FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25756

FusionGeneSummary for PACSIN2_NUPL2

check button Fusion gene summary
Fusion gene informationFusion gene name: PACSIN2_NUPL2
Fusion gene ID: 25756
HgeneTgene
Gene symbol

PACSIN2

NUPL2

Gene ID

11252

11097

Gene nameprotein kinase C and casein kinase substrate in neurons 2nucleoporin like 2
SynonymsSDPIICG1|NLP-1|NLP_1|hCG1
Cytomap

22q13.2

7p15.3

Type of geneprotein-codingprotein-coding
Descriptionprotein kinase C and casein kinase substrate in neurons protein 2cytoplasmic phosphoprotein PACSIN2syndapin-2syndapin-IIsyndapin2nucleoporin-like protein 2H_RG271G13.9NUP42 homolognucleoporin hCG1nucleoporin-like protein 1
Modification date2018052320180523
UniProtAcc

Q9UNF0

O15504

Ensembl transtripts involved in fusion geneENST00000337959, ENST00000263246, 
ENST00000407585, ENST00000403744, 
ENST00000402229, 
ENST00000258742, 
ENST00000410002, ENST00000487595, 
Fusion gene scores* DoF score16 X 9 X 8=11523 X 2 X 2=12
# samples 173
** MAII scorelog2(17/1152*10)=-2.76053406530461
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PACSIN2 [Title/Abstract] AND NUPL2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePACSIN2

GO:0097320

plasma membrane tubulation

23596323


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AN-A0FJ-01APACSIN2chr22

43308027

-NUPL2chr7

23224689

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000337959ENST00000258742PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
In-frameENST00000337959ENST00000410002PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
5CDS-3UTRENST00000337959ENST00000487595PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
In-frameENST00000263246ENST00000258742PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
In-frameENST00000263246ENST00000410002PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
5CDS-3UTRENST00000263246ENST00000487595PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
Frame-shitENST00000407585ENST00000258742PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
Frame-shitENST00000407585ENST00000410002PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
5CDS-3UTRENST00000407585ENST00000487595PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
In-frameENST00000403744ENST00000258742PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
In-frameENST00000403744ENST00000410002PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
5CDS-3UTRENST00000403744ENST00000487595PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
Frame-shitENST00000402229ENST00000258742PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
Frame-shitENST00000402229ENST00000410002PACSIN2chr22

43308027

-NUPL2chr7

23224689

+
5CDS-3UTRENST00000402229ENST00000487595PACSIN2chr22

43308027

-NUPL2chr7

23224689

+

Top

FusionProtFeatures for PACSIN2_NUPL2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PACSIN2

