FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26073

FusionGeneSummary for PAX5_AUTS2

check button Fusion gene summary
Fusion gene informationFusion gene name: PAX5_AUTS2
Fusion gene ID: 26073
HgeneTgene
Gene symbol

PAX5

AUTS2

Gene ID

5079

26053

Gene namepaired box 5AUTS2, activator of transcription and developmental regulator
SynonymsALL3|BSAPFBRSL2|MRD26
Cytomap

9p13.2

7q11.22

Type of geneprotein-codingprotein-coding
Descriptionpaired box protein Pax-5B-cell lineage specific activatorpaired box homeotic gene 5paired domain gene 5transcription factor PAX 5autism susceptibility gene 2 proteinautism susceptibility candidate 2autism-related protein 1
Modification date2018052020180519
UniProtAcc

Q02548

Q8WXX7

Ensembl transtripts involved in fusion geneENST00000358127, ENST00000523241, 
ENST00000520154, ENST00000377852, 
ENST00000377853, ENST00000522003, 
ENST00000520281, ENST00000414447, 
ENST00000523145, ENST00000446742, 
ENST00000377847, 
ENST00000406775, 
ENST00000342771, ENST00000403018, 
ENST00000489774, 
Fusion gene scores* DoF score7 X 8 X 2=11218 X 16 X 6=1728
# samples 820
** MAII scorelog2(8/112*10)=-0.485426827170242
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1728*10)=-3.11103131238874
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PAX5 [Title/Abstract] AND AUTS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneAUTS2

GO:0045944

positive regulation of transcription by RNA polymerase II

25519132

TgeneAUTS2

GO:0051571

positive regulation of histone H3-K4 methylation

25519132

TgeneAUTS2

GO:2000620

positive regulation of histone H4-K16 acetylation

25519132


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1EU784146PAX5chr9

36966546

-AUTS2chr7

69599518

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000358127ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000358127ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000358127ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000358127ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000523241ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000523241ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000523241ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000523241ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000520154ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000520154ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000520154ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000520154ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000377852ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000377852ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000377852ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000377852ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000377853ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000377853ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000377853ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000377853ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
Frame-shitENST00000522003ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
Frame-shitENST00000522003ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
Frame-shitENST00000522003ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000522003ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000520281ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000520281ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000520281ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000520281ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000414447ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000414447ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000414447ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000414447ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
Frame-shitENST00000523145ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
Frame-shitENST00000523145ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
Frame-shitENST00000523145ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000523145ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000446742ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000446742ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000446742ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000446742ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000377847ENST00000406775PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000377847ENST00000342771PAX5chr9

36966546

-AUTS2chr7

69599518

+
In-frameENST00000377847ENST00000403018PAX5chr9

36966546

-AUTS2chr7

69599518

+
5CDS-intronENST00000377847ENST00000489774PAX5chr9

36966546

-AUTS2chr7

69599518

+

Top

FusionProtFeatures for PAX5_AUTS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PAX5

Q02548

AUTS2

Q8WXX7

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain thetranscriptionally repressive state of many genes, including Hoxgenes, throughout development. PcG PRC1 complex acts via chromatinremodeling and modification of histones; it mediatesmonoubiquitination of histone H2A 'Lys-119', rendering chromatinheritably changed in its expressibility (PubMed:25519132). ThePRC1-like complex that contains PCGF5, RNF2, CSNK2B, RYBP andAUTS2 has decreased histone H2A ubiquitination activity, due tothe phosphorylation of RNF2 by CSNK2B (PubMed:25519132). As aconsequence, the complex mediates transcriptional activation(PubMed:25519132). In the cytoplasm, plays a role in axon anddendrite elongation and in neuronal migration during embryonicbrain development. Promotes reorganization of the actincytoskeleton, lamellipodia formation and neurite elongation viaits interaction with RAC guanine nucleotide exchange factors,which then leads to the activation of RAC1 (By similarity).{ECO:0000250|UniProtKB:A0A087WPF7, ECO:0000269|PubMed:25519132}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePAX5chr9:36966546chr7:69599518ENST00000358127-61016_142260392DomainPaired
HgenePAX5chr9:36966546chr7:69599518ENST00000377847-6816_142260329DomainPaired
HgenePAX5chr9:36966546chr7:69599518ENST00000377852-6916_142260358DomainPaired
HgenePAX5chr9:36966546chr7:69599518ENST00000377853-6916_142260363DomainPaired
HgenePAX5chr9:36966546chr7:69599518ENST00000414447-5916_142217349DomainPaired
HgenePAX5chr9:36966546chr7:69599518ENST00000446742-5816_142194292DomainPaired
HgenePAX5chr9:36966546chr7:69599518ENST00000520281-5816_142217320DomainPaired
TgeneAUTS2chr9:36966546chr7:69599518ENST00000342771+2191122_11812081260Compositional biasHis-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000342771+219288_4712081260Compositional biasPro-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000342771+219525_5482081260Compositional biasHis-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000342771+219545_6462081260Compositional biasPro-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000403018+251122_1181208267Compositional biasHis-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000403018+25288_471208267Compositional biasPro-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000403018+25525_548208267Compositional biasHis-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000403018+25545_646208267Compositional biasPro-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000406775+2181122_11812081236Compositional biasHis-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000406775+218288_4712081236Compositional biasPro-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000406775+218525_5482081236Compositional biasHis-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000406775+218545_6462081236Compositional biasPro-rich
TgeneAUTS2chr9:36966546chr7:69599518ENST00000342771+219289_4722081260RegionImportant for regulation of lamellipodia formation
TgeneAUTS2chr9:36966546chr7:69599518ENST00000403018+25289_472208267RegionImportant for regulation of lamellipodia formation
TgeneAUTS2chr9:36966546chr7:69599518ENST00000406775+218289_4722081236RegionImportant for regulation of lamellipodia formation

