positive regulation of transcription, DNA-templated

9388203|15356023|15961562

HgenePAX8

GO:0045944

positive regulation of transcription by RNA polymerase II

9388203

HgenePAX8

GO:0071371

cellular response to gonadotropin stimulus

15961562

TgeneNFE2L2

GO:0010499

proteasomal ubiquitin-independent protein catabolic process

19424503

TgeneNFE2L2

GO:0016567

protein ubiquitination

15983046

TgeneNFE2L2

GO:0043161

proteasome-mediated ubiquitin-dependent protein catabolic process

15983046

TgeneNFE2L2

GO:0045944

positive regulation of transcription by RNA polymerase II

17015834

TgeneNFE2L2

GO:0071498

cellular response to fluid shear stress

25190803


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVTHCATCGA-EM-A2CP-01APAX8chr2

113999128

-NFE2L2chr2

178097311

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000348715ENST00000397063PAX8chr2

113999128

-NFE2L2chr2

178097311

-
In-frameENST00000348715ENST00000397062PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000348715ENST00000446151PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000348715ENST00000464747PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-3UTRENST00000348715ENST00000423513PAX8chr2

113999128

-NFE2L2chr2

178097311

-
In-frameENST00000397647ENST00000397063PAX8chr2

113999128

-NFE2L2chr2

178097311

-
In-frameENST00000397647ENST00000397062PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000397647ENST00000446151PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000397647ENST00000464747PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-3UTRENST00000397647ENST00000423513PAX8chr2

113999128

-NFE2L2chr2

178097311

-
In-frameENST00000263335ENST00000397063PAX8chr2

113999128

-NFE2L2chr2

178097311

-
In-frameENST00000263335ENST00000397062PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000263335ENST00000446151PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000263335ENST00000464747PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-3UTRENST00000263335ENST00000423513PAX8chr2

113999128

-NFE2L2chr2

178097311

-
Frame-shitENST00000429538ENST00000397063PAX8chr2

113999128

-NFE2L2chr2

178097311

-
Frame-shitENST00000429538ENST00000397062PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000429538ENST00000446151PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000429538ENST00000464747PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-3UTRENST00000429538ENST00000423513PAX8chr2

113999128

-NFE2L2chr2

178097311

-
In-frameENST00000263334ENST00000397063PAX8chr2

113999128

-NFE2L2chr2

178097311

-
In-frameENST00000263334ENST00000397062PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000263334ENST00000446151PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-intronENST00000263334ENST00000464747PAX8chr2

113999128

-NFE2L2chr2

178097311

-
5CDS-3UTRENST00000263334ENST00000423513PAX8chr2

113999128

-NFE2L2chr2

178097311

-

Top

FusionProtFeatures for PAX8_NFE2L2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PAX8

Q06710

NFE2L2

Q16236

Transcription factor for the thyroid-specific expressionof the genes exclusively expressed in the thyroid cell type,maintaining the functional differentiation of such cells. Transcription activator that binds to antioxidantresponse (ARE) elements in the promoter regions of target genes.Important for the coordinated up-regulation of genes in responseto oxidative stress and the regulation of cellular redoxconditions. May be involved in the transcriptional activation ofgenes of the beta-globin cluster by mediating enhancer activity ofhypersensitive site 2 of the beta-globin locus control region.{ECO:0000269|PubMed:11035812, ECO:0000269|PubMed:29018201}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePAX8chr2:113999128chr2:178097311ENST00000263334-6109_135259399DomainPaired
HgenePAX8chr2:113999128chr2:178097311ENST00000263335-7109_1352591161DomainPaired
HgenePAX8chr2:113999128chr2:178097311ENST00000348715-7129_1352591238DomainPaired
HgenePAX8chr2:113999128chr2:178097311ENST00000397647-799_1352591127DomainPaired
HgenePAX8chr2:113999128chr2:178097311ENST00000429538-7129_135259451DomainPaired
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000397062-25497_560134606DomainbZIP
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000397063-25497_560118590DomainbZIP
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000446151-05497_560-58583DomainbZIP
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000464747-58497_560118590DomainbZIP
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000397062-25499_518134606RegionBasic motif
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000397062-25522_529134606RegionLeucine-zipper
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000397063-25499_518118590RegionBasic motif
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000397063-25522_529118590RegionLeucine-zipper
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000446151-05499_518-58583RegionBasic motif
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000446151-05522_529-58583RegionLeucine-zipper
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000464747-58499_518118590RegionBasic motif
TgeneNFE2L2chr2:113999128chr2:178097311ENST00000464747-58522_529118590RegionLeucine-zipper

