FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25645

FusionGeneSummary for OXNAD1_LRRTM4

check button Fusion gene summary
Fusion gene informationFusion gene name: OXNAD1_LRRTM4
Fusion gene ID: 25645
HgeneTgene
Gene symbol

OXNAD1

LRRTM4

Gene ID

92106

80059

Gene nameoxidoreductase NAD binding domain containing 1leucine rich repeat transmembrane neuronal 4
Synonyms--
Cytomap

3p25.1-p24.3

2p12

Type of geneprotein-codingprotein-coding
Descriptionoxidoreductase NAD-binding domain-containing protein 1leucine-rich repeat transmembrane neuronal protein 4
Modification date2018052220180523
UniProtAcc

Q96HP4

Q86VH4

Ensembl transtripts involved in fusion geneENST00000606098, ENST00000285083, 
ENST00000605932, ENST00000435829, 
ENST00000544043, ENST00000607329, 
ENST00000409911, ENST00000409884, 
ENST00000409093, ENST00000409088, 
ENST00000409282, ENST00000491242, 
Fusion gene scores* DoF score2 X 3 X 2=121 X 1 X 1=1
# samples 31
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: OXNAD1 [Title/Abstract] AND LRRTM4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AR-A0TZ-01AOXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000606098ENST00000409911OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
Frame-shitENST00000606098ENST00000409884OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
In-frameENST00000606098ENST00000409093OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000606098ENST00000409088OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000606098ENST00000409282OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000606098ENST00000491242OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
Frame-shitENST00000285083ENST00000409911OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
Frame-shitENST00000285083ENST00000409884OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
In-frameENST00000285083ENST00000409093OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000285083ENST00000409088OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000285083ENST00000409282OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000285083ENST00000491242OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
Frame-shitENST00000605932ENST00000409911OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
Frame-shitENST00000605932ENST00000409884OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
In-frameENST00000605932ENST00000409093OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000605932ENST00000409088OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000605932ENST00000409282OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000605932ENST00000491242OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
Frame-shitENST00000435829ENST00000409911OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
Frame-shitENST00000435829ENST00000409884OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
In-frameENST00000435829ENST00000409093OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000435829ENST00000409088OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000435829ENST00000409282OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000435829ENST00000491242OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
Frame-shitENST00000544043ENST00000409911OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
Frame-shitENST00000544043ENST00000409884OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
In-frameENST00000544043ENST00000409093OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000544043ENST00000409088OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000544043ENST00000409282OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
5CDS-intronENST00000544043ENST00000491242OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
intron-3CDSENST00000607329ENST00000409911OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
intron-3CDSENST00000607329ENST00000409884OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
intron-3CDSENST00000607329ENST00000409093OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
intron-intronENST00000607329ENST00000409088OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
intron-intronENST00000607329ENST00000409282OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-
intron-intronENST00000607329ENST00000491242OXNAD1chr3

16327955

+LRRTM4chr2

76976042

-

Top

FusionProtFeatures for OXNAD1_LRRTM4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
OXNAD1

Q96HP4

LRRTM4

Q86VH4

May play a role in the development and maintenance ofthe vertebrate nervous system. Exhibits strong synaptogenicactivity, restricted to excitatory presynaptic differentiation (Bysimilarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for OXNAD1_LRRTM4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_OXNAD1_ENST00000606098_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_170aa
MACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDF

>In-frame_OXNAD1_ENST00000285083_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_170aa
MACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDF

>In-frame_OXNAD1_ENST00000605932_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_170aa
MACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDF

>In-frame_OXNAD1_ENST00000435829_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_188aa
MTPKISWTSKFSVCPESAMACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAA
SESPSVKSLRLLVADQDFSFKAGQ_CHTT_SPCHITAMTSL_SGTARPTSHSMSPRAMRQCLQSRTKAPAWSWAETTASSPPSPGRQHRP

