FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26034

FusionGeneSummary for PARP4_COL9A1

check button Fusion gene summary
Fusion gene informationFusion gene name: PARP4_COL9A1
Fusion gene ID: 26034
HgeneTgene
Gene symbol

PARP4

COL9A1

Gene ID

143

1297

Gene namepoly(ADP-ribose) polymerase family member 4collagen type IX alpha 1 chain
SynonymsADPRTL1|ARTD4|PARP-4|PARPL|PH5P|VAULT3|VPARP|VWA5C|p193DJ149L1.1.2|EDM6|MED|STL4
Cytomap

13q12.12

6q13

Type of geneprotein-codingprotein-coding
Descriptionpoly [ADP-ribose] polymerase 4193 kDa vault proteinADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 1ADP-ribosyltransferase diphtheria toxin-like 4H5 proline-richI-alpha-I-relatedPARP-relatedPARP-related/IalphaI-related H5/proline-rcollagen alpha-1(IX) chainalpha-1(IX) collagen chaincartilage-specific short collagencollagen IX, alpha-1 polypeptidecollagen, type IX, alpha 1
Modification date2018051920180523
UniProtAcc

Q9UKK3

P20849

Ensembl transtripts involved in fusion geneENST00000381989, ENST00000480576, 
ENST00000357250, ENST00000320755, 
ENST00000370499, ENST00000489611, 
ENST00000370496, 
Fusion gene scores* DoF score3 X 3 X 2=184 X 4 X 4=64
# samples 24
** MAII scorelog2(2/18*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PARP4 [Title/Abstract] AND COL9A1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePARP4

GO:0006464

cellular protein modification process

10477748

HgenePARP4

GO:0051972

regulation of telomerase activity

15169895


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-UF-A7JJ-01APARP4chr13

25073439

-COL9A1chr6

70993523

-
TCGALDHNSCTCGA-UF-A7JJ-01APARP4chr13

25086844

-COL9A1chr6

70993523

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000381989ENST00000357250PARP4chr13

25073439

-COL9A1chr6

70993523

-
5CDS-intronENST00000381989ENST00000320755PARP4chr13

25073439

-COL9A1chr6

70993523

-
5CDS-intronENST00000381989ENST00000370499PARP4chr13

25073439

-COL9A1chr6

70993523

-
5CDS-intronENST00000381989ENST00000489611PARP4chr13

25073439

-COL9A1chr6

70993523

-
5CDS-intronENST00000381989ENST00000370496PARP4chr13

25073439

-COL9A1chr6

70993523

-
intron-3CDSENST00000480576ENST00000357250PARP4chr13

25073439

-COL9A1chr6

70993523

-
intron-intronENST00000480576ENST00000320755PARP4chr13

25073439

-COL9A1chr6

70993523

-
intron-intronENST00000480576ENST00000370499PARP4chr13

25073439

-COL9A1chr6

70993523

-
intron-intronENST00000480576ENST00000489611PARP4chr13

25073439

-COL9A1chr6

70993523

-
intron-intronENST00000480576ENST00000370496PARP4chr13

25073439

-COL9A1chr6

70993523

-
5UTR-3CDSENST00000381989ENST00000357250PARP4chr13

25086844

-COL9A1chr6

70993523

-
5UTR-intronENST00000381989ENST00000320755PARP4chr13

25086844

-COL9A1chr6

70993523

-
5UTR-intronENST00000381989ENST00000370499PARP4chr13

25086844

-COL9A1chr6

70993523

-
5UTR-intronENST00000381989ENST00000489611PARP4chr13

25086844

-COL9A1chr6

70993523

-
5UTR-intronENST00000381989ENST00000370496PARP4chr13

25086844

-COL9A1chr6

70993523

-
intron-3CDSENST00000480576ENST00000357250PARP4chr13

25086844

-COL9A1chr6

70993523

-
intron-intronENST00000480576ENST00000320755PARP4chr13

25086844

-COL9A1chr6

70993523

-
intron-intronENST00000480576ENST00000370499PARP4chr13

25086844

-COL9A1chr6

70993523

-
intron-intronENST00000480576ENST00000489611PARP4chr13

25086844

-COL9A1chr6

70993523

-
intron-intronENST00000480576ENST00000370496PARP4chr13

25086844

-COL9A1chr6

70993523

-

Top

FusionProtFeatures for PARP4_COL9A1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PARP4