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePAX8chr2:113999128chr2:178097311ENST00000263334-610315_327259399Compositional biasNote=Ser-rich
HgenePAX8chr2:113999128chr2:178097311ENST00000263335-710315_3272591161Compositional biasNote=Ser-rich
HgenePAX8chr2:113999128chr2:178097311ENST00000348715-712315_3272591238Compositional biasNote=Ser-rich
HgenePAX8chr2:113999128chr2:178097311ENST00000397647-79315_3272591127Compositional biasNote=Ser-rich
HgenePAX8chr2:113999128chr2:178097311ENST00000429538-712315_327259451Compositional biasNote=Ser-rich


Top

FusionGeneSequence for PAX8_NFE2L2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PAX8_ENST00000348715_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_731aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVE
KIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEATASPSHTKGEQVSSATFQSLVP
DIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNTHFYSSIPSM
EKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFTSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLC
KAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSTGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQST
HVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRG
KNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLTLEVFSMLRDEDGKPTSPSEYSLQQTRDGNVFLVP

>In-frame_PAX8_ENST00000348715_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_731aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVE
KIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEATASPSHTKGEQVSSATFQSLVP
DIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNTHFYSSIPSM
EKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFTSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLC
KAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSTGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQST
HVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRG
KNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLTLEVFSMLRDEDGKPTSPSEYSLQQTRDGNVFLVP

>In-frame_PAX8_ENST00000397647_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_731aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVE
KIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEATASPSHTKGEQVSSATFQSLVP
DIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNTHFYSSIPSM
EKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFTSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLC
KAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSTGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQST
HVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRG
KNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLTLEVFSMLRDEDGKPTSPSEYSLQQTRDGNVFLVP

>In-frame_PAX8_ENST00000397647_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_731aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVE
KIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEATASPSHTKGEQVSSATFQSLVP
DIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNTHFYSSIPSM
EKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFTSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLC
KAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSTGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQST
HVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRG
KNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLTLEVFSMLRDEDGKPTSPSEYSLQQTRDGNVFLVP

>In-frame_PAX8_ENST00000263335_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_731aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVE
KIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEATASPSHTKGEQVSSATFQSLVP
DIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNTHFYSSIPSM
EKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFTSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLC
KAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSTGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQST
HVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRG
KNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLTLEVFSMLRDEDGKPTSPSEYSLQQTRDGNVFLVP

>In-frame_PAX8_ENST00000263335_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_731aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVE
KIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEATASPSHTKGEQVSSATFQSLVP
DIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNTHFYSSIPSM
EKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFTSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLC
KAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSTGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQST
HVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRG
KNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLTLEVFSMLRDEDGKPTSPSEYSLQQTRDGNVFLVP

>In-frame_PAX8_ENST00000263334_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_731aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVE
KIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEATASPSHTKGEQVSSATFQSLVP
DIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNTHFYSSIPSM
EKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFTSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLC
KAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSTGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQST
HVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRG
KNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLTLEVFSMLRDEDGKPTSPSEYSLQQTRDGNVFLVP

>In-frame_PAX8_ENST00000263334_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_731aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVE
KIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEATASPSHTKGEQVSSATFQSLVP
DIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNTHFYSSIPSM
EKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFTSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLC
KAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSTGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQST
HVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRG
KNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLTLEVFSMLRDEDGKPTSPSEYSLQQTRDGNVFLVP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PAX8_ENST00000348715_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_2193nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC

>In-frame_PAX8_ENST00000348715_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_2193nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC

>In-frame_PAX8_ENST00000397647_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_2193nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC

>In-frame_PAX8_ENST00000397647_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_2193nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC

>In-frame_PAX8_ENST00000263335_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_2193nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC

>In-frame_PAX8_ENST00000263335_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_2193nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC

>In-frame_PAX8_ENST00000263334_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_2193nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC

>In-frame_PAX8_ENST00000263334_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_2193nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PAX8_ENST00000348715_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_2829nt
TTCAGAAGGAGGAGAGACACCGGGCCCAGGGCACCCTCGCGGGCGGACCCAACCAGTGAGGGCCTGCAGCCGGCCGGCCAGGGCAGCGGC
AGGCGCGGCCCGGACCTACGGGAGGAAGCCCCGAGCCCTCGGCGGGCTGCGAGCGACTCCCCGGCGATGCCTCACAACTCCATCAGATCT
GGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTCCGCCAGCGCATCGTAGACCTGGCC
CACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAGATCCTTGGCAGGTACTACGAGACT
GGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAGAAGATTGGGGACTACAAACGCCAG
AACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGACACTGTGCCCAGTGTCAGCTCCATT
AATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACCAAGTCCCTGAGTCCCGGACACACG
CTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTACTCCATCAATGGGCTCCTGGGCATC
GCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATTGACTCACAGAGCAGCAGCAGCGGA
CCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTTGAGCGGCAGCACTACCCAGAGGCC
TATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCTGATATTCCCGGTCACATCGAGAGC
CCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTTGATTTAGACGGTATGCAACAGGAC
ATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGACAAGCTGGTTGAGACTACCATGGTT
CCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATGGAAAAAGAAGTAGGTAACTGTAGT
CCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAGTTGACAGTGAACTCATTAAATTCA
GATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATCAGCAACAGCATGCCCTCACCTGCT
ACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGCAAAGCTTTCAACCAAAACCACCCT
GAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCATCACCAGAACACTCAGTGGAATCT
TCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCTGGAAGTGTCAAACAGAATGGTCCT
AAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACTCACGTGCATGATGCCCAATGTGAG
AACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAACATTCAAGCCGCTTGGAGGCTCAT
CTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAACCTCCCTGTTGTTGACTTCAACGAA
ATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGTAAGAATAAAGTGGCTGCTCAGAAT
TGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAAAAAGAAAAATTGCTCAAAGAAAAA
GGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTCAGCATGCTACGTGATGAAGATGGA
AAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCCAAAAGTAAGAAGCCAGATGTTAAG
AAAAACTAGATTTAGGAGGATTTGACCTTTTCTGAGCTAGTTTTTTTGTACTATTATACTAAAAGCTCCTACTGTGATGTGAAATGCTCA
TACTTTATAAGTAATTCTATGCAAAATCATAGCCAAAACTAGTATAGAAAATAATACGAAACTTTAAAAAGCATTGGAGTGTCAGTATGT
TGAATCAGTAGTTTCACTTTAACTGTAAACAATTTCTTAGGACACCATTTGGGCTAGTTTCTGTGTAAGTGTAAATACTACAAAAACTTA
TTTATACTGTTCTTATGTCATTTGTTATATTCATAGATTTATATGATGATATGACATCTGGCTAAAAAGAAATTATTGCAAAACTAACCA
CTATGTACTTTTTTATAAATACTGTATGGACAAAAAATGGCATTTTTTATATTAAATTGTTTAGCTCTGGCAAAAAAAAAAAATTTTAAG

>In-frame_PAX8_ENST00000348715_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_2829nt
TTCAGAAGGAGGAGAGACACCGGGCCCAGGGCACCCTCGCGGGCGGACCCAACCAGTGAGGGCCTGCAGCCGGCCGGCCAGGGCAGCGGC
AGGCGCGGCCCGGACCTACGGGAGGAAGCCCCGAGCCCTCGGCGGGCTGCGAGCGACTCCCCGGCGATGCCTCACAACTCCATCAGATCT
GGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTCCGCCAGCGCATCGTAGACCTGGCC
CACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAGATCCTTGGCAGGTACTACGAGACT
GGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAGAAGATTGGGGACTACAAACGCCAG
AACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGACACTGTGCCCAGTGTCAGCTCCATT
AATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACCAAGTCCCTGAGTCCCGGACACACG
CTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTACTCCATCAATGGGCTCCTGGGCATC
GCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATTGACTCACAGAGCAGCAGCAGCGGA
CCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTTGAGCGGCAGCACTACCCAGAGGCC
TATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCTGATATTCCCGGTCACATCGAGAGC
CCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTTGATTTAGACGGTATGCAACAGGAC
ATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGACAAGCTGGTTGAGACTACCATGGTT
CCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATGGAAAAAGAAGTAGGTAACTGTAGT
CCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAGTTGACAGTGAACTCATTAAATTCA
GATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATCAGCAACAGCATGCCCTCACCTGCT
ACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGCAAAGCTTTCAACCAAAACCACCCT
GAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCATCACCAGAACACTCAGTGGAATCT
TCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCTGGAAGTGTCAAACAGAATGGTCCT
AAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACTCACGTGCATGATGCCCAATGTGAG
AACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAACATTCAAGCCGCTTGGAGGCTCAT
CTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAACCTCCCTGTTGTTGACTTCAACGAA
ATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGTAAGAATAAAGTGGCTGCTCAGAAT
TGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAAAAAGAAAAATTGCTCAAAGAAAAA
GGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTCAGCATGCTACGTGATGAAGATGGA
AAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCCAAAAGTAAGAAGCCAGATGTTAAG
AAAAACTAGATTTAGGAGGATTTGACCTTTTCTGAGCTAGTTTTTTTGTACTATTATACTAAAAGCTCCTACTGTGATGTGAAATGCTCA
TACTTTATAAGTAATTCTATGCAAAATCATAGCCAAAACTAGTATAGAAAATAATACGAAACTTTAAAAAGCATTGGAGTGTCAGTATGT
TGAATCAGTAGTTTCACTTTAACTGTAAACAATTTCTTAGGACACCATTTGGGCTAGTTTCTGTGTAAGTGTAAATACTACAAAAACTTA
TTTATACTGTTCTTATGTCATTTGTTATATTCATAGATTTATATGATGATATGACATCTGGCTAAAAAGAAATTATTGCAAAACTAACCA
CTATGTACTTTTTTATAAATACTGTATGGACAAAAAATGGCATTTTTTATATTAAATTGTTTAGCTCTGGCAAAAAAAAAAAATTTTAAG