Q9UNF0

NUPL2

O15504

Lipid-binding protein that is able to promote thetubulation of the phosphatidic acid-containing membranes itpreferentially binds. Plays a role in intracellular vesicle-mediated transport. Involved in the endocytosis of cell-surfacereceptors like the EGF receptor, contributing to itsinternalization in the absence of EGF stimulus. May also play arole in the formation of caveolae at the cell membrane. RecruitsDNM2 to caveolae, and thereby plays a role in caveola-mediatedendocytosis. {ECO:0000269|PubMed:21610094,ECO:0000269|PubMed:21693584, ECO:0000269|PubMed:23129763,ECO:0000269|PubMed:23236520, ECO:0000269|PubMed:23596323}. Required for the export of mRNAs containing poly(A)tails from the nucleus into the cytoplasm. In case of infection byHIV-1, it may participate in the docking of viral Vpr at thenuclear envelope. {ECO:0000269|PubMed:10610322,ECO:0000269|PubMed:16000379}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07238_37840424Compositional biasNote=Ser-rich
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07218_21940424RepeatNote=FG 3
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07220_22140424RepeatNote=FG 4
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07265_26640424RepeatNote=FG 5
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07271_27240424RepeatNote=FG 6
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07288_28940424RepeatNote=FG 7
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07290_29140424RepeatNote=FG 8
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07311_31240424RepeatNote=FG 9
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07336_33740424RepeatNote=FG 10
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07345_34640424RepeatNote=FG 11
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07364_36540424RepeatNote=FG 12
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+0795_9640424RepeatNote=FG 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePACSIN2chr22:43308027chr7:23224689ENST00000263246-21125_27420487Coiled coil.
HgenePACSIN2chr22:43308027chr7:23224689ENST00000337959-21025_27420446Coiled coil.
HgenePACSIN2chr22:43308027chr7:23224689ENST00000402229-21125_27420487Coiled coil.
HgenePACSIN2chr22:43308027chr7:23224689ENST00000403744-21125_27420487Coiled coil.
HgenePACSIN2chr22:43308027chr7:23224689ENST00000407585-21025_27420446Coiled coil.
HgenePACSIN2chr22:43308027chr7:23224689ENST00000263246-21111_28220487DomainF-BAR
HgenePACSIN2chr22:43308027chr7:23224689ENST00000263246-211426_48620487DomainSH3
HgenePACSIN2chr22:43308027chr7:23224689ENST00000337959-21011_28220446DomainF-BAR
HgenePACSIN2chr22:43308027chr7:23224689ENST00000337959-210426_48620446DomainSH3
HgenePACSIN2chr22:43308027chr7:23224689ENST00000402229-21111_28220487DomainF-BAR
HgenePACSIN2chr22:43308027chr7:23224689ENST00000402229-211426_48620487DomainSH3
HgenePACSIN2chr22:43308027chr7:23224689ENST00000403744-21111_28220487DomainF-BAR
HgenePACSIN2chr22:43308027chr7:23224689ENST00000403744-211426_48620487DomainSH3
HgenePACSIN2chr22:43308027chr7:23224689ENST00000407585-21011_28220446DomainF-BAR
HgenePACSIN2chr22:43308027chr7:23224689ENST00000407585-210426_48620446DomainSH3
HgenePACSIN2chr22:43308027chr7:23224689ENST00000263246-211362_36420487MotifNote=NPF1
HgenePACSIN2chr22:43308027chr7:23224689ENST00000263246-211405_40720487MotifNote=NPF2
HgenePACSIN2chr22:43308027chr7:23224689ENST00000263246-211417_41920487MotifNote=NPF3
HgenePACSIN2chr22:43308027chr7:23224689ENST00000337959-210362_36420446MotifNote=NPF1
HgenePACSIN2chr22:43308027chr7:23224689ENST00000337959-210405_40720446MotifNote=NPF2
HgenePACSIN2chr22:43308027chr7:23224689ENST00000337959-210417_41920446MotifNote=NPF3
HgenePACSIN2chr22:43308027chr7:23224689ENST00000402229-211362_36420487MotifNote=NPF1
HgenePACSIN2chr22:43308027chr7:23224689ENST00000402229-211405_40720487MotifNote=NPF2
HgenePACSIN2chr22:43308027chr7:23224689ENST00000402229-211417_41920487MotifNote=NPF3
HgenePACSIN2chr22:43308027chr7:23224689ENST00000403744-211362_36420487MotifNote=NPF1
HgenePACSIN2chr22:43308027chr7:23224689ENST00000403744-211405_40720487MotifNote=NPF2
HgenePACSIN2chr22:43308027chr7:23224689ENST00000403744-211417_41920487MotifNote=NPF3
HgenePACSIN2chr22:43308027chr7:23224689ENST00000407585-210362_36420446MotifNote=NPF1
HgenePACSIN2chr22:43308027chr7:23224689ENST00000407585-210405_40720446MotifNote=NPF2
HgenePACSIN2chr22:43308027chr7:23224689ENST00000407585-210417_41920446MotifNote=NPF3
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+0714_1540424RepeatNote=FG 1
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+071_2540424Zinc fingerC3H1-type


Top

FusionGeneSequence for PACSIN2_NUPL2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PACSIN2_ENST00000337959_chr22_43308027_-_NUPL2_ENST00000258742_chr7_23224689_+_403aa
MSVTTDDSVGVEVSSDSFWEVIIDVDGIQLARDIPMSSSHPVSPNPHHGGAAEIKKSHISVLLILELQLTGRKALDCLRTHLLHLVLMSR
KMKRNFWKEL_KIWRFGNHQGSGCFLFIHQ_KRNLIFQVLQTFHQRN_GLNTITS_PAITYRVI_ILSNV__INGGTG_MN_KV_ITQLK
_LCSLM_RME_IKQHLHLDLAAVKQQHLCRQAFQSITAAVIMLRTLVLKQTLDLLLPLLEALLVLGVPQHLELQPLPVQVSLLLLQLLDL
GSLKSHRLHHFHSKALQLPVLDHLDFQDFQLPWQQVLSELQWPQPLEVAVLWLVLVVRAHILTLLFLSHPVTLLEIAATPLLCQPQAASL