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PAX5_AUTS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PAX5_ENST00000358127_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_1028aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGL
KPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPN
SMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLP
VNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESA
RPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDR
TRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHH
HPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRISPTAGNQNGLLNKTPPTAALSAPPP

>In-frame_PAX5_ENST00000358127_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_1052aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAW
QIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPS
TFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVS
KDDKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRA
AGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGP
LASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPR
LYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRIS

>In-frame_PAX5_ENST00000358127_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_59aa

>In-frame_PAX5_ENST00000523241_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_1028aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGL
KPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPN
SMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLP
VNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESA
RPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDR
TRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHH
HPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRISPTAGNQNGLLNKTPPTAALSAPPP

>In-frame_PAX5_ENST00000523241_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_1052aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAW
QIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPS
TFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVS
KDDKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRA
AGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGP
LASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPR
LYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRIS

>In-frame_PAX5_ENST00000523241_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_59aa

>In-frame_PAX5_ENST00000520154_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_1028aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGL
KPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPN
SMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLP
VNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESA
RPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDR
TRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHH
HPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRISPTAGNQNGLLNKTPPTAALSAPPP

>In-frame_PAX5_ENST00000520154_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_1052aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAW
QIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPS
TFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVS
KDDKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRA
AGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGP
LASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPR
LYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRIS

>In-frame_PAX5_ENST00000520154_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_59aa

>In-frame_PAX5_ENST00000377852_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_1028aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGL
KPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPN
SMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLP
VNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESA
RPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDR
TRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHH
HPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRISPTAGNQNGLLNKTPPTAALSAPPP

>In-frame_PAX5_ENST00000377852_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_1052aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAW
QIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPS
TFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVS
KDDKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRA
AGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGP
LASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPR
LYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRIS

>In-frame_PAX5_ENST00000377852_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_59aa

>In-frame_PAX5_ENST00000377853_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_1028aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGL
KPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPN
SMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLP
VNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESA
RPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDR
TRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHH
HPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRISPTAGNQNGLLNKTPPTAALSAPPP

>In-frame_PAX5_ENST00000377853_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_1052aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAW
QIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPS
TFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVS
KDDKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRA
AGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGP
LASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPR
LYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRIS

>In-frame_PAX5_ENST00000377853_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_59aa

>In-frame_PAX5_ENST00000520281_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_1028aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGL
KPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPN
SMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLP
VNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESA
RPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDR
TRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHH
HPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRISPTAGNQNGLLNKTPPTAALSAPPP

>In-frame_PAX5_ENST00000520281_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_1052aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAW
QIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPS
TFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVS
KDDKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRA
AGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGP
LASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPR
LYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRIS

>In-frame_PAX5_ENST00000520281_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_59aa

>In-frame_PAX5_ENST00000414447_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_1028aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGL
KPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPN
SMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLP
VNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESA
RPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDR
TRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHH
HPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRISPTAGNQNGLLNKTPPTAALSAPPP

>In-frame_PAX5_ENST00000414447_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_1052aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAW
QIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPS
TFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVS
KDDKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRA
AGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGP
LASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPR
LYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRIS

>In-frame_PAX5_ENST00000414447_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_59aa

>In-frame_PAX5_ENST00000446742_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_1028aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGL
KPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPN
SMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLP
VNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESA
RPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDR
TRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHH
HPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRISPTAGNQNGLLNKTPPTAALSAPPP

>In-frame_PAX5_ENST00000446742_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_1052aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAW
QIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPS
TFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVS
KDDKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRA
AGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGP
LASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPR
LYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRIS

>In-frame_PAX5_ENST00000446742_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_59aa

>In-frame_PAX5_ENST00000377847_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_1028aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGL
KPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPN
SMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLP
VNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESA
RPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDR
TRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHH
HPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRISPTAGNQNGLLNKTPPTAALSAPPP

>In-frame_PAX5_ENST00000377847_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_1052aa
SSAPSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDP
CPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLS
QPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPPHISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQ
VAGHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPAPPMFDKYP
TKVDPFYRHSLFHSTPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAW
QIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPS
TFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVS
KDDKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGHEGRA
AGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGP
LASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPR
LYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHTPRIS

>In-frame_PAX5_ENST00000377847_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_59aa


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PAX5_ENST00000358127_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_3084nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATG
CATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTG
AAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTC
TCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAG
CCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAAC
TCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCG
TTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAA
CGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCG
GTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAG
AGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCAC
GGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCC
AGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTG
AAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCC
AGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGG
ACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGG
GACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCAC
CGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCAC
CACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTAC
GAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATG
CACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCG
CTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACG

>In-frame_PAX5_ENST00000358127_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_3156nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTA
CTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGG
CAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGC
CGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCA
CACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCT
ACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAG
GATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCC
TGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGT
AAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACAT
ACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCG
GAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCC
GCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCG
AGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAA
GACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCC
CTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCC
TTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCT
TACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGG
CTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGAC
CCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCAC
TCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGC
CCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGG
GGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCC

>In-frame_PAX5_ENST00000358127_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_177nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGAT

>In-frame_PAX5_ENST00000523241_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_3084nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATG
CATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTG
AAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTC
TCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAG
CCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAAC
TCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCG
TTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAA
CGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCG
GTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAG
AGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCAC
GGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCC
AGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTG
AAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCC
AGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGG
ACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGG
GACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCAC
CGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCAC
CACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTAC
GAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATG
CACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCG
CTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACG

>In-frame_PAX5_ENST00000523241_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_3156nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTA
CTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGG
CAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGC
CGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCA
CACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCT
ACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAG
GATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCC
TGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGT
AAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACAT
ACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCG
GAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCC
GCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCG
AGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAA
GACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCC
CTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCC
TTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCT
TACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGG
CTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGAC
CCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCAC
TCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGC
CCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGG
GGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCC

>In-frame_PAX5_ENST00000523241_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_177nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGAT

>In-frame_PAX5_ENST00000520154_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_3084nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATG
CATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTG
AAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTC
TCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAG
CCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAAC
TCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCG
TTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAA
CGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCG
GTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAG
AGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCAC
GGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCC
AGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTG
AAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCC
AGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGG
ACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGG
GACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCAC
CGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCAC
CACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTAC
GAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATG
CACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCG
CTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACG

>In-frame_PAX5_ENST00000520154_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_3156nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTA
CTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGG
CAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGC
CGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCA
CACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCT
ACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAG
GATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCC
TGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGT
AAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACAT
ACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCG
GAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCC
GCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCG
AGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAA
GACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCC
CTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCC
TTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCT
TACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGG
CTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGAC
CCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCAC
TCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGC
CCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGG
GGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCC

>In-frame_PAX5_ENST00000520154_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_177nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGAT

>In-frame_PAX5_ENST00000377852_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_3084nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATG
CATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTG
AAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTC
TCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAG
CCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAAC
TCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCG
TTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAA
CGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCG
GTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAG
AGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCAC
GGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCC
AGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTG
AAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCC
AGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGG
ACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGG
GACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCAC
CGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCAC
CACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTAC
GAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATG
CACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCG
CTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACG

>In-frame_PAX5_ENST00000377852_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_3156nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTA
CTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGG
CAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGC
CGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCA
CACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCT
ACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAG
GATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCC
TGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGT
AAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACAT
ACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCG
GAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCC
GCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCG
AGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAA
GACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCC
CTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCC
TTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCT
TACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGG
CTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGAC
CCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCAC
TCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGC
CCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGG
GGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCC

>In-frame_PAX5_ENST00000377852_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_177nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGAT

>In-frame_PAX5_ENST00000377853_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_3084nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATG
CATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTG
AAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTC
TCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAG
CCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAAC
TCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCG
TTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAA
CGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCG
GTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAG
AGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCAC
GGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCC
AGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTG
AAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCC
AGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGG
ACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGG
GACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCAC
CGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCAC
CACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTAC
GAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATG
CACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCG
CTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACG

>In-frame_PAX5_ENST00000377853_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_3156nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTA
CTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGG
CAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGC
CGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCA
CACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCT
ACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAG
GATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCC
TGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGT
AAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACAT
ACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCG
GAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCC
GCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCG
AGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAA
GACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCC
CTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCC
TTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCT
TACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGG
CTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGAC
CCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCAC
TCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGC
CCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGG
GGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCC

>In-frame_PAX5_ENST00000377853_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_177nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGAT

>In-frame_PAX5_ENST00000520281_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_3084nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATG
CATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTG
AAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTC
TCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAG
CCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAAC
TCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCG
TTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAA
CGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCG
GTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAG
AGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCAC
GGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCC
AGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTG
AAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCC
AGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGG
ACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGG
GACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCAC
CGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCAC
CACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTAC
GAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATG
CACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCG
CTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACG

>In-frame_PAX5_ENST00000520281_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_3156nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTA
CTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGG
CAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGC
CGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCA
CACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCT
ACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAG
GATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCC
TGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGT
AAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACAT
ACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCG
GAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCC
GCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCG
AGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAA
GACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCC
CTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCC
TTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCT
TACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGG
CTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGAC
CCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCAC
TCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGC
CCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGG
GGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCC

>In-frame_PAX5_ENST00000520281_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_177nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGAT

>In-frame_PAX5_ENST00000414447_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_3084nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATG
CATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTG
AAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTC
TCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAG
CCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAAC
TCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCG
TTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAA
CGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCG
GTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAG
AGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCAC
GGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCC
AGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTG
AAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCC
AGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGG
ACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGG
GACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCAC
CGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCAC
CACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTAC
GAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATG
CACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCG
CTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACG

>In-frame_PAX5_ENST00000414447_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_3156nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTA
CTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGG
CAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGC
CGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCA
CACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCT
ACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAG
GATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCC
TGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGT
AAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACAT
ACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCG
GAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCC
GCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCG
AGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAA
GACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCC
CTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCC
TTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCT
TACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGG
CTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGAC
CCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCAC
TCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGC
CCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGG
GGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCC

>In-frame_PAX5_ENST00000414447_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_177nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGAT

>In-frame_PAX5_ENST00000446742_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_3084nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATG
CATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTG
AAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTC
TCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAG
CCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAAC
TCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCG
TTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAA
CGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCG
GTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAG
AGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCAC
GGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCC
AGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTG
AAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCC
AGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGG
ACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGG
GACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCAC
CGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCAC
CACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTAC
GAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATG
CACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCG
CTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACG

>In-frame_PAX5_ENST00000446742_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_3156nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTA
CTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGG
CAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGC
CGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCA
CACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCT
ACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAG
GATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCC
TGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGT
AAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACAT
ACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCG
GAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCC
GCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCG
AGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAA
GACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCC
CTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCC
TTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCT
TACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGG
CTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGAC
CCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCAC
TCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGC
CCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGG
GGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCC

>In-frame_PAX5_ENST00000446742_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_177nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGAT

>In-frame_PAX5_ENST00000377847_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_3084nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATG
CATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTG
AAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTC
TCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAG
CCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAAC
TCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCG
TTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAA
CGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCG
GTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAG
AGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCAC
GGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCC
AGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTG
AAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCC
AGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGG
ACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGG
GACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCAC
CGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCAC
CACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTAC
GAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATG
CACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCG
CTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACG

>In-frame_PAX5_ENST00000377847_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_3156nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAA
CTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTC
CCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCC
TGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACA
GAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTG
CAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCC
CAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCC
CCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTC
CAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAG
GTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCT
GACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACG
CACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCT
ACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGC
CCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTA
CTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGG
CAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGC
CGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCA
CACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCT
ACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAG
GATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCC
TGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGT
AAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACAT
ACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCG
GAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCC
GCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCG
AGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAA
GACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCC
CTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCC
TTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCT
TACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGG
CTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGAC
CCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCAC
TCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGC
CCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGG
GGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCC

>In-frame_PAX5_ENST00000377847_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_177nt
AGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PAX5_ENST00000358127_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_5446nt
AAAAAAAAGAAAAAAAAAGGCACAAAAAAGTGGAAACTTTTCCCTGTCCATTCCATCAAGTCCTGAAAAATCAAAATGGATTTAGAGAAA
AATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGAT
GTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTC
AGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTG
GTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGAC
AATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGT
CACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTG
GGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCG
GGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCAC
TACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGT
GACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTT
GGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGAC
TGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCC
CAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAG
GGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAG
AACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGT
TTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTC
TCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCC
ACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATC
TTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAG
TTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACC
GCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTAT
CCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGAT
CCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTC
AAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGA
GCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCA
CCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGT
GGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGC
AACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGC
AGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTC
GAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGG
GCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGAC
GAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCC
CGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGT
GAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCG
CAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGG
GTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGC
GGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGA
GACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGG
GACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGC
CACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGA
CACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTC
CTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACG
ACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAAC
GAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCAC
CCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCC
AGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAA
TTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTG
TACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTA
AATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCT
GTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGA
GCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTT
TTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAA
AGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGG
TGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATAC
CTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATAT
GTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAAC
AGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTG
AGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTA
GCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAG

>In-frame_PAX5_ENST00000358127_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_6083nt
AAAAAAAAGAAAAAAAAAGGCACAAAAAAGTGGAAACTTTTCCCTGTCCATTCCATCAAGTCCTGAAAAATCAAAATGGATTTAGAGAAA
AATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGAT
GTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTC
AGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTG
GTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGAC
AATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGT
CACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTG
GGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCG
GGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCAC
TACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGT
GACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTT
GGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGAC
TGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCC
CAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAG
GGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAG
AACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGT
TTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTC
TCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCC
ACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATC
TTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAG
TTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACC
GCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTAT
CCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAAC
CCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTA
AGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCA
GACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCAT
GACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAAC
TTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGA
CTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGG
AACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCT
CATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGC
CACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAG
GCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAG
GGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTAC
GTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAAC
CCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCG
GAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCC
ATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTAC
CCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGAC
TTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGAC
TACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAG
CGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGC
CTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCG
ACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAG
ATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTA
GGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAA
ATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGT
CTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGC
GGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAA
GAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATA
ATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTT
ATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTT
ACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAAC
ATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGG
TAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACA
CACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGT
TTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAAT
AACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACC
TTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAA
TGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATA
TCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTGCTATCTGACGTTGTTA
TCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGAGAGATCTATTTTAGTAGTAAACTGA
AGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTTAAGACAACAACTAAAAAAAATGCAA
GGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGACCTTTTTGCTGTTTATCCTGTATGTA
ATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTCATCGGCGGAGCCTTCTTGTGTAATG
TAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGACCATCATTACCTTAGGGAAGAAGCCA
TACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGGCTCACCTGCAGTGGCTGACCACCCT

>In-frame_PAX5_ENST00000358127_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_1145nt
AAAAAAAAGAAAAAAAAAGGCACAAAAAAGTGGAAACTTTTCCCTGTCCATTCCATCAAGTCCTGAAAAATCAAAATGGATTTAGAGAAA
AATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGAT
GTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTC
AGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTG
GTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGAC
AATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGT
CACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTG
GGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCG
GGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCAC
TACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGG
AAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGATATGAAGAGGGATGTCAGCAACACTTCATCCTGGGCCAGTAATAGG
GAGAGTTTCTTTTCTCTCGTCAAATTGCTTAAAGGATTCTAGTTCCGTTTGGTGTGGTCACTCACATTTGAATTCTAATACTCTATGTGA