>In-frame_PAX8_ENST00000397647_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_2829nt
TTCAGAAGGAGGAGAGACACCGGGCCCAGGGCACCCTCGCGGGCGGACCCAACCAGTGAGGGCCTGCAGCCGGCCGGCCAGGGCAGCGGC
AGGCGCGGCCCGGACCTACGGGAGGAAGCCCCGAGCCCTCGGCGGGCTGCGAGCGACTCCCCGGCGATGCCTCACAACTCCATCAGATCT
GGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTCCGCCAGCGCATCGTAGACCTGGCC
CACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAGATCCTTGGCAGGTACTACGAGACT
GGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAGAAGATTGGGGACTACAAACGCCAG
AACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGACACTGTGCCCAGTGTCAGCTCCATT
AATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACCAAGTCCCTGAGTCCCGGACACACG
CTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTACTCCATCAATGGGCTCCTGGGCATC
GCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATTGACTCACAGAGCAGCAGCAGCGGA
CCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTTGAGCGGCAGCACTACCCAGAGGCC
TATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCTGATATTCCCGGTCACATCGAGAGC
CCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTTGATTTAGACGGTATGCAACAGGAC
ATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGACAAGCTGGTTGAGACTACCATGGTT
CCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATGGAAAAAGAAGTAGGTAACTGTAGT
CCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAGTTGACAGTGAACTCATTAAATTCA
GATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATCAGCAACAGCATGCCCTCACCTGCT
ACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGCAAAGCTTTCAACCAAAACCACCCT
GAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCATCACCAGAACACTCAGTGGAATCT
TCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCTGGAAGTGTCAAACAGAATGGTCCT
AAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACTCACGTGCATGATGCCCAATGTGAG
AACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAACATTCAAGCCGCTTGGAGGCTCAT
CTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAACCTCCCTGTTGTTGACTTCAACGAA
ATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGTAAGAATAAAGTGGCTGCTCAGAAT
TGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAAAAAGAAAAATTGCTCAAAGAAAAA
GGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTCAGCATGCTACGTGATGAAGATGGA
AAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCCAAAAGTAAGAAGCCAGATGTTAAG
AAAAACTAGATTTAGGAGGATTTGACCTTTTCTGAGCTAGTTTTTTTGTACTATTATACTAAAAGCTCCTACTGTGATGTGAAATGCTCA
TACTTTATAAGTAATTCTATGCAAAATCATAGCCAAAACTAGTATAGAAAATAATACGAAACTTTAAAAAGCATTGGAGTGTCAGTATGT
TGAATCAGTAGTTTCACTTTAACTGTAAACAATTTCTTAGGACACCATTTGGGCTAGTTTCTGTGTAAGTGTAAATACTACAAAAACTTA
TTTATACTGTTCTTATGTCATTTGTTATATTCATAGATTTATATGATGATATGACATCTGGCTAAAAAGAAATTATTGCAAAACTAACCA
CTATGTACTTTTTTATAAATACTGTATGGACAAAAAATGGCATTTTTTATATTAAATTGTTTAGCTCTGGCAAAAAAAAAAAATTTTAAG