Q9UKK3

COL9A1

P20849


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePARP4chr13:25073439chr6:70993523ENST00000381989-5341_941591725DomainBRCT
HgenePARP4chr13:25073439chr6:70993523ENST00000381989-53419_251591725MotifNuclear localization signal
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032269_324-53679DomainNote=Collagen-like 1
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032325_356-53679DomainNote=Collagen-like 2
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032358_403-53679DomainNote=Collagen-like 3
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032416_472-53679DomainNote=Collagen-like 4
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032473_516-53679DomainNote=Collagen-like 5
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-03250_244-53679DomainNote=Laminin G-like
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032587_643-53679DomainNote=Collagen-like 6
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032655_712-53679DomainNote=Collagen-like 7
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032713_755-53679DomainNote=Collagen-like 8
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032790_847-53679DomainNote=Collagen-like 9
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032848_899-53679DomainNote=Collagen-like 10
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438269_324232922DomainNote=Collagen-like 1
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438325_356232922DomainNote=Collagen-like 2
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438358_403232922DomainNote=Collagen-like 3
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438416_472232922DomainNote=Collagen-like 4
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438473_516232922DomainNote=Collagen-like 5
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438587_643232922DomainNote=Collagen-like 6
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438655_712232922DomainNote=Collagen-like 7
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438713_755232922DomainNote=Collagen-like 8
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438790_847232922DomainNote=Collagen-like 9
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438848_899232922DomainNote=Collagen-like 10
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411269_324232329DomainNote=Collagen-like 1
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411325_356232329DomainNote=Collagen-like 2
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411358_403232329DomainNote=Collagen-like 3
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411416_472232329DomainNote=Collagen-like 4
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411473_516232329DomainNote=Collagen-like 5
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411587_643232329DomainNote=Collagen-like 6
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411655_712232329DomainNote=Collagen-like 7
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411713_755232329DomainNote=Collagen-like 8
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411790_847232329DomainNote=Collagen-like 9
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411848_899232329DomainNote=Collagen-like 10
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-03224_268-53679RegionNote=Nonhelical region (NC4)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032269_405-53679RegionNote=Triple-helical region (COL3)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032406_417-53679RegionNote=Nonhelical region (NC3)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032418_756-53679RegionNote=Triple-helical region (COL2)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032757_786-53679RegionNote=Nonhelical region (NC2)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032787_901-53679RegionNote=Triple-helical region (COL1)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000320755-032902_921-53679RegionNote=Nonhelical region (NC1)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438269_405232922RegionNote=Triple-helical region (COL3)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438406_417232922RegionNote=Nonhelical region (NC3)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438418_756232922RegionNote=Triple-helical region (COL2)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438757_786232922RegionNote=Nonhelical region (NC2)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438787_901232922RegionNote=Triple-helical region (COL1)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-438902_921232922RegionNote=Nonhelical region (NC1)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411269_405232329RegionNote=Triple-helical region (COL3)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411406_417232329RegionNote=Nonhelical region (NC3)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411418_756232329RegionNote=Triple-helical region (COL2)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411757_786232329RegionNote=Nonhelical region (NC2)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411787_901232329RegionNote=Triple-helical region (COL1)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-411902_921232329RegionNote=Nonhelical region (NC1)

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePARP4chr13:25073439chr6:70993523ENST00000381989-534242_3701591725DomainPARP alpha-helical
HgenePARP4chr13:25073439chr6:70993523ENST00000381989-534369_5731591725DomainPARP catalytic
HgenePARP4chr13:25073439chr6:70993523ENST00000381989-534607_7351591725DomainVIT
HgenePARP4chr13:25073439chr6:70993523ENST00000381989-534876_10461591725DomainVWFA
HgenePARP4chr13:25073439chr6:70993523ENST00000381989-5341237_12491591725MotifNuclear localization signal
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-43850_244232922DomainNote=Laminin G-like
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-41150_244232329DomainNote=Laminin G-like
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000357250-43824_268232922RegionNote=Nonhelical region (NC4)
TgeneCOL9A1chr13:25073439chr6:70993523ENST00000370496-41124_268232329RegionNote=Nonhelical region (NC4)