>In-frame_PACSIN2_ENST00000337959_chr22_43308027_-_NUPL2_ENST00000410002_chr7_23224689_+_135aa
MSVTTDDSVGVEVSSDSFWEVIIDVDGIQLARDIPMSSSHPVSPNPHHGGAAEIKKSHISVLLILELQLTGRKALDCLRTHLLHLVLMSR

>In-frame_PACSIN2_ENST00000263246_chr22_43308027_-_NUPL2_ENST00000258742_chr7_23224689_+_403aa
MSVTTDDSVGVEVSSDSFWEVIIDVDGIQLARDIPMSSSHPVSPNPHHGGAAEIKKSHISVLLILELQLTGRKALDCLRTHLLHLVLMSR
KMKRNFWKEL_KIWRFGNHQGSGCFLFIHQ_KRNLIFQVLQTFHQRN_GLNTITS_PAITYRVI_ILSNV__INGGTG_MN_KV_ITQLK
_LCSLM_RME_IKQHLHLDLAAVKQQHLCRQAFQSITAAVIMLRTLVLKQTLDLLLPLLEALLVLGVPQHLELQPLPVQVSLLLLQLLDL
GSLKSHRLHHFHSKALQLPVLDHLDFQDFQLPWQQVLSELQWPQPLEVAVLWLVLVVRAHILTLLFLSHPVTLLEIAATPLLCQPQAASL

>In-frame_PACSIN2_ENST00000263246_chr22_43308027_-_NUPL2_ENST00000410002_chr7_23224689_+_135aa
MSVTTDDSVGVEVSSDSFWEVIIDVDGIQLARDIPMSSSHPVSPNPHHGGAAEIKKSHISVLLILELQLTGRKALDCLRTHLLHLVLMSR

>In-frame_PACSIN2_ENST00000403744_chr22_43308027_-_NUPL2_ENST00000258742_chr7_23224689_+_403aa
MSVTTDDSVGVEVSSDSFWEVIIDVDGIQLARDIPMSSSHPVSPNPHHGGAAEIKKSHISVLLILELQLTGRKALDCLRTHLLHLVLMSR
KMKRNFWKEL_KIWRFGNHQGSGCFLFIHQ_KRNLIFQVLQTFHQRN_GLNTITS_PAITYRVI_ILSNV__INGGTG_MN_KV_ITQLK
_LCSLM_RME_IKQHLHLDLAAVKQQHLCRQAFQSITAAVIMLRTLVLKQTLDLLLPLLEALLVLGVPQHLELQPLPVQVSLLLLQLLDL
GSLKSHRLHHFHSKALQLPVLDHLDFQDFQLPWQQVLSELQWPQPLEVAVLWLVLVVRAHILTLLFLSHPVTLLEIAATPLLCQPQAASL

>In-frame_PACSIN2_ENST00000403744_chr22_43308027_-_NUPL2_ENST00000410002_chr7_23224689_+_135aa
MSVTTDDSVGVEVSSDSFWEVIIDVDGIQLARDIPMSSSHPVSPNPHHGGAAEIKKSHISVLLILELQLTGRKALDCLRTHLLHLVLMSR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PACSIN2_ENST00000337959_chr22_43308027_-_NUPL2_ENST00000258742_chr7_23224689_+_1211nt
ATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAATAGACGTGGATGGAATACAACTA
GCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGAGATCAAGAAAAGCCATATTTCA
GTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCTTCACTTAGTCCTGATGAGCAGA
AAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGGATGTTTTCTGTTTATTCACCAG
TGAAAAAGAAACCTAATATTTCAGGTTTTACAGACATTTCACCAGAGGAATTGAGGCTTGAATACCATAACTTCTTAACCAGCAATAACT
TACAGAGTTATCTAAATTCTGTCCAACGTTTAATAAATCAATGGAGGAACAGGGTAAATGAACTGAAAAGTCTAAATATATCAACTAAAG
TAGCTTTGCTCTCTGATGTAAAGGATGGAGTAAATCAAGCAGCACCTGCATTTGGATTTGGCAGCAGTCAAGCAGCAACATTTATGTCGC
CAGGCTTTCCAGTCAATAACAGCAGCAGTGATAATGCTCAGAACTTTAGTTTTAAAACAAACTCTGGATTTGCTGCTGCCTCTTCTGGAA
GCCCTGCTGGTTTTGGGAGTTCCCCAGCATTTGGAGCTGCAGCCTCTACCAGTTCAGGTATCTCTACTTCTGCTCCAGCTTTTGGATTTG
GGAAGCCTGAAGTCACATCGGCTGCATCATTTTCATTCAAAAGCCCTGCAGCTTCCAGTTTTGGATCACCTGGATTTTCAGGACTTCCAG
CTTCCTTGGCAACAGGTCCTGTCAGAGCTCCAGTGGCCCCAGCCTTTGGAGGTGGCAGTTCTGTGGCTGGTTTTGGTAGTCCGGGCTCAC
ATTCTCACACTGCTTTTTCTAAGCCATCCAGTGACACTTTTGGAAATAGCAGCATATCCACTTCTCTGTCAGCCTCAAGCAGCATCATTG
CAACAGATAATGTGTTATTCACACCCAGAGATAAACTAACAGTAGAAGAACTGGAACAATTTCAATCCAAGAAATTTACTCTGGGAAAAA