>In-frame_OXNAD1_ENST00000544043_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_188aa
MTPKISWTSKFSVCPESAMACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAA
SESPSVKSLRLLVADQDFSFKAGQ_CHTT_SPCHITAMTSL_SGTARPTSHSMSPRAMRQCLQSRTKAPAWSWAETTASSPPSPGRQHRP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_OXNAD1_ENST00000606098_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_512nt
ATGGCCTGTGCTGCTGTTATGATTCCTGGGTTGTTGCGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTGCGTCACTGAGATTGACACTC
AGCACTTTGCGCCACCTTACTCTAACCAGCATAATGAAATCCAAAAGGAAAACTGATCACATGGAGAGAACTGCAAGTGTCCTTCGACGG
GAGATTGTGTCAGCAGCTAAGGTGTGTGGAGCTGCCAGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGCTTGTTGCTGATCAAGACTTT
TCCTTTAAAGCTGGCCAGTGATGCCACACCACATGAAGCCCTTGCCATATTACAGCTATGACCAGCCTGTGATCGGGTACTGCCAGGCCC
ACCAGCCACTCCATGTCACCAAGGGCTATGAGACAGTGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGAGCTGGGCCGAGACCACAGCT

>In-frame_OXNAD1_ENST00000285083_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_512nt
ATGGCCTGTGCTGCTGTTATGATTCCTGGGTTGTTGCGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTGCGTCACTGAGATTGACACTC
AGCACTTTGCGCCACCTTACTCTAACCAGCATAATGAAATCCAAAAGGAAAACTGATCACATGGAGAGAACTGCAAGTGTCCTTCGACGG
GAGATTGTGTCAGCAGCTAAGGTGTGTGGAGCTGCCAGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGCTTGTTGCTGATCAAGACTTT
TCCTTTAAAGCTGGCCAGTGATGCCACACCACATGAAGCCCTTGCCATATTACAGCTATGACCAGCCTGTGATCGGGTACTGCCAGGCCC
ACCAGCCACTCCATGTCACCAAGGGCTATGAGACAGTGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGAGCTGGGCCGAGACCACAGCT

>In-frame_OXNAD1_ENST00000605932_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_512nt
ATGGCCTGTGCTGCTGTTATGATTCCTGGGTTGTTGCGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTGCGTCACTGAGATTGACACTC
AGCACTTTGCGCCACCTTACTCTAACCAGCATAATGAAATCCAAAAGGAAAACTGATCACATGGAGAGAACTGCAAGTGTCCTTCGACGG
GAGATTGTGTCAGCAGCTAAGGTGTGTGGAGCTGCCAGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGCTTGTTGCTGATCAAGACTTT
TCCTTTAAAGCTGGCCAGTGATGCCACACCACATGAAGCCCTTGCCATATTACAGCTATGACCAGCCTGTGATCGGGTACTGCCAGGCCC
ACCAGCCACTCCATGTCACCAAGGGCTATGAGACAGTGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGAGCTGGGCCGAGACCACAGCT

>In-frame_OXNAD1_ENST00000435829_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_566nt
ATGACTCCTAAAATCTCGTGGACTTCTAAGTTTTCTGTTTGCCCAGAAAGCGCCATGGCCTGTGCTGCTGTTATGATTCCTGGGTTGTTG
CGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTGCGTCACTGAGATTGACACTCAGCACTTTGCGCCACCTTACTCTAACCAGCATAATG
AAATCCAAAAGGAAAACTGATCACATGGAGAGAACTGCAAGTGTCCTTCGACGGGAGATTGTGTCAGCAGCTAAGGTGTGTGGAGCTGCC
AGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGCTTGTTGCTGATCAAGACTTTTCCTTTAAAGCTGGCCAGTGATGCCACACCACATGA
AGCCCTTGCCATATTACAGCTATGACCAGCCTGTGATCGGGTACTGCCAGGCCCACCAGCCACTCCATGTCACCAAGGGCTATGAGACAG
TGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGAGCTGGGCCGAGACCACAGCTTCATCGCCACCATCGCCAGGTCGGCAGCACCGGCCA