Top

FusionGeneSequence for PARP4_COL9A1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PARP4_ENST00000381989_chr13_25073439_-_COL9A1_ENST00000357250_chr6_70993523_-_849aa
MVMGIFANCIFCLKVKYLPQQQKKKLQTDIKENGGKFSFSLNPQCTHIILDNADVLSQYQLNSIQKNHVHIANPDFIWKSIREKRLLDVK
NTDPTKPLDITPPPDQKASSSEVKTEGLCPDSATEEEDTVELTEFGMQNVEIPHLPQDFEVAKTNTLEKFELQWMLIHCDPLRPRRETCH
ELPARITPSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQK
GEPGVPGSRGFPGRGIPGPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRSGTPGLPGMRGHKG
AKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDKGEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEG
ARGIPGLPGPKGDTGLPGVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQMGNSGKPGQQGPPG
EVGPRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPGLPGMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPGPKG
SAGNPGEPGLRGPEGSRGLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVIQEHFAEMAASLKRPDSGATGLPG
RPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEKGERGPPGRGPNGLPGAIGLPGDPGPASTGRNGRDGERGPPGVA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PARP4_ENST00000381989_chr13_25073439_-_COL9A1_ENST00000357250_chr6_70993523_-_2547nt
ATGGTGATGGGAATCTTTGCAAATTGTATCTTCTGTTTGAAAGTGAAGTACTTACCTCAGCAGCAGAAGAAAAAGCTACAAACTGACATT
AAGGAAAATGGCGGAAAGTTTTCCTTTTCGTTAAATCCTCAGTGCACACATATAATCTTAGATAATGCTGATGTTCTGAGTCAGTACCAA
CTGAATTCTATCCAAAAGAACCACGTTCATATTGCAAACCCAGATTTTATATGGAAATCTATCAGGGAAAAGAGACTCTTGGATGTAAAG
AATTATGATCCTTATAAGCCCCTGGACATCACACCACCTCCTGATCAGAAGGCGAGCAGTTCTGAAGTGAAAACAGAAGGTCTATGCCCG
GACAGTGCCACAGAGGAGGAAGACACTGTGGAACTCACTGAGTTTGGTATGCAGAATGTTGAAATTCCTCATCTTCCTCAAGATTTTGAA
GTTGCAAAATATAACACCTTGGAGAAATTTGAACTTCAATGGATGCTGATCCATTGTGACCCCCTGCGGCCCAGGAGAGAAACTTGCCAT
GAGCTGCCAGCCAGAATAACGCCCAGCCAGACCACCGACGAGAGAGGTCCCCCGGGTGAGCAGGGTCCTCCCGGGCCTCCGGGCCCCCCT
GGAGTTCCAGGCATCGATGGCATCGACGGTGACCGAGGTCCTAAGGGCCCCCCGGGCCCCCCGGGTCCTGCAGGTGAACCGGGAAAGCCA
GGAGCTCCAGGCAAGCCTGGCACACCTGGCGCTGATGGATTAACAGGACCTGATGGATCCCCTGGCTCCATTGGGTCAAAGGGACAAAAA
GGAGAACCTGGTGTGCCTGGATCGCGTGGATTTCCAGGCCGTGGTATTCCTGGACCCCCTGGTCCTCCTGGGACAGCAGGACTCCCTGGA
GAGCTTGGCCGTGTAGGACCTGTTGGTGACCCTGGGAGAAGAGGACCACCTGGCCCCCCTGGCCCCCCAGGACCCAGAGGAACAATTGGC
TTTCATGATGGAGATCCATTGTGTCCCAATGCCTGTCCACCAGGTCGCTCAGGATATCCAGGCCTACCAGGCATGAGGGGTCATAAAGGG