>In-frame_PACSIN2_ENST00000337959_chr22_43308027_-_NUPL2_ENST00000410002_chr7_23224689_+_407nt
ATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAATAGACGTGGATGGAATACAACTA
GCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGAGATCAAGAAAAGCCATATTTCA
GTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCTTCACTTAGTCCTGATGAGCAGA
AAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGGATGTTTTCTGTTTATTCACCAG

>In-frame_PACSIN2_ENST00000263246_chr22_43308027_-_NUPL2_ENST00000258742_chr7_23224689_+_1211nt
ATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAATAGACGTGGATGGAATACAACTA
GCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGAGATCAAGAAAAGCCATATTTCA
GTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCTTCACTTAGTCCTGATGAGCAGA
AAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGGATGTTTTCTGTTTATTCACCAG
TGAAAAAGAAACCTAATATTTCAGGTTTTACAGACATTTCACCAGAGGAATTGAGGCTTGAATACCATAACTTCTTAACCAGCAATAACT
TACAGAGTTATCTAAATTCTGTCCAACGTTTAATAAATCAATGGAGGAACAGGGTAAATGAACTGAAAAGTCTAAATATATCAACTAAAG
TAGCTTTGCTCTCTGATGTAAAGGATGGAGTAAATCAAGCAGCACCTGCATTTGGATTTGGCAGCAGTCAAGCAGCAACATTTATGTCGC
CAGGCTTTCCAGTCAATAACAGCAGCAGTGATAATGCTCAGAACTTTAGTTTTAAAACAAACTCTGGATTTGCTGCTGCCTCTTCTGGAA
GCCCTGCTGGTTTTGGGAGTTCCCCAGCATTTGGAGCTGCAGCCTCTACCAGTTCAGGTATCTCTACTTCTGCTCCAGCTTTTGGATTTG
GGAAGCCTGAAGTCACATCGGCTGCATCATTTTCATTCAAAAGCCCTGCAGCTTCCAGTTTTGGATCACCTGGATTTTCAGGACTTCCAG
CTTCCTTGGCAACAGGTCCTGTCAGAGCTCCAGTGGCCCCAGCCTTTGGAGGTGGCAGTTCTGTGGCTGGTTTTGGTAGTCCGGGCTCAC
ATTCTCACACTGCTTTTTCTAAGCCATCCAGTGACACTTTTGGAAATAGCAGCATATCCACTTCTCTGTCAGCCTCAAGCAGCATCATTG
CAACAGATAATGTGTTATTCACACCCAGAGATAAACTAACAGTAGAAGAACTGGAACAATTTCAATCCAAGAAATTTACTCTGGGAAAAA

>In-frame_PACSIN2_ENST00000263246_chr22_43308027_-_NUPL2_ENST00000410002_chr7_23224689_+_407nt
ATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAATAGACGTGGATGGAATACAACTA
GCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGAGATCAAGAAAAGCCATATTTCA
GTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCTTCACTTAGTCCTGATGAGCAGA
AAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGGATGTTTTCTGTTTATTCACCAG