>In-frame_PAX8_ENST00000397647_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_2829nt
TTCAGAAGGAGGAGAGACACCGGGCCCAGGGCACCCTCGCGGGCGGACCCAACCAGTGAGGGCCTGCAGCCGGCCGGCCAGGGCAGCGGC
AGGCGCGGCCCGGACCTACGGGAGGAAGCCCCGAGCCCTCGGCGGGCTGCGAGCGACTCCCCGGCGATGCCTCACAACTCCATCAGATCT
GGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTCCGCCAGCGCATCGTAGACCTGGCC
CACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAGATCCTTGGCAGGTACTACGAGACT
GGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAGAAGATTGGGGACTACAAACGCCAG
AACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGACACTGTGCCCAGTGTCAGCTCCATT
AATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACCAAGTCCCTGAGTCCCGGACACACG
CTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTACTCCATCAATGGGCTCCTGGGCATC
GCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATTGACTCACAGAGCAGCAGCAGCGGA
CCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTTGAGCGGCAGCACTACCCAGAGGCC
TATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCTGATATTCCCGGTCACATCGAGAGC
CCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTTGATTTAGACGGTATGCAACAGGAC
ATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGACAAGCTGGTTGAGACTACCATGGTT
CCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATGGAAAAAGAAGTAGGTAACTGTAGT
CCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAGTTGACAGTGAACTCATTAAATTCA
GATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATCAGCAACAGCATGCCCTCACCTGCT
ACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGCAAAGCTTTCAACCAAAACCACCCT
GAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCATCACCAGAACACTCAGTGGAATCT
TCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCTGGAAGTGTCAAACAGAATGGTCCT
AAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACTCACGTGCATGATGCCCAATGTGAG
AACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAACATTCAAGCCGCTTGGAGGCTCAT
CTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAACCTCCCTGTTGTTGACTTCAACGAA
ATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGTAAGAATAAAGTGGCTGCTCAGAAT
TGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAAAAAGAAAAATTGCTCAAAGAAAAA
GGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTCAGCATGCTACGTGATGAAGATGGA
AAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCCAAAAGTAAGAAGCCAGATGTTAAG
AAAAACTAGATTTAGGAGGATTTGACCTTTTCTGAGCTAGTTTTTTTGTACTATTATACTAAAAGCTCCTACTGTGATGTGAAATGCTCA
TACTTTATAAGTAATTCTATGCAAAATCATAGCCAAAACTAGTATAGAAAATAATACGAAACTTTAAAAAGCATTGGAGTGTCAGTATGT
TGAATCAGTAGTTTCACTTTAACTGTAAACAATTTCTTAGGACACCATTTGGGCTAGTTTCTGTGTAAGTGTAAATACTACAAAAACTTA
TTTATACTGTTCTTATGTCATTTGTTATATTCATAGATTTATATGATGATATGACATCTGGCTAAAAAGAAATTATTGCAAAACTAACCA
CTATGTACTTTTTTATAAATACTGTATGGACAAAAAATGGCATTTTTTATATTAAATTGTTTAGCTCTGGCAAAAAAAAAAAATTTTAAG

>In-frame_PAX8_ENST00000263335_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_2829nt
TTCAGAAGGAGGAGAGACACCGGGCCCAGGGCACCCTCGCGGGCGGACCCAACCAGTGAGGGCCTGCAGCCGGCCGGCCAGGGCAGCGGC
AGGCGCGGCCCGGACCTACGGGAGGAAGCCCCGAGCCCTCGGCGGGCTGCGAGCGACTCCCCGGCGATGCCTCACAACTCCATCAGATCT
GGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTCCGCCAGCGCATCGTAGACCTGGCC
CACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAGATCCTTGGCAGGTACTACGAGACT
GGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAGAAGATTGGGGACTACAAACGCCAG
AACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGACACTGTGCCCAGTGTCAGCTCCATT
AATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACCAAGTCCCTGAGTCCCGGACACACG
CTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTACTCCATCAATGGGCTCCTGGGCATC
GCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATTGACTCACAGAGCAGCAGCAGCGGA
CCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTTGAGCGGCAGCACTACCCAGAGGCC
TATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCTGATATTCCCGGTCACATCGAGAGC
CCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTTGATTTAGACGGTATGCAACAGGAC
ATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGACAAGCTGGTTGAGACTACCATGGTT
CCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATGGAAAAAGAAGTAGGTAACTGTAGT
CCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAGTTGACAGTGAACTCATTAAATTCA
GATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATCAGCAACAGCATGCCCTCACCTGCT
ACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGCAAAGCTTTCAACCAAAACCACCCT
GAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCATCACCAGAACACTCAGTGGAATCT
TCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCTGGAAGTGTCAAACAGAATGGTCCT
AAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACTCACGTGCATGATGCCCAATGTGAG
AACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAACATTCAAGCCGCTTGGAGGCTCAT
CTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAACCTCCCTGTTGTTGACTTCAACGAA
ATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGTAAGAATAAAGTGGCTGCTCAGAAT
TGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAAAAAGAAAAATTGCTCAAAGAAAAA
GGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTCAGCATGCTACGTGATGAAGATGGA
AAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCCAAAAGTAAGAAGCCAGATGTTAAG
AAAAACTAGATTTAGGAGGATTTGACCTTTTCTGAGCTAGTTTTTTTGTACTATTATACTAAAAGCTCCTACTGTGATGTGAAATGCTCA
TACTTTATAAGTAATTCTATGCAAAATCATAGCCAAAACTAGTATAGAAAATAATACGAAACTTTAAAAAGCATTGGAGTGTCAGTATGT
TGAATCAGTAGTTTCACTTTAACTGTAAACAATTTCTTAGGACACCATTTGGGCTAGTTTCTGTGTAAGTGTAAATACTACAAAAACTTA
TTTATACTGTTCTTATGTCATTTGTTATATTCATAGATTTATATGATGATATGACATCTGGCTAAAAAGAAATTATTGCAAAACTAACCA
CTATGTACTTTTTTATAAATACTGTATGGACAAAAAATGGCATTTTTTATATTAAATTGTTTAGCTCTGGCAAAAAAAAAAAATTTTAAG