>In-frame_PAX5_ENST00000523241_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_5381nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGT
AAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGA
GAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCC
AATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCC
ACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACA
GTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAA
CAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCA
CCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACA
TCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGG
GAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGG
CCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCC
GTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTA
CCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGG
AGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCA
GATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCG
CCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACA
CCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTAC
ATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGA
TGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTG
GCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAA
AGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATAC
CCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGA
ATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGC
GGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAG
CCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGA
CCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCT
GGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTT
CATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTA
CCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCT
GTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCC
TCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTC
CGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCC
CACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGG
CCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCG
ATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCA
CACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGT
TGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAA
CAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTC
TTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGAT
GAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATA
TCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTC
ACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGAT
ATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAG
TTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCA
GATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCC
TTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCT
TCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATT
CCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAA
GTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACAT
ATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTC

>In-frame_PAX5_ENST00000523241_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_6018nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGT
AAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGA
GAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCC
AATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCC
ACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACA
GTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAA
CAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCA
CCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACA
TCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGG
GAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGG
CCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCC
GTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTA
CCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGG
AGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTT
GACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACA
GAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCT
TTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTT
TGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGC
AGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAA
CTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCT
GGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGA
AAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACA
GATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGC
CGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCA
GCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCG
CAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGA
GGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGAC
GGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCT
CCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCA
CCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTC
CTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCG
GGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCT
CGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAA
CGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAG
AAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAG
CAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAA
GCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTT
TTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACAC
ACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAA
GGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTAC
AAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGC
TAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACT
CAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTG
CTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCT
GGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGA
CGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTAT
TTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGA
TGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTC
TGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTG
TTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGAC
TTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTAT
ATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGA
GAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTT
AAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGAC
CTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTC
ATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGAC
CATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGG

>In-frame_PAX5_ENST00000523241_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_1080nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGATATGAAGAGGGATGTCAGCAA
CACTTCATCCTGGGCCAGTAATAGGGAGAGTTTCTTTTCTCTCGTCAAATTGCTTAAAGGATTCTAGTTCCGTTTGGTGTGGTCACTCAC
ATTTGAATTCTAATACTCTATGTGATATAGATTCTGTTGACTACTGTTAGCGTGACCCCAATGAGAAATTAAACACTTCCCTCCTTTTCA

>In-frame_PAX5_ENST00000520154_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_5381nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGT
AAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGA
GAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCC
AATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCC
ACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACA
GTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAA
CAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCA
CCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACA
TCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGG
GAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGG
CCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCC
GTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTA
CCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGG
AGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCA
GATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCG
CCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACA
CCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTAC
ATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGA
TGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTG
GCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAA
AGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATAC
CCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGA
ATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGC
GGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAG
CCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGA
CCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCT
GGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTT
CATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTA
CCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCT
GTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCC
TCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTC
CGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCC
CACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGG
CCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCG
ATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCA
CACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGT
TGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAA
CAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTC
TTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGAT
GAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATA
TCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTC
ACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGAT
ATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAG
TTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCA
GATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCC
TTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCT
TCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATT
CCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAA
GTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACAT
ATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTC

>In-frame_PAX5_ENST00000520154_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_6018nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGT
AAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGA
GAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCC
AATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCC
ACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACA
GTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAA
CAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCA
CCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACA
TCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGG
GAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGG
CCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCC
GTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTA
CCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGG
AGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTT
GACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACA
GAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCT
TTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTT
TGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGC
AGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAA
CTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCT
GGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGA
AAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACA
GATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGC
CGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCA
GCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCG
CAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGA
GGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGAC
GGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCT
CCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCA
CCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTC
CTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCG
GGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCT
CGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAA
CGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAG
AAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAG
CAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAA
GCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTT
TTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACAC
ACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAA
GGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTAC
AAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGC
TAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACT
CAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTG
CTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCT
GGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGA
CGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTAT
TTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGA
TGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTC
TGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTG
TTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGAC
TTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTAT
ATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGA
GAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTT
AAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGAC
CTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTC
ATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGAC
CATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGG

>In-frame_PAX5_ENST00000520154_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_1080nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGATATGAAGAGGGATGTCAGCAA
CACTTCATCCTGGGCCAGTAATAGGGAGAGTTTCTTTTCTCTCGTCAAATTGCTTAAAGGATTCTAGTTCCGTTTGGTGTGGTCACTCAC
ATTTGAATTCTAATACTCTATGTGATATAGATTCTGTTGACTACTGTTAGCGTGACCCCAATGAGAAATTAAACACTTCCCTCCTTTTCA

>In-frame_PAX5_ENST00000377852_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_5381nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGT
AAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGA
GAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCC
AATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCC
ACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACA
GTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAA
CAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCA
CCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACA
TCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGG
GAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGG
CCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCC
GTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTA
CCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGG
AGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCA
GATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCG
CCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACA
CCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTAC
ATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGA
TGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTG
GCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAA
AGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATAC
CCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGA
ATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGC
GGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAG
CCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGA
CCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCT
GGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTT
CATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTA
CCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCT
GTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCC
TCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTC
CGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCC
CACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGG
CCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCG
ATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCA
CACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGT
TGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAA
CAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTC
TTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGAT
GAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATA
TCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTC
ACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGAT
ATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAG
TTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCA
GATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCC
TTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCT
TCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATT
CCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAA
GTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACAT
ATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTC

>In-frame_PAX5_ENST00000377852_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_6018nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGT
AAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGA
GAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCC
AATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCC
ACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACA
GTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAA
CAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCA
CCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACA
TCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGG
GAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGG
CCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCC
GTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTA
CCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGG
AGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTT
GACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACA
GAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCT
TTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTT
TGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGC
AGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAA
CTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCT
GGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGA
AAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACA
GATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGC
CGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCA
GCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCG
CAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGA
GGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGAC
GGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCT
CCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCA
CCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTC
CTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCG
GGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCT
CGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAA
CGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAG
AAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAG
CAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAA
GCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTT
TTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACAC
ACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAA
GGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTAC
AAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGC
TAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACT
CAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTG
CTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCT
GGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGA
CGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTAT
TTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGA
TGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTC
TGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTG
TTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGAC
TTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTAT
ATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGA
GAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTT
AAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGAC
CTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTC
ATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGAC
CATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGG

>In-frame_PAX5_ENST00000377852_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_1080nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGATATGAAGAGGGATGTCAGCAA
CACTTCATCCTGGGCCAGTAATAGGGAGAGTTTCTTTTCTCTCGTCAAATTGCTTAAAGGATTCTAGTTCCGTTTGGTGTGGTCACTCAC
ATTTGAATTCTAATACTCTATGTGATATAGATTCTGTTGACTACTGTTAGCGTGACCCCAATGAGAAATTAAACACTTCCCTCCTTTTCA

>In-frame_PAX5_ENST00000377853_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_5381nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGT
AAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGA
GAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCC
AATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCC
ACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACA
GTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAA
CAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCA
CCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACA
TCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGG
GAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGG
CCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCC
GTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTA
CCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGG
AGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCA
GATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCG
CCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACA
CCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTAC
ATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGA
TGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTG
GCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAA
AGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATAC
CCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGA
ATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGC
GGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAG
CCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGA
CCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCT
GGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTT
CATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTA
CCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCT
GTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCC
TCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTC
CGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCC
CACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGG
CCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCG
ATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCA
CACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGT
TGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAA
CAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTC
TTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGAT
GAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATA
TCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTC
ACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGAT
ATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAG
TTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCA
GATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCC
TTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCT
TCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATT
CCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAA
GTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACAT
ATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTC

>In-frame_PAX5_ENST00000377853_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_6018nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGT
AAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGA
GAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCC
AATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCC
ACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACA
GTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAA
CAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCA
CCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACA
TCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGG
GAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGG
CCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCC
GTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTA
CCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGG
AGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTT
GACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACA
GAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCT
TTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTT
TGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGC
AGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAA
CTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCT
GGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGA
AAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACA
GATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGC
CGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCA
GCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCG
CAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGA
GGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGAC
GGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCT
CCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCA
CCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTC
CTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCG
GGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCT
CGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAA
CGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAG
AAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAG
CAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAA
GCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTT
TTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACAC
ACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAA
GGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTAC
AAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGC
TAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACT
CAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTG
CTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCT
GGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGA
CGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTAT
TTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGA
TGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTC
TGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTG
TTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGAC
TTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTAT
ATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGA
GAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTT
AAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGAC
CTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTC
ATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGAC
CATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGG

>In-frame_PAX5_ENST00000377853_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_1080nt
AAAAATCAAAATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTT
GGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGATATGAAGAGGGATGTCAGCAA
CACTTCATCCTGGGCCAGTAATAGGGAGAGTTTCTTTTCTCTCGTCAAATTGCTTAAAGGATTCTAGTTCCGTTTGGTGTGGTCACTCAC
ATTTGAATTCTAATACTCTATGTGATATAGATTCTGTTGACTACTGTTAGCGTGACCCCAATGAGAAATTAAACACTTCCCTCCTTTTCA

>In-frame_PAX5_ENST00000520281_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_5242nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTC
GCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCA
GAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCA
GTCCCAGCTTCCAGTCACAGCATAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAG
ATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACA
GAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCA
TCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGC
CAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAG
CCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGAC
CCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAG
CCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCAC
CCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACT
CCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTG
CACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCA
CTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGT
TTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCAC
CAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCT
CCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCC
CCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAA
CCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCA
CATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTG
GCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTC
AACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGA
AATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGG
CTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGAC
AGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCT
TCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGG
GAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCAC
CTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGG
ACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAG
AAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCG
CCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAAC
AGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCT
TTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTG
CTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGC
CACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTG
CACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATC
ACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCA
GCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGG
GAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGA
CACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTAT
AGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTA
CTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGC
GGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATT
GCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACAT
TAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGAC
AGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCA
TACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTG
TTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTG
AGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGG
TCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTA
ATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGA
CGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGG
AGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTC
TTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGT
CTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTGCTATCTGACGTTGTTATCCTGT