GCTAAAGGAGAAATTGGTGAACCAGGAAGACAAGGACACAAGGGTGAAGAAGGTGACCAGGGAGAACTCGGAGAAGTTGGAGCTCAAGGA
CCTCCAGGAGCCCAGGGTTTGCGAGGCATCACCGGCATAGTTGGGGACAAAGGGGAAAAAGGTGCTCGGGGCTTAGATGGTGAACCTGGG
CCTCAGGGTCTTCCTGGTGCACCTGGTGATCAAGGACAGCGAGGACCTCCAGGAGAAGCAGGTCCCAAAGGAGATAGAGGGGCTGAAGGT
GCTAGAGGAATTCCTGGTCTCCCTGGGCCCAAAGGAGACACGGGTTTGCCAGGTGTGGATGGCCGTGATGGGATCCCTGGAATGCCTGGA
ACAAAGGGTGAACCAGGAAAACCTGGGCCTCCTGGTGATGCAGGATTGCAGGGGTTACCAGGTGTACCTGGAATTCCTGGTGCAAAGGGT
GTTGCTGGTGAAAAGGGTAGCACAGGTGCTCCAGGGAAGCCTGGTCAGATGGGAAATTCAGGCAAACCGGGCCAACAGGGGCCTCCAGGA
GAGGTGGGACCCCGAGGACCCCAGGGGCTTCCTGGCAGTAGAGGAGAATTAGGACCAGTGGGATCCCCAGGCCTACCAGGTAAACTGGGT
TCTCTGGGTAGCCCTGGCCTCCCTGGCTTGCCTGGGCCCCCTGGACTTCCTGGAATGAAAGGTGACAGGGGTGTAGTCGGTGAACCGGGT
CCAAAGGGTGAACAGGGTGCCTCTGGTGAAGAAGGTGAAGCAGGAGAAAGGGGGGAACTTGGAGATATAGGATTACCTGGCCCAAAGGGA
TCTGCAGGTAATCCTGGGGAACCTGGCTTGAGAGGGCCTGAGGGAAGTCGGGGGCTTCCTGGAGTGGAAGGACCAAGAGGACCACCTGGA
CCCCGGGGTGTGCAGGGAGAACAGGGTGCCACCGGCCTGCCTGGTGTCCAGGGCCCTCCGGGTAGAGCACCGACAGATCAGCACATTAAG
CAGGTTTGCATGAGAGTCATACAAGAACATTTTGCTGAGATGGCTGCCAGTCTTAAGCGTCCAGACTCAGGTGCCACTGGGCTTCCTGGA
AGGCCTGGCCCTCCTGGTCCCCCCGGCCCTCCTGGAGAGAATGGTTTCCCAGGCCAGATGGGAATTCGTGGCCTTCCGGGCATTAAGGGG
CCCCCTGGTGCTCTTGGTTTGAGGGGACCTAAAGGTGACTTGGGAGAAAAGGGGGAGCGTGGCCCTCCAGGAAGAGGTCCCAACGGTTTG
CCTGGAGCTATAGGTCTCCCAGGTGACCCAGGCCCTGCCAGCTATGGCAGAAATGGCCGAGACGGTGAGCGAGGCCCCCCAGGGGTGGCA
GGAATTCCTGGAGTGCCTGGACCCCCGGGACCTCCTGGGCTTCCCGGTTTCTGTGAGCCAGCCTCCTGCACCATGCAGGCTGGTCAGCGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PARP4_ENST00000381989_chr13_25073439_-_COL9A1_ENST00000357250_chr6_70993523_-_4489nt
CGCCCGCCCAGCCCCGGGGGCAGGGAGAGCCTAGATTACGGAAGTACCGCGAGCAAGGAGCGCGGAATCGGGGAGCGTCCGGAGCTAGCT
GGATCCTCTAGGCAGGATGGTGATGGGAATCTTTGCAAATTGTATCTTCTGTTTGAAAGTGAAGTACTTACCTCAGCAGCAGAAGAAAAA
GCTACAAACTGACATTAAGGAAAATGGCGGAAAGTTTTCCTTTTCGTTAAATCCTCAGTGCACACATATAATCTTAGATAATGCTGATGT
TCTGAGTCAGTACCAACTGAATTCTATCCAAAAGAACCACGTTCATATTGCAAACCCAGATTTTATATGGAAATCTATCAGGGAAAAGAG
ACTCTTGGATGTAAAGAATTATGATCCTTATAAGCCCCTGGACATCACACCACCTCCTGATCAGAAGGCGAGCAGTTCTGAAGTGAAAAC
AGAAGGTCTATGCCCGGACAGTGCCACAGAGGAGGAAGACACTGTGGAACTCACTGAGTTTGGTATGCAGAATGTTGAAATTCCTCATCT
TCCTCAAGATTTTGAAGTTGCAAAATATAACACCTTGGAGAAATTTGAACTTCAATGGATGCTGATCCATTGTGACCCCCTGCGGCCCAG
GAGAGAAACTTGCCATGAGCTGCCAGCCAGAATAACGCCCAGCCAGACCACCGACGAGAGAGGTCCCCCGGGTGAGCAGGGTCCTCCCGG