>In-frame_PAX8_ENST00000263335_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_2829nt
TTCAGAAGGAGGAGAGACACCGGGCCCAGGGCACCCTCGCGGGCGGACCCAACCAGTGAGGGCCTGCAGCCGGCCGGCCAGGGCAGCGGC
AGGCGCGGCCCGGACCTACGGGAGGAAGCCCCGAGCCCTCGGCGGGCTGCGAGCGACTCCCCGGCGATGCCTCACAACTCCATCAGATCT
GGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTCCGCCAGCGCATCGTAGACCTGGCC
CACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAGATCCTTGGCAGGTACTACGAGACT
GGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAGAAGATTGGGGACTACAAACGCCAG
AACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGACACTGTGCCCAGTGTCAGCTCCATT
AATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACCAAGTCCCTGAGTCCCGGACACACG
CTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTACTCCATCAATGGGCTCCTGGGCATC
GCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATTGACTCACAGAGCAGCAGCAGCGGA
CCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTTGAGCGGCAGCACTACCCAGAGGCC
TATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCTGATATTCCCGGTCACATCGAGAGC
CCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTTGATTTAGACGGTATGCAACAGGAC
ATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGACAAGCTGGTTGAGACTACCATGGTT
CCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATGGAAAAAGAAGTAGGTAACTGTAGT
CCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAGTTGACAGTGAACTCATTAAATTCA
GATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATCAGCAACAGCATGCCCTCACCTGCT
ACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGCAAAGCTTTCAACCAAAACCACCCT
GAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCATCACCAGAACACTCAGTGGAATCT
TCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCTGGAAGTGTCAAACAGAATGGTCCT
AAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACTCACGTGCATGATGCCCAATGTGAG
AACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAACATTCAAGCCGCTTGGAGGCTCAT
CTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAACCTCCCTGTTGTTGACTTCAACGAA
ATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGTAAGAATAAAGTGGCTGCTCAGAAT
TGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAAAAAGAAAAATTGCTCAAAGAAAAA
GGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTCAGCATGCTACGTGATGAAGATGGA
AAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCCAAAAGTAAGAAGCCAGATGTTAAG
AAAAACTAGATTTAGGAGGATTTGACCTTTTCTGAGCTAGTTTTTTTGTACTATTATACTAAAAGCTCCTACTGTGATGTGAAATGCTCA
TACTTTATAAGTAATTCTATGCAAAATCATAGCCAAAACTAGTATAGAAAATAATACGAAACTTTAAAAAGCATTGGAGTGTCAGTATGT
TGAATCAGTAGTTTCACTTTAACTGTAAACAATTTCTTAGGACACCATTTGGGCTAGTTTCTGTGTAAGTGTAAATACTACAAAAACTTA
TTTATACTGTTCTTATGTCATTTGTTATATTCATAGATTTATATGATGATATGACATCTGGCTAAAAAGAAATTATTGCAAAACTAACCA
CTATGTACTTTTTTATAAATACTGTATGGACAAAAAATGGCATTTTTTATATTAAATTGTTTAGCTCTGGCAAAAAAAAAAAATTTTAAG