>In-frame_PAX5_ENST00000520281_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_5879nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTC
GCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCA
GAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCA
GTCCCAGCTTCCAGTCACAGCATAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAG
ATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACA
GAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCA
TCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGC
CAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAG
CCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGAC
CCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAG
CCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCAC
CCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACT
CCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTG
CACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCA
CTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGT
TTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCAC
CAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCT
CCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCC
CCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCT
GGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCT
ATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGA
CTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTG
TTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTA
GAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCC
AACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCG
TCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGAT
AAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTC
CCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAA
GAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGG
CACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGT
GCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAG
GTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCG
TCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGAC
AGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATC
CGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTC
CACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCAC
CACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGAC
TACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGC
ATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCC
CCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCAC
ACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAG
AGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTT
GAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATA
AAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCC
ACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGT
TCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGT
GCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTA
TGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTT
CCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCC
AGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGT
GCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACAC
ACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACC
CAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGT
TTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAG
GGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAA
TACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATA
TATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAA
AAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGAGAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATT
TTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTTAAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAG
TGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGACCTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATG
TGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTCATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAA
ATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGACCATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTG
AAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGGCTCACCTGCAGTGGCTGACCACCCTACCCAACTCGGTTAGTGTCTCACC

>In-frame_PAX5_ENST00000520281_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_941nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTC
GCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCA
GAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCA
GTCCCAGCTTCCAGTCACAGCATAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAG
ATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACA
GAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCA
TGTCTTAAATCTGGAAATGATATGAAGAGGGATGTCAGCAACACTTCATCCTGGGCCAGTAATAGGGAGAGTTTCTTTTCTCTCGTCAAA
TTGCTTAAAGGATTCTAGTTCCGTTTGGTGTGGTCACTCACATTTGAATTCTAATACTCTATGTGATATAGATTCTGTTGACTACTGTTA

>In-frame_PAX5_ENST00000414447_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_5242nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTC
GCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCA
GAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCA
GTCCCAGCTTCCAGTCACAGCATAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAG
ATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACA
GAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCA
TCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGC
CAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAG
CCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGAC
CCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAG
CCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCAC
CCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACT
CCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTG
CACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCA
CTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGT
TTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCAC
CAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCT
CCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCC
CCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAA
CCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCA
CATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTG
GCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTC
AACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGA
AATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGG
CTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGAC
AGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCT
TCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGG
GAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCAC
CTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGG
ACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAG
AAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCG
CCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAAC
AGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCT
TTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTG
CTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGC
CACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTG
CACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATC
ACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCA
GCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGG
GAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGA
CACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTAT
AGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTA
CTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGC
GGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATT
GCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACAT
TAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGAC
AGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCA
TACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTG
TTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTG
AGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGG
TCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTA
ATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGA
CGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGG
AGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTC
TTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGT
CTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTGCTATCTGACGTTGTTATCCTGT

>In-frame_PAX5_ENST00000414447_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_5879nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTC
GCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCA
GAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCA
GTCCCAGCTTCCAGTCACAGCATAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAG
ATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACA
GAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCA
TCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGC
CAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAG
CCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGAC
CCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAG
CCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCAC
CCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACT
CCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTG
CACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCA
CTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGT
TTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCAC
CAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCT
CCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCC
CCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCT
GGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCT
ATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGA
CTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTG
TTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTA
GAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCC
AACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCG
TCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGAT
AAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTC
CCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAA
GAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGG
CACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGT
GCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAG
GTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCG
TCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGAC
AGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATC
CGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTC
CACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCAC
CACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGAC
TACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGC
ATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCC
CCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCAC
ACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAG
AGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTT
GAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATA
AAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCC
ACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGT
TCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGT
GCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTA
TGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTT
CCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCC
AGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGT
GCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACAC
ACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACC
CAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGT
TTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAG
GGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAA
TACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATA
TATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAA
AAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGAGAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATT
TTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTTAAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAG
TGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGACCTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATG
TGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTCATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAA
ATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGACCATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTG
AAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGGCTCACCTGCAGTGGCTGACCACCCTACCCAACTCGGTTAGTGTCTCACC

>In-frame_PAX5_ENST00000414447_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_941nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTC
GCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCA
GAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCA
GTCCCAGCTTCCAGTCACAGCATAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAG
ATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACA
GAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCA
TGTCTTAAATCTGGAAATGATATGAAGAGGGATGTCAGCAACACTTCATCCTGGGCCAGTAATAGGGAGAGTTTCTTTTCTCTCGTCAAA
TTGCTTAAAGGATTCTAGTTCCGTTTGGTGTGGTCACTCACATTTGAATTCTAATACTCTATGTGATATAGATTCTGTTGACTACTGTTA

>In-frame_PAX5_ENST00000446742_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_5173nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGAC
AGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGC
ACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGT
TGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAA
CTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGC
CCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAAC
CTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTA
AGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCC
CTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACT
GCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTG
CGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTC
CATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCC
ATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCT
CCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCT
TTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAG
AAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCC
ATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCT
CCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGC
AATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAAC
CCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGC
GCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAG
AAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCT
CATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAG
CACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGG
GTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAG
CCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAG
ACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTG
ACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGA
GAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGAC
CCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGAC
CGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCAC
CTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACAC
CTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTC
AACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACT
CCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAG
GAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCC
TTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGT
CATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATTG
GATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTAC
ATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAAT
AGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTG
TTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCC
TTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTT
TTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGT
GTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGG
TGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTG
TACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTT
TTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGC
CGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGT
TTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGCA
GAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTGC

>In-frame_PAX5_ENST00000446742_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_5810nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCTGTGACAGTGAC
AGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGC
ACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGT
TGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAA
CTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGC
CCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAAC
CTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTA
AGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCC
CTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACT
GCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTG
CGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTC
CATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCC
ATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCT
CCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCT
ATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGG
AAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGAC
CCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGAC
CTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTC
CTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTT
GGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAAC
CGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCAT
GACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCAC
CCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCT
CGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGC
CACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTG
CGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCC
AAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAG
CCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATG
AACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCT
TCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTC
CTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTAC
AGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGC
TTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTC
ATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACA
GCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATA
AGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGC
AGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATG
TATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTC
CTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGG
GGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAG
ATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATA
CATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATA
GACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACA
GCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATC
CTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAA
CTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACAC
AGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTT
GTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAAC
TGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTG
TGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGT
CTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCT
TGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTGCTATCTGACGTTGTTATCC
TGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGAGAGATCTATTTTAGTAGTAAACTGAAGG
TTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTTAAGACAACAACTAAAAAAAATGCAAGGA
ATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGACCTTTTTGCTGTTTATCCTGTATGTAATA
AAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTCATCGGCGGAGCCTTCTTGTGTAATGTAA
ACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGACCATCATTACCTTAGGGAAGAAGCCATAC
CTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGGCTCACCTGCAGTGGCTGACCACCCTACC

>In-frame_PAX5_ENST00000446742_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_872nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGCTACTTCAGATCAGGGAAG
ATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGATATGAAGAGGGATGTCAGCAACACTTCATCCTGGGCCAGTAATAGGGAG
AGTTTCTTTTCTCTCGTCAAATTGCTTAAAGGATTCTAGTTCCGTTTGGTGTGGTCACTCACATTTGAATTCTAATACTCTATGTGATAT

>In-frame_PAX5_ENST00000377847_chr9_36966546_-_AUTS2_ENST00000406775_chr7_69599518_+_5371nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTC
GCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCA
GAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCA
GTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCC
ATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAAC
GGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTG
TTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGC
TACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGAT
CCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAG
GAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAG
CCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGT
ACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACC
CAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGC
TTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCC
TCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAAT
ATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTAC
TCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCC
TACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCAC
GCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGT
CTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAG
CCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCAC
CACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGC
CCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGG
ACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGC
CTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGT
GTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCA
GGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAA
GAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCC
ACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAG
GACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAG
GCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCC
GAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTG
CCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATG
CCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATC
AGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTT
GACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCC
GACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAG
CACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCC
GCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGC
AACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTC
TCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAG
AACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGG
GGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTT
CAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGAT
GACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGA
GGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTA
CTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACA
CAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCC
GCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGT
TTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTG
TGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAA
TCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTG
TGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTC
TCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTG
ATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTG
TGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAG
AATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCT

>In-frame_PAX5_ENST00000377847_chr9_36966546_-_AUTS2_ENST00000342771_chr7_69599518_+_6008nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTC
GCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCA
GAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCA
GTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCC
ATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAAC
GGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTG
TTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGC
TACTTCTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGAT
CCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAG
GAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAG
CCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGT
ACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACC
CAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGC
TTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCC
TCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAAT
ATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTAC
TCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCC
TACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCAC
GCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGT
CTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAG
CCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCT
TTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAG
AAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCC
ATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCT
CCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGC
AATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAAC
CCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGC
GCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAG
AAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCT
CATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAG
CACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGG
GTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAG
CCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAG
ACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTG
ACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGA
GAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGAC
CCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGAC
CGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCAC
CTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACAC
CTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTC
AACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACT
CCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAG
GAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCC
TTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGT
CATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATTG
GATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTAC
ATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAAT
AGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTG
TTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCC
TTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTT
TTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGT
GTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGG
TGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTG
TACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTT
TTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGC
CGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGT
TTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGCA
GAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTGC
TATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGAGAGATCTATT
TTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTTAAGACAACAA
CTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGACCTTTTTGCTG
TTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTCATCGGCGGAG
CCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGACCATCATTACC
TTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGGCTCACCTGCA

>In-frame_PAX5_ENST00000377847_chr9_36966546_-_AUTS2_ENST00000403018_chr7_69599518_+_1070nt
ATGGATTTAGAGAAAAATTATCCGACTCCTCGGACCAGCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGA
CGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTC
AGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTC
GCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCA
GAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCA
GTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCC
ATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAAC
GGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTG
TTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGAGTTCAGCTCCTTCCAGCTTGGGAACAGGC
TACTTCAGATCAGGGAAGATGTGCCTTGGAGAGGAAGCATGTCTTAAATCTGGAAATGATATGAAGAGGGATGTCAGCAACACTTCATCC
TGGGCCAGTAATAGGGAGAGTTTCTTTTCTCTCGTCAAATTGCTTAAAGGATTCTAGTTCCGTTTGGTGTGGTCACTCACATTTGAATTC


Top

FusionGenePPI for PAX5_AUTS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PAX5TLE4, DAXX, RUNX1, MYB, ID3, EP300, TBP, RB1, MAPK1AUTS2PCGF3, PCGF5, RNF2, CSNK2A2, RYBP, RING1, YAF2, CSNK2A1, CSNK2B, DCAF7, FBRS, EP300, RERE, RBM14, ZNF608, ZNF609, TLE3, WDR5, PCGF6, ATN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PAX5_AUTS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PAX5_AUTS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePAX5C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human;UNIPROT
HgenePAX5C0023485Precursor B-Cell Lymphoblastic Leukemia-Lymphoma1CTD_human
TgeneAUTS2C0036341Schizophrenia2PSYGENET
TgeneAUTS2C0014544Epilepsy1CTD_human