GCCTCCGGGCCCCCCTGGAGTTCCAGGCATCGATGGCATCGACGGTGACCGAGGTCCTAAGGGCCCCCCGGGCCCCCCGGGTCCTGCAGG
TGAACCGGGAAAGCCAGGAGCTCCAGGCAAGCCTGGCACACCTGGCGCTGATGGATTAACAGGACCTGATGGATCCCCTGGCTCCATTGG
GTCAAAGGGACAAAAAGGAGAACCTGGTGTGCCTGGATCGCGTGGATTTCCAGGCCGTGGTATTCCTGGACCCCCTGGTCCTCCTGGGAC
AGCAGGACTCCCTGGAGAGCTTGGCCGTGTAGGACCTGTTGGTGACCCTGGGAGAAGAGGACCACCTGGCCCCCCTGGCCCCCCAGGACC
CAGAGGAACAATTGGCTTTCATGATGGAGATCCATTGTGTCCCAATGCCTGTCCACCAGGTCGCTCAGGATATCCAGGCCTACCAGGCAT
GAGGGGTCATAAAGGGGCTAAAGGAGAAATTGGTGAACCAGGAAGACAAGGACACAAGGGTGAAGAAGGTGACCAGGGAGAACTCGGAGA
AGTTGGAGCTCAAGGACCTCCAGGAGCCCAGGGTTTGCGAGGCATCACCGGCATAGTTGGGGACAAAGGGGAAAAAGGTGCTCGGGGCTT
AGATGGTGAACCTGGGCCTCAGGGTCTTCCTGGTGCACCTGGTGATCAAGGACAGCGAGGACCTCCAGGAGAAGCAGGTCCCAAAGGAGA
TAGAGGGGCTGAAGGTGCTAGAGGAATTCCTGGTCTCCCTGGGCCCAAAGGAGACACGGGTTTGCCAGGTGTGGATGGCCGTGATGGGAT
CCCTGGAATGCCTGGAACAAAGGGTGAACCAGGAAAACCTGGGCCTCCTGGTGATGCAGGATTGCAGGGGTTACCAGGTGTACCTGGAAT
TCCTGGTGCAAAGGGTGTTGCTGGTGAAAAGGGTAGCACAGGTGCTCCAGGGAAGCCTGGTCAGATGGGAAATTCAGGCAAACCGGGCCA
ACAGGGGCCTCCAGGAGAGGTGGGACCCCGAGGACCCCAGGGGCTTCCTGGCAGTAGAGGAGAATTAGGACCAGTGGGATCCCCAGGCCT
ACCAGGTAAACTGGGTTCTCTGGGTAGCCCTGGCCTCCCTGGCTTGCCTGGGCCCCCTGGACTTCCTGGAATGAAAGGTGACAGGGGTGT
AGTCGGTGAACCGGGTCCAAAGGGTGAACAGGGTGCCTCTGGTGAAGAAGGTGAAGCAGGAGAAAGGGGGGAACTTGGAGATATAGGATT
ACCTGGCCCAAAGGGATCTGCAGGTAATCCTGGGGAACCTGGCTTGAGAGGGCCTGAGGGAAGTCGGGGGCTTCCTGGAGTGGAAGGACC
AAGAGGACCACCTGGACCCCGGGGTGTGCAGGGAGAACAGGGTGCCACCGGCCTGCCTGGTGTCCAGGGCCCTCCGGGTAGAGCACCGAC
AGATCAGCACATTAAGCAGGTTTGCATGAGAGTCATACAAGAACATTTTGCTGAGATGGCTGCCAGTCTTAAGCGTCCAGACTCAGGTGC
CACTGGGCTTCCTGGAAGGCCTGGCCCTCCTGGTCCCCCCGGCCCTCCTGGAGAGAATGGTTTCCCAGGCCAGATGGGAATTCGTGGCCT
TCCGGGCATTAAGGGGCCCCCTGGTGCTCTTGGTTTGAGGGGACCTAAAGGTGACTTGGGAGAAAAGGGGGAGCGTGGCCCTCCAGGAAG
AGGTCCCAACGGTTTGCCTGGAGCTATAGGTCTCCCAGGTGACCCAGGCCCTGCCAGCTATGGCAGAAATGGCCGAGACGGTGAGCGAGG
CCCCCCAGGGGTGGCAGGAATTCCTGGAGTGCCTGGACCCCCGGGACCTCCTGGGCTTCCCGGTTTCTGTGAGCCAGCCTCCTGCACCAT
GCAGGCTGGTCAGCGAGCATTTAACAAAGGGCCTGACCCTTGAAAGGCTTACTGCTGCATGGCTGTCTGCATGAACCACGCCTGGTGAAG
GAGCCTGGGTGAGAAACACCATCCAAAGCTGGGGCAAAGATGATTACCTTCAGCATGATTACAATGTATTACCTTCAGTATGATTACAGA
AGTCCTACTTGACAATCACATATAGAAGAACGGTGCTATTCAGTAAGTTCTCTTTCCTTTCCCTTGGAGGGAAGACAGCAGAGTCATCAG
TTAAAAAAAAAAAAAGAAAACCAAACACCTCCCTTGAATAAATTTATACTCCTGTTCCCAGGATCTTGAGCTTTAGTGTGCTATACCTAT