>In-frame_PACSIN2_ENST00000403744_chr22_43308027_-_NUPL2_ENST00000258742_chr7_23224689_+_1211nt
ATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAATAGACGTGGATGGAATACAACTA
GCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGAGATCAAGAAAAGCCATATTTCA
GTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCTTCACTTAGTCCTGATGAGCAGA
AAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGGATGTTTTCTGTTTATTCACCAG
TGAAAAAGAAACCTAATATTTCAGGTTTTACAGACATTTCACCAGAGGAATTGAGGCTTGAATACCATAACTTCTTAACCAGCAATAACT
TACAGAGTTATCTAAATTCTGTCCAACGTTTAATAAATCAATGGAGGAACAGGGTAAATGAACTGAAAAGTCTAAATATATCAACTAAAG
TAGCTTTGCTCTCTGATGTAAAGGATGGAGTAAATCAAGCAGCACCTGCATTTGGATTTGGCAGCAGTCAAGCAGCAACATTTATGTCGC
CAGGCTTTCCAGTCAATAACAGCAGCAGTGATAATGCTCAGAACTTTAGTTTTAAAACAAACTCTGGATTTGCTGCTGCCTCTTCTGGAA
GCCCTGCTGGTTTTGGGAGTTCCCCAGCATTTGGAGCTGCAGCCTCTACCAGTTCAGGTATCTCTACTTCTGCTCCAGCTTTTGGATTTG
GGAAGCCTGAAGTCACATCGGCTGCATCATTTTCATTCAAAAGCCCTGCAGCTTCCAGTTTTGGATCACCTGGATTTTCAGGACTTCCAG
CTTCCTTGGCAACAGGTCCTGTCAGAGCTCCAGTGGCCCCAGCCTTTGGAGGTGGCAGTTCTGTGGCTGGTTTTGGTAGTCCGGGCTCAC
ATTCTCACACTGCTTTTTCTAAGCCATCCAGTGACACTTTTGGAAATAGCAGCATATCCACTTCTCTGTCAGCCTCAAGCAGCATCATTG
CAACAGATAATGTGTTATTCACACCCAGAGATAAACTAACAGTAGAAGAACTGGAACAATTTCAATCCAAGAAATTTACTCTGGGAAAAA

>In-frame_PACSIN2_ENST00000403744_chr22_43308027_-_NUPL2_ENST00000410002_chr7_23224689_+_407nt
ATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAATAGACGTGGATGGAATACAACTA
GCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGAGATCAAGAAAAGCCATATTTCA
GTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCTTCACTTAGTCCTGATGAGCAGA
AAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGGATGTTTTCTGTTTATTCACCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PACSIN2_ENST00000337959_chr22_43308027_-_NUPL2_ENST00000258742_chr7_23224689_+_1677nt
GCGGCCGCAGGGGTCTGGGCAGGGCTGGGCAGTGCTGCCGGAGCAAAAGCGGTAGCGGGAGCCCGGCCGGAGCTGGGTCTGGAGACGCCG
TGGCAGCCTGAACGGAGTGTGCGACGGATTGGGAGGTTTGTCTACAGATTTTGAGCGTTCGAAGTTGACCCCTGACTAAGTATACTTTGC
TGCTCCCTCAGCCTTTGAAAAAATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAAT
AGACGTGGATGGAATACAACTAGCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGA
GATCAAGAAAAGCCATATTTCAGTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCT
TCACTTAGTCCTGATGAGCAGAAAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGG
ATGTTTTCTGTTTATTCACCAGTGAAAAAGAAACCTAATATTTCAGGTTTTACAGACATTTCACCAGAGGAATTGAGGCTTGAATACCAT
AACTTCTTAACCAGCAATAACTTACAGAGTTATCTAAATTCTGTCCAACGTTTAATAAATCAATGGAGGAACAGGGTAAATGAACTGAAA
AGTCTAAATATATCAACTAAAGTAGCTTTGCTCTCTGATGTAAAGGATGGAGTAAATCAAGCAGCACCTGCATTTGGATTTGGCAGCAGT
CAAGCAGCAACATTTATGTCGCCAGGCTTTCCAGTCAATAACAGCAGCAGTGATAATGCTCAGAACTTTAGTTTTAAAACAAACTCTGGA
TTTGCTGCTGCCTCTTCTGGAAGCCCTGCTGGTTTTGGGAGTTCCCCAGCATTTGGAGCTGCAGCCTCTACCAGTTCAGGTATCTCTACT
TCTGCTCCAGCTTTTGGATTTGGGAAGCCTGAAGTCACATCGGCTGCATCATTTTCATTCAAAAGCCCTGCAGCTTCCAGTTTTGGATCA
CCTGGATTTTCAGGACTTCCAGCTTCCTTGGCAACAGGTCCTGTCAGAGCTCCAGTGGCCCCAGCCTTTGGAGGTGGCAGTTCTGTGGCT
GGTTTTGGTAGTCCGGGCTCACATTCTCACACTGCTTTTTCTAAGCCATCCAGTGACACTTTTGGAAATAGCAGCATATCCACTTCTCTG
TCAGCCTCAAGCAGCATCATTGCAACAGATAATGTGTTATTCACACCCAGAGATAAACTAACAGTAGAAGAACTGGAACAATTTCAATCC
AAGAAATTTACTCTGGGAAAAATTCCATTAAAGCCTCCACCTCTGGAACTTCTAAATGTTTAAAAGGGCAATTTTAAATACAAAAAAGAA
TGATGTTTAAAATTGCTTTGAGTGATTCATACAGAGATGTATATATGCATACATGTATATATTCATAAGGAATATAAGCTTCCATCAATA
GTGATTTTAAATTTGATTTTTTTCTTAACTCTAAATATTTAAGTAAAAAGTAACAAAAACTCTGCAAGCAAGGGAATTTTTTTGTACTGT

>In-frame_PACSIN2_ENST00000337959_chr22_43308027_-_NUPL2_ENST00000410002_chr7_23224689_+_773nt
GCGGCCGCAGGGGTCTGGGCAGGGCTGGGCAGTGCTGCCGGAGCAAAAGCGGTAGCGGGAGCCCGGCCGGAGCTGGGTCTGGAGACGCCG
TGGCAGCCTGAACGGAGTGTGCGACGGATTGGGAGGTTTGTCTACAGATTTTGAGCGTTCGAAGTTGACCCCTGACTAAGTATACTTTGC
TGCTCCCTCAGCCTTTGAAAAAATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAAT
AGACGTGGATGGAATACAACTAGCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGA
GATCAAGAAAAGCCATATTTCAGTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCT
TCACTTAGTCCTGATGAGCAGAAAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGG
ATGTTTTCTGTTTATTCACCAGTGAAAAAGAAACCTAATATTTCAGTCCCTAAGCCCTTTCTGGGCTGAAACCTAGACCACCGGGCTTTC
CCAAGCCCACTCTGGGTGTTCCTGGGCCTCCGTCCTTTTGAGGAAACAGTGGGTACCTTGCAAATGGGAGCTCTTGCAATCAATATCGCA

>In-frame_PACSIN2_ENST00000263246_chr22_43308027_-_NUPL2_ENST00000258742_chr7_23224689_+_1677nt
GCGGCCGCAGGGGTCTGGGCAGGGCTGGGCAGTGCTGCCGGAGCAAAAGCGGTAGCGGGAGCCCGGCCGGAGCTGGGTCTGGAGACGCCG
TGGCAGCCTGAACGGAGTGTGCGACGGATTGGGAGGTTTGTCTACAGATTTTGAGCGTTCGAAGTTGACCCCTGACTAAGTATACTTTGC
TGCTCCCTCAGCCTTTGAAAAAATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAAT
AGACGTGGATGGAATACAACTAGCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGA
GATCAAGAAAAGCCATATTTCAGTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCT
TCACTTAGTCCTGATGAGCAGAAAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGG
ATGTTTTCTGTTTATTCACCAGTGAAAAAGAAACCTAATATTTCAGGTTTTACAGACATTTCACCAGAGGAATTGAGGCTTGAATACCAT
AACTTCTTAACCAGCAATAACTTACAGAGTTATCTAAATTCTGTCCAACGTTTAATAAATCAATGGAGGAACAGGGTAAATGAACTGAAA
AGTCTAAATATATCAACTAAAGTAGCTTTGCTCTCTGATGTAAAGGATGGAGTAAATCAAGCAGCACCTGCATTTGGATTTGGCAGCAGT
CAAGCAGCAACATTTATGTCGCCAGGCTTTCCAGTCAATAACAGCAGCAGTGATAATGCTCAGAACTTTAGTTTTAAAACAAACTCTGGA
TTTGCTGCTGCCTCTTCTGGAAGCCCTGCTGGTTTTGGGAGTTCCCCAGCATTTGGAGCTGCAGCCTCTACCAGTTCAGGTATCTCTACT
TCTGCTCCAGCTTTTGGATTTGGGAAGCCTGAAGTCACATCGGCTGCATCATTTTCATTCAAAAGCCCTGCAGCTTCCAGTTTTGGATCA
CCTGGATTTTCAGGACTTCCAGCTTCCTTGGCAACAGGTCCTGTCAGAGCTCCAGTGGCCCCAGCCTTTGGAGGTGGCAGTTCTGTGGCT
GGTTTTGGTAGTCCGGGCTCACATTCTCACACTGCTTTTTCTAAGCCATCCAGTGACACTTTTGGAAATAGCAGCATATCCACTTCTCTG
TCAGCCTCAAGCAGCATCATTGCAACAGATAATGTGTTATTCACACCCAGAGATAAACTAACAGTAGAAGAACTGGAACAATTTCAATCC
AAGAAATTTACTCTGGGAAAAATTCCATTAAAGCCTCCACCTCTGGAACTTCTAAATGTTTAAAAGGGCAATTTTAAATACAAAAAAGAA
TGATGTTTAAAATTGCTTTGAGTGATTCATACAGAGATGTATATATGCATACATGTATATATTCATAAGGAATATAAGCTTCCATCAATA
GTGATTTTAAATTTGATTTTTTTCTTAACTCTAAATATTTAAGTAAAAAGTAACAAAAACTCTGCAAGCAAGGGAATTTTTTTGTACTGT

>In-frame_PACSIN2_ENST00000263246_chr22_43308027_-_NUPL2_ENST00000410002_chr7_23224689_+_773nt
GCGGCCGCAGGGGTCTGGGCAGGGCTGGGCAGTGCTGCCGGAGCAAAAGCGGTAGCGGGAGCCCGGCCGGAGCTGGGTCTGGAGACGCCG
TGGCAGCCTGAACGGAGTGTGCGACGGATTGGGAGGTTTGTCTACAGATTTTGAGCGTTCGAAGTTGACCCCTGACTAAGTATACTTTGC
TGCTCCCTCAGCCTTTGAAAAAATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGACAGCTTCTGGGAGGTAATAAT
AGACGTGGATGGAATACAACTAGCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCACACCATGGGGGGGCAGCAGA
GATCAAGAAAAGCCATATTTCAGTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGATTGTCTGAGAACCCATTTGCT
TCACTTAGTCCTGATGAGCAGAAAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTTGGGAATCATCAGGGCAGTGG
ATGTTTTCTGTTTATTCACCAGTGAAAAAGAAACCTAATATTTCAGTCCCTAAGCCCTTTCTGGGCTGAAACCTAGACCACCGGGCTTTC
CCAAGCCCACTCTGGGTGTTCCTGGGCCTCCGTCCTTTTGAGGAAACAGTGGGTACCTTGCAAATGGGAGCTCTTGCAATCAATATCGCA

>In-frame_PACSIN2_ENST00000403744_chr22_43308027_-_NUPL2_ENST00000258742_chr7_23224689_+_1697nt
CTGTCCCACTGGGCAGGTGCCTCTGACGGAGAGGAGGCGTCGTCGGGAAGTATGTGGCCGTGGCTGCTCTGGCATGATCCTGAAGACTGG
CACGAAGGGGAATGGAGCCGCACAGAGAATTTCAGGCATCAGAGGGGAAGCGCAGGTTTGTCTACAGATTTTGAGCGTTCGAAGTTGACC
CCTGACTAAGTATACTTTGCTGCTCCCTCAGCCTTTGAAAAAATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGAC
AGCTTCTGGGAGGTAATAATAGACGTGGATGGAATACAACTAGCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCA
CACCATGGGGGGGCAGCAGAGATCAAGAAAAGCCATATTTCAGTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGAT
TGTCTGAGAACCCATTTGCTTCACTTAGTCCTGATGAGCAGAAAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTT
GGGAATCATCAGGGCAGTGGATGTTTTCTGTTTATTCACCAGTGAAAAAGAAACCTAATATTTCAGGTTTTACAGACATTTCACCAGAGG
AATTGAGGCTTGAATACCATAACTTCTTAACCAGCAATAACTTACAGAGTTATCTAAATTCTGTCCAACGTTTAATAAATCAATGGAGGA
ACAGGGTAAATGAACTGAAAAGTCTAAATATATCAACTAAAGTAGCTTTGCTCTCTGATGTAAAGGATGGAGTAAATCAAGCAGCACCTG
CATTTGGATTTGGCAGCAGTCAAGCAGCAACATTTATGTCGCCAGGCTTTCCAGTCAATAACAGCAGCAGTGATAATGCTCAGAACTTTA
GTTTTAAAACAAACTCTGGATTTGCTGCTGCCTCTTCTGGAAGCCCTGCTGGTTTTGGGAGTTCCCCAGCATTTGGAGCTGCAGCCTCTA
CCAGTTCAGGTATCTCTACTTCTGCTCCAGCTTTTGGATTTGGGAAGCCTGAAGTCACATCGGCTGCATCATTTTCATTCAAAAGCCCTG
CAGCTTCCAGTTTTGGATCACCTGGATTTTCAGGACTTCCAGCTTCCTTGGCAACAGGTCCTGTCAGAGCTCCAGTGGCCCCAGCCTTTG
GAGGTGGCAGTTCTGTGGCTGGTTTTGGTAGTCCGGGCTCACATTCTCACACTGCTTTTTCTAAGCCATCCAGTGACACTTTTGGAAATA
GCAGCATATCCACTTCTCTGTCAGCCTCAAGCAGCATCATTGCAACAGATAATGTGTTATTCACACCCAGAGATAAACTAACAGTAGAAG
AACTGGAACAATTTCAATCCAAGAAATTTACTCTGGGAAAAATTCCATTAAAGCCTCCACCTCTGGAACTTCTAAATGTTTAAAAGGGCA
ATTTTAAATACAAAAAAGAATGATGTTTAAAATTGCTTTGAGTGATTCATACAGAGATGTATATATGCATACATGTATATATTCATAAGG
AATATAAGCTTCCATCAATAGTGATTTTAAATTTGATTTTTTTCTTAACTCTAAATATTTAAGTAAAAAGTAACAAAAACTCTGCAAGCA

>In-frame_PACSIN2_ENST00000403744_chr22_43308027_-_NUPL2_ENST00000410002_chr7_23224689_+_793nt
CTGTCCCACTGGGCAGGTGCCTCTGACGGAGAGGAGGCGTCGTCGGGAAGTATGTGGCCGTGGCTGCTCTGGCATGATCCTGAAGACTGG
CACGAAGGGGAATGGAGCCGCACAGAGAATTTCAGGCATCAGAGGGGAAGCGCAGGTTTGTCTACAGATTTTGAGCGTTCGAAGTTGACC
CCTGACTAAGTATACTTTGCTGCTCCCTCAGCCTTTGAAAAAATGTCTGTCACATATGATGATTCCGTTGGAGTAGAAGTGTCCAGCGAC
AGCTTCTGGGAGGTAATAATAGACGTGGATGGAATACAACTAGCCAGAGATATTCCAATGTCATCCAGCCATCCAGTTTCTCCAAATCCA
CACCATGGGGGGGCAGCAGAGATCAAGAAAAGCCATATTTCAGTTCTTTTGATTCTGGAGCTTCAACTAACAGGAAGGAAGGCTTTGGAT
TGTCTGAGAACCCATTTGCTTCACTTAGTCCTGATGAGCAGAAAGATGAAAAGAAACTTCTGGAAGGAATTGTAAAAGATATGGAGGTTT
GGGAATCATCAGGGCAGTGGATGTTTTCTGTTTATTCACCAGTGAAAAAGAAACCTAATATTTCAGTCCCTAAGCCCTTTCTGGGCTGAA
ACCTAGACCACCGGGCTTTCCCAAGCCCACTCTGGGTGTTCCTGGGCCTCCGTCCTTTTGAGGAAACAGTGGGTACCTTGCAAATGGGAG


Top

FusionGenePPI for PACSIN2_NUPL2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PACSIN2PACSIN3, PACSIN1, PACSIN2, FASLG, DNM1, SYNJ1, WASL, CARS, CYFIP2, ASAP1, DNM2, HSPA1A, HSPA8, KHDRBS1, MICALL1, APBB1IP, WAS, WIPF1, SBK1, TERF1, TERF2IP, POT1, SHBG, ANKS1A, COL4A3BP, FTL, PLOD2, PTPN12, UGP2, VASN, PPP2R5C, SWAP70, MEOX2, MOV10, NXF1, COBL, COBLL1, THG1L, WIPF2, MPRIP, HSPD1, PTGES3, ST13, EWSR1, TMEM17, ERP44, CDH1, RAI14, GTF2E2, TRIM25NUPL2RAE1, APC, COPS5, NUP214, C9orf41, NUP35, MARK2, KPNB1, NCBP1, NUPL1, NUP153, CNOT1, NUP107, NXF2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+07365_42340424GLE1
TgeneNUPL2chr22:43308027chr7:23224689ENST00000258742+0794_17040424HIV-1 Vpr


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PACSIN2_NUPL2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PACSIN2_NUPL2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePACSIN2C3495559Juvenile arthritis1CTD_human