>In-frame_OXNAD1_ENST00000544043_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_566nt
ATGACTCCTAAAATCTCGTGGACTTCTAAGTTTTCTGTTTGCCCAGAAAGCGCCATGGCCTGTGCTGCTGTTATGATTCCTGGGTTGTTG
CGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTGCGTCACTGAGATTGACACTCAGCACTTTGCGCCACCTTACTCTAACCAGCATAATG
AAATCCAAAAGGAAAACTGATCACATGGAGAGAACTGCAAGTGTCCTTCGACGGGAGATTGTGTCAGCAGCTAAGGTGTGTGGAGCTGCC
AGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGCTTGTTGCTGATCAAGACTTTTCCTTTAAAGCTGGCCAGTGATGCCACACCACATGA
AGCCCTTGCCATATTACAGCTATGACCAGCCTGTGATCGGGTACTGCCAGGCCCACCAGCCACTCCATGTCACCAAGGGCTATGAGACAG
TGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGAGCTGGGCCGAGACCACAGCTTCATCGCCACCATCGCCAGGTCGGCAGCACCGGCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_OXNAD1_ENST00000606098_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_847nt
AGCCCAGGGCGACGGTCAGCTTGTTAATTCCTGGCTGCAGGAACTTTGTGAGAATTTTAATGCATGGAAAAGCTGTCCATGTTCCAACTG
CTGTACATCCAAAAGTCTCAGTGTAATAGCAGGACCAAAATATTCTGTCAATCAGCTGACCATATACTTAATGACTCCTAAAATCTCGTG
GACTTCTAAGAAAGCGCCATGGCCTGTGCTGCTGTTATGATTCCTGGGTTGTTGCGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTGCG
TCACTGAGATTGACACTCAGCACTTTGCGCCACCTTACTCTAACCAGCATAATGAAATCCAAAAGGAAAACTGATCACATGGAGAGAACT
GCAAGTGTCCTTCGACGGGAGATTGTGTCAGCAGCTAAGGTGTGTGGAGCTGCCAGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGCTT
GTTGCTGATCAAGACTTTTCCTTTAAAGCTGGCCAGTGATGCCACACCACATGAAGCCCTTGCCATATTACAGCTATGACCAGCCTGTGA
TCGGGTACTGCCAGGCCCACCAGCCACTCCATGTCACCAAGGGCTATGAGACAGTGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGAGC
TGGGCCGAGACCACAGCTTCATCGCCACCATCGCCAGGTCGGCAGCACCGGCCATCTACCTAGAGAGAATTGCAAACTAACGCTGAAGCC
AACTCCTCACTGGGGAGCTCCATGGGGGGGAGGGAGGGCCTTCATCTTAAAGGAGAATGGGTGTCCACAATCGCGCAATCGAGCAAGCTC