>In-frame_PAX8_ENST00000263334_chr2_113999128_-_NFE2L2_ENST00000397063_chr2_178097311_-_2673nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC
AAAAGTAAGAAGCCAGATGTTAAGAAAAACTAGATTTAGGAGGATTTGACCTTTTCTGAGCTAGTTTTTTTGTACTATTATACTAAAAGC
TCCTACTGTGATGTGAAATGCTCATACTTTATAAGTAATTCTATGCAAAATCATAGCCAAAACTAGTATAGAAAATAATACGAAACTTTA
AAAAGCATTGGAGTGTCAGTATGTTGAATCAGTAGTTTCACTTTAACTGTAAACAATTTCTTAGGACACCATTTGGGCTAGTTTCTGTGT
AAGTGTAAATACTACAAAAACTTATTTATACTGTTCTTATGTCATTTGTTATATTCATAGATTTATATGATGATATGACATCTGGCTAAA
AAGAAATTATTGCAAAACTAACCACTATGTACTTTTTTATAAATACTGTATGGACAAAAAATGGCATTTTTTATATTAAATTGTTTAGCT

>In-frame_PAX8_ENST00000263334_chr2_113999128_-_NFE2L2_ENST00000397062_chr2_178097311_-_2673nt
ATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAGCTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTC
CGCCAGCGCATCGTAGACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCATGGCTGCGTCAGCAAG
ATCCTTGGCAGGTACTACGAGACTGGCAGCATCCGGCCTGGAGTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAG
AAGATTGGGGACTACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAGGGCGTCTGTGACAATGAC
ACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACCAAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACC
AAGTCCCTGAGTCCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGATTCCCTGGGCTCCACCTAC
TCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGACAAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATT
GACTCACAGAGCAGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAGCCGCTCGAGTGCCCATTT
GAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCACACCAAAGGCGAGCAGGTTTCTTCGGCTACGTTTCAGTCACTTGTTCCT
GATATTCCCGGTCACATCGAGAGCCCAGTCTTCATTGCTACTAATCAGGCTCAGTCACCTGAAACTTCTGTTGCTCAGGTAGCCCCTGTT
GATTTAGACGGTATGCAACAGGACATTGAGCAAGTTTGGGAGGAGCTATTATCCATTCCTGAGTTACAGTGTCTTAATATTGAAAATGAC
AAGCTGGTTGAGACTACCATGGTTCCAAGTCCAGAAGCCAAACTGACAGAAGTTGACAATTATCATTTTTACTCATCTATACCCTCAATG
GAAAAAGAAGTAGGTAACTGTAGTCCACATTTTCTTAATGCTTTTGAGGATTCCTTCAGCAGCATCCTCTCCACAGAAGACCCCAACCAG
TTGACAGTGAACTCATTAAATTCAGATGCCACAGTCAACACAGATTTTGGTGATGAATTTTATTCTGCTTTCATAGCTGAGCCCAGTATC
AGCAACAGCATGCCCTCACCTGCTACTTTAAGCCATTCACTCTCTGAACTTCTAAATGGGCCCATTGATGTTTCTGATCTATCACTTTGC
AAAGCTTTCAACCAAAACCACCCTGAAAGCACAGCAGAATTCAATGATTCTGACTCCGGCATTTCACTAAACACAAGTCCCAGTGTGGCA
TCACCAGAACACTCAGTGGAATCTTCCAGCTATGGAGACACACTACTTGGCCTCAGTGATTCTGAAGTGGAAGAGCTAGATAGTGCCCCT
GGAAGTGTCAAACAGAATGGTCCTAAAACACCAGTACATTCTTCTGGGGATATGGTACAACCCTTGTCACCATCTCAGGGGCAGAGCACT
CACGTGCATGATGCCCAATGTGAGAACACACCAGAGAAAGAATTGCCTGTAAGTCCTGGTCATCGGAAAACCCCATTCACAAAAGACAAA
CATTCAAGCCGCTTGGAGGCTCATCTCACAAGAGATGAACTTAGGGCAAAAGCTCTCCATATCCCATTCCCTGTAGAAAAAATCATTAAC
CTCCCTGTTGTTGACTTCAACGAAATGATGTCCAAAGAGCAGTTCAATGAAGCTCAACTTGCATTAATTCGGGATATACGTAGGAGGGGT
AAGAATAAAGTGGCTGCTCAGAATTGCAGAAAAAGAAAACTGGAAAATATAGTAGAACTAGAGCAAGATTTAGATCATTTGAAAGATGAA
AAAGAAAAATTGCTCAAAGAAAAAGGAGAAAATGACAAAAGCCTTCACCTACTGAAAAAACAACTCAGCACCTTATATCTCGAAGTTTTC
AGCATGCTACGTGATGAAGATGGAAAACCTTATTCTCCTAGTGAATACTCCCTGCAGCAAACAAGAGATGGCAATGTTTTCCTTGTTCCC
AAAAGTAAGAAGCCAGATGTTAAGAAAAACTAGATTTAGGAGGATTTGACCTTTTCTGAGCTAGTTTTTTTGTACTATTATACTAAAAGC
TCCTACTGTGATGTGAAATGCTCATACTTTATAAGTAATTCTATGCAAAATCATAGCCAAAACTAGTATAGAAAATAATACGAAACTTTA
AAAAGCATTGGAGTGTCAGTATGTTGAATCAGTAGTTTCACTTTAACTGTAAACAATTTCTTAGGACACCATTTGGGCTAGTTTCTGTGT
AAGTGTAAATACTACAAAAACTTATTTATACTGTTCTTATGTCATTTGTTATATTCATAGATTTATATGATGATATGACATCTGGCTAAA
AAGAAATTATTGCAAAACTAACCACTATGTACTTTTTTATAAATACTGTATGGACAAAAAATGGCATTTTTTATATTAAATTGTTTAGCT


Top

FusionGenePPI for PAX8_NFE2L2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PAX8NKX2-1, POU2AF1, CHUK, CXCL9, PKM, SERINC1, ANXA7, EP300, RB1NFE2L2CREBBP, PMF1, EIF2AK3, KEAP1, MAFK, MAFF, JUN, TRIM24, SMARCA4, CUL3, NCOR2, NCOR1, YY1, MYC, BACH1, PRKCD, PRKCA, PRKCQ, PRKCH, PRKCG, SQSTM1, GADD45GIP1, CDKN1A, GSK3B, PGAM5, UBE2E3, UBE2E2, COPS7A, ENC1, MAFG, BPTF, SUMO1, SUMO2, RNF4, SIAH2, NFE2L3, NFE2, ATF4, CREB3, AHR, KPNA3, RBMX, NQO1, BRCA1, AKT1, MAPK8, MAPK9, MAP2K1, MAP2K2, MAPK7, HDAC1, HDAC2, HDAC3, FBXW11, TNNT1, WAC, TCF20, UBC, BTRC, TRIM28, RBM45, MAF, CDH1, PAQR3, PPP1R13L, DCAF11


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PAX8_NFE2L2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PAX8_NFE2L2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePAX8C1869118HYPOTHYROIDISM, CONGENITAL, DUE TO THYROID DYSGENESIS3CTD_human;ORPHANET;UNIPROT
HgenePAX8C0009404Colorectal Neoplasms1CTD_human
HgenePAX8C2931367Thyroid cancer, follicular1CTD_human
TgeneNFE2L2C4277682Chemical and Drug Induced Liver Injury4CTD_human
TgeneNFE2L2C0007131Non-Small Cell Lung Carcinoma2CTD_human
TgeneNFE2L2C0033578Prostatic Neoplasms2CTD_human
TgeneNFE2L2C0007137Squamous cell carcinoma1CTD_human
TgeneNFE2L2C0008370Cholestasis1CTD_human
TgeneNFE2L2C0011881Diabetic Nephropathy1CTD_human
TgeneNFE2L2C0013990Pathological accumulation of air in tissues1CTD_human
TgeneNFE2L2C0014072Experimental Autoimmune Encephalomyelitis1CTD_human
TgeneNFE2L2C0014170Endometrial Neoplasms1CTD_human
TgeneNFE2L2C0017178Gastrointestinal Diseases1CTD_human
TgeneNFE2L2C0020456Hyperglycemia1CTD_human
TgeneNFE2L2C0020507Hyperplasia1CTD_human
TgeneNFE2L2C0022593Keratosis1CTD_human
TgeneNFE2L2C0022658Kidney Diseases1CTD_human
TgeneNFE2L2C0023890Liver Cirrhosis1CTD_human
TgeneNFE2L2C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneNFE2L2C0023903Liver neoplasms1CTD_human
TgeneNFE2L2C0027540Necrosis1CTD_human
TgeneNFE2L2C0034069Pulmonary Fibrosis1CTD_human
TgeneNFE2L2C0037286Skin Neoplasms1CTD_human
TgeneNFE2L2C0041755Adverse reaction to drug1CTD_human
TgeneNFE2L2C0085215Ovarian Failure, Premature1CTD_human
TgeneNFE2L2C0162820Dermatitis, Allergic Contact1CTD_human
TgeneNFE2L2C0235032Neurotoxicity Syndromes1CTD_human
TgeneNFE2L2C0242488Acute Lung Injury1CTD_human
TgeneNFE2L2C0279626Squamous cell carcinoma of esophagus1CTD_human
TgeneNFE2L2C0400966Non-alcoholic Fatty Liver Disease1CTD_human
TgeneNFE2L2C0887833Carcinoma, Pancreatic Ductal1CTD_human
TgeneNFE2L2C2239176Liver carcinoma1CTD_human
TgeneNFE2L2C2609414Acute kidney injury1CTD_human