GTGTCTTATCGTGGGCCACTGTGCCAATAAACAAAAACAACTGTTTGGTTTACCTCAGTTGCAGTAGTTATTTTCATTTAGAAGTTGTTC
TCAGATTATTGTTTCAGTTATATAGAGGATTACTAGACTAGTTATGAAGAAACCCCACTACATTCAATGGAATTGGTGCTTAAAATCTCA
TCGATGTGCTGTCTCTGGAGTGATAAGAAAGGGCTACATCTCCCGAAATGATTTCTTTACGTCATGTATTGGTTTCCTTCTTCACCTTGA
ACTTTTGTTGAACTGTATGTACTTTACCCCAAACCTGTTAATATTTTGAGCGCTTCTATGTGAAAGCAAAGAAATAATTTTAATACTCTG
GCATTCATAAATTTTATTGATGAGATTATTTATTTTAAAGGTTTGAGGTAACATCTCTGGTTGTACCAAAGAAGAAATAAATATGGTTTC
TTAATCTCTTGCATGTTTTCTTATAAATAATCATGTTCAATGAAAAGAAGTTACTGAGCTTATTTAGATACATTAAACATTACTTAACTA
CTGGTTCTATAGGTGTATGTTTATAATATTAGTGTTTTTTCTACATAAAGTAATTTAAAAAGCTGTTCCACAGAGGGTGTTACCCTGTGA
CAGATGCGTATGTGTGTGTGTGTGTGTGTGTGTGTGTTTTAGTGTGTATGGAGAGAGCTTCATGGACCTTTTCGAAATGTTAATTCCCTA
GAAAGATGTGCAGCTGCATGCGCATCTATATTTTTGTATAGTATTTCAGAGATTTCGTGGACTTTTTTAAGTCTAGCCTTGCTTTATTTC
TAGGTTAAGAACCACTGCCTTCATTCCAATGGCTTGTTAGCTCCCTCCTACTCAGAACTTTATTGTAAACATGATTTATGTTTCACCATT
TCTTGTAAATTTTATAAATGCAGCTCAGCTAAAGCACTGTATTCTTAACAAGTATTTCCTGACCACTTAAGCACTTTATTATTATCTGTG
TAATCATATTGGCTTGCTGTTTCATTAACATCTACTTAACTATCCAACAGACTTAATATATTCATTTTATATCACAGAGCCTGTGAGTAA
CCTGTGCTGGGGCATAAAACAATAGCTCAACATAGTATCTTTAGTTAGTTTATGGAACTAAATTCTGTCAAGTCAAAGGAGAGTGAGCCC
TAATATAATTTTTTATATATATTTTTCTCGTGTGTACTTTTATACATTTTAAATTCTAGTCCTAGTTGTTTGGTTAAATCAATCATTATG
TAATCTGTATTTGGATTTCTTTAAAACTGCTTACAGCATCTAGTTTTATGCTTCTAGCATGAATTTTGCTTAAGAAGATTCCAACTTTGC
CATATAGATCAGTGCTATTTACATAGACTGAAAGAATGTTCTTTCCCTTTTTTCAAATATGACTTTTGAAAATAAAGGTCTCTGTTATAG


Top

FusionGenePPI for PARP4_COL9A1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PARP4MVP, ARL6IP5, NOS2, TEP1, SMAD3, RFWD2, CLTC, CDC5L, BRCA1COL9A1COL2A1, MAG, CTPS2, COL6A2, COL6A1, COL4A2, PPP1R12C, VHL


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgenePARP4chr13:25073439chr6:70993523ENST00000381989-5341562_17241591725the major vault protein


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PARP4_COL9A1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PARP4_COL9A1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePARP4C0009375Colonic Neoplasms1CTD_human
TgeneCOL9A1C0029422Osteochondrodysplasias2CTD_human
TgeneCOL9A1C0018784Sensorineural Hearing Loss (disorder)1CTD_human;HPO
TgeneCOL9A1C0027092Myopia1CTD_human;HPO
TgeneCOL9A1C0035309Retinal Diseases1CTD_human