>In-frame_OXNAD1_ENST00000285083_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_1114nt
CTGGGACCGCGGAGTATTCCAGGCGCCTGCAACTAAACGTGGCCGGGTCTGCAAGCTAGGTGCCAGCGGGGAAAGTTTCCCTGCTTCTTA
TCGTCTGCTTTAACGCCTTAAATAGCCCGCTGAAGGCTGCAGCAGGTGCTAGGTAGCAGCCTCCCGGCCCTCGGGAAAGGCGGGGTGGGG
AGGCGAGAGCAGCTTAGCCTCCTCGACCTCCCTTCCTGGTGACGGACGAACAGTTCCCGTAGAATTTCGCTTCACCGAGTGACCTTGAGC
CCAGGGCGACGGTCAGCTTGTTAATTCCTGGCTGCAGGAACTTTGTGAGAATTTTAATGCATGGAAAAGCTGTCCATGTTCCAACTGCTG
TACATCCAAAAGTCTCAGTGTAATAGCAGGACCAAAATATTCTGTCAATCAGCTGACCATATACTTAATGACTCCTAAAATCTCGTGGAC
TTCTAAGAAAGCGCCATGGCCTGTGCTGCTGTTATGATTCCTGGGTTGTTGCGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTGCGTCA
CTGAGATTGACACTCAGCACTTTGCGCCACCTTACTCTAACCAGCATAATGAAATCCAAAAGGAAAACTGATCACATGGAGAGAACTGCA
AGTGTCCTTCGACGGGAGATTGTGTCAGCAGCTAAGGTGTGTGGAGCTGCCAGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGCTTGTT
GCTGATCAAGACTTTTCCTTTAAAGCTGGCCAGTGATGCCACACCACATGAAGCCCTTGCCATATTACAGCTATGACCAGCCTGTGATCG
GGTACTGCCAGGCCCACCAGCCACTCCATGTCACCAAGGGCTATGAGACAGTGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGAGCTGG
GCCGAGACCACAGCTTCATCGCCACCATCGCCAGGTCGGCAGCACCGGCCATCTACCTAGAGAGAATTGCAAACTAACGCTGAAGCCAAC
TCCTCACTGGGGAGCTCCATGGGGGGGAGGGAGGGCCTTCATCTTAAAGGAGAATGGGTGTCCACAATCGCGCAATCGAGCAAGCTCATC

>In-frame_OXNAD1_ENST00000605932_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_1111nt
GGACCGCGGAGTATTCCAGGCGCCTGCAACTAAACGTGGCCGGGTCTGCAAGCTAGGTGCCAGCGGGGAAAGTTTCCCTGCTTCTTATCG
TCTGCTTTAACGCCTTAAATAGCCCGCTGAAGGCTGCAGCAGGTGCTAGGTAGCAGCCTCCCGGCCCTCGGGAAAGGCGGGGTGGGGAGG
CGAGAGCAGCTTAGCCTCCTCGACCTCCCTTCCTGGTGACGGACGAACAGTTCCCGTAGAATTTCGCTTCACCGAGTGACCTTGAGCCCA
GGGCGACGGTCAGCTTGTTAATTCCTGGCTGCAGGAACTTTGTGAGAATTTTAATGCATGGAAAAGCTGTCCATGTTCCAACTGCTGTAC
ATCCAAAAGTCTCAGTGTAATAGCAGGACCAAAATATTCTGTCAATCAGCTGACCATATACTTAATGACTCCTAAAATCTCGTGGACTTC
TAAGAAAGCGCCATGGCCTGTGCTGCTGTTATGATTCCTGGGTTGTTGCGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTGCGTCACTG
AGATTGACACTCAGCACTTTGCGCCACCTTACTCTAACCAGCATAATGAAATCCAAAAGGAAAACTGATCACATGGAGAGAACTGCAAGT
GTCCTTCGACGGGAGATTGTGTCAGCAGCTAAGGTGTGTGGAGCTGCCAGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGCTTGTTGCT
GATCAAGACTTTTCCTTTAAAGCTGGCCAGTGATGCCACACCACATGAAGCCCTTGCCATATTACAGCTATGACCAGCCTGTGATCGGGT
ACTGCCAGGCCCACCAGCCACTCCATGTCACCAAGGGCTATGAGACAGTGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGAGCTGGGCC
GAGACCACAGCTTCATCGCCACCATCGCCAGGTCGGCAGCACCGGCCATCTACCTAGAGAGAATTGCAAACTAACGCTGAAGCCAACTCC
TCACTGGGGAGCTCCATGGGGGGGAGGGAGGGCCTTCATCTTAAAGGAGAATGGGTGTCCACAATCGCGCAATCGAGCAAGCTCATCGTT

>In-frame_OXNAD1_ENST00000435829_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_1119nt
GAGTATTCCAGGCGCCTGCAACTAAACGTGGCCGGGTCTGCAAGCTAGGTGCCAGCGGGGAAAGTTTCCCTGCTTCTTATCGTCTGCTTT
AACGCCTTAAATAGCCCGCTGAAGGCTGCAGCAGGTGCTAGGTAGCAGCCTCCCGGCCCTCGGGAAAGGCGGGGTGGGGAGGCGAGAGCA
GCTTAGCCTCCTCGACCTCCCTTCCTGGTGACGGACGAACAGTTCCCGTAGAATTTCGCTTCACCGAGTGACCTTGAGCCCAGGGCGACG
GTCAGCTTGTTAATTCCTGGCTGCAGGAACTTTGTGAGAATTTTAATGCATGGAAAAGCTGTCCATGTTCCAACTGCTGTACATCCAAAA
GTCTCAGTGTAATAGCAGGACCAAAATATTCTGTCAATCAGCTGACCATATACTTAATGACTCCTAAAATCTCGTGGACTTCTAAGTTTT
CTGTTTGCCCAGAAAGCGCCATGGCCTGTGCTGCTGTTATGATTCCTGGGTTGTTGCGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTG
CGTCACTGAGATTGACACTCAGCACTTTGCGCCACCTTACTCTAACCAGCATAATGAAATCCAAAAGGAAAACTGATCACATGGAGAGAA
CTGCAAGTGTCCTTCGACGGGAGATTGTGTCAGCAGCTAAGGTGTGTGGAGCTGCCAGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGC
TTGTTGCTGATCAAGACTTTTCCTTTAAAGCTGGCCAGTGATGCCACACCACATGAAGCCCTTGCCATATTACAGCTATGACCAGCCTGT
GATCGGGTACTGCCAGGCCCACCAGCCACTCCATGTCACCAAGGGCTATGAGACAGTGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGA
GCTGGGCCGAGACCACAGCTTCATCGCCACCATCGCCAGGTCGGCAGCACCGGCCATCTACCTAGAGAGAATTGCAAACTAACGCTGAAG
CCAACTCCTCACTGGGGAGCTCCATGGGGGGGAGGGAGGGCCTTCATCTTAAAGGAGAATGGGTGTCCACAATCGCGCAATCGAGCAAGC

>In-frame_OXNAD1_ENST00000544043_chr3_16327955_+_LRRTM4_ENST00000409093_chr2_76976042_-_708nt
ACTTAATGACTCCTAAAATCTCGTGGACTTCTAAGTTTTCTGTTTGCCCAGAAAGCGCCATGGCCTGTGCTGCTGTTATGATTCCTGGGT
TGTTGCGGTGCTCTGTTGGAGCCATCCGTATTGAGGCTGCGTCACTGAGATTGACACTCAGCACTTTGCGCCACCTTACTCTAACCAGCA
TAATGAAATCCAAAAGGAAAACTGATCACATGGAGAGAACTGCAAGTGTCCTTCGACGGGAGATTGTGTCAGCAGCTAAGGTGTGTGGAG
CTGCCAGTGAGTCACCGTCAGTGAAGAGCCTCCGCTTGCTTGTTGCTGATCAAGACTTTTCCTTTAAAGCTGGCCAGTGATGCCACACCA
CATGAAGCCCTTGCCATATTACAGCTATGACCAGCCTGTGATCGGGTACTGCCAGGCCCACCAGCCACTCCATGTCACCAAGGGCTATGA
GACAGTGTCTCCAGAGCAGGACGAAAGCCCCGGCCTGGAGCTGGGCCGAGACCACAGCTTCATCGCCACCATCGCCAGGTCGGCAGCACC
GGCCATCTACCTAGAGAGAATTGCAAACTAACGCTGAAGCCAACTCCTCACTGGGGAGCTCCATGGGGGGGAGGGAGGGCCTTCATCTTA


Top

FusionGenePPI for OXNAD1_LRRTM4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
OXNAD1HSPD1, SRR, DENR, PROSC, YBEY, MRPL12, MMABLRRTM4PILRA, EGFR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for OXNAD1_LRRTM4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for OXNAD1_LRRTM4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource