FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2560

FusionGeneSummary for ARHGEF2_GON4L

check button Fusion gene summary
Fusion gene informationFusion gene name: ARHGEF2_GON4L
Fusion gene ID: 2560
HgeneTgene
Gene symbol

ARHGEF2

GON4L

Gene ID

9181

54856

Gene nameRho/Rac guanine nucleotide exchange factor 2gon-4 like
SynonymsGEF|GEF-H1|GEFH1|LFP40|NEDMHM|P40GON-4|GON4|YARP
Cytomap

1q22

1q22

Type of geneprotein-codingprotein-coding
Descriptionrho guanine nucleotide exchange factor 2Rho/Rac guanine nucleotide exchange factor (GEF) 2guanine nucleotide exchange factor H1microtubule-regulated Rho-GEFproliferating cell nucleolar antigen p40GON-4-like protein2610100B20RikYY1AP related proteinYY1AP-related protein1gon-4 homolog
Modification date2018052220180523
UniProtAcc

Q92974

Q3T8J9

Ensembl transtripts involved in fusion geneENST00000368315, ENST00000313695, 
ENST00000361247, ENST00000368316, 
ENST00000462460, ENST00000477754, 
ENST00000313667, 
ENST00000437809, 
ENST00000368331, ENST00000271883, 
ENST00000361040, ENST00000471341, 
Fusion gene scores* DoF score9 X 8 X 9=6487 X 6 X 6=252
# samples 108
** MAII scorelog2(10/648*10)=-2.6959938131099
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/252*10)=-1.65535182861255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARHGEF2 [Title/Abstract] AND GON4L [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARHGEF2

GO:0032755

positive regulation of interleukin-6 production

21887730

HgeneARHGEF2

GO:0032760

positive regulation of tumor necrosis factor production

21887730

HgeneARHGEF2

GO:0045666

positive regulation of neuron differentiation

28453519

HgeneARHGEF2

GO:0045944

positive regulation of transcription by RNA polymerase II

21887730

HgeneARHGEF2

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

21887730

HgeneARHGEF2

GO:0051092

positive regulation of NF-kappaB transcription factor activity

19043560|21887730

HgeneARHGEF2

GO:0055059

asymmetric neuroblast division

28453519

HgeneARHGEF2

GO:0071225

cellular response to muramyl dipeptide

21887730


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-04-1517-01AARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000368315ENST00000437809ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000368315ENST00000368331ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000368315ENST00000271883ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000368315ENST00000361040ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
5CDS-5UTRENST00000368315ENST00000471341ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000313695ENST00000437809ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000313695ENST00000368331ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000313695ENST00000271883ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000313695ENST00000361040ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
5CDS-5UTRENST00000313695ENST00000471341ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000361247ENST00000437809ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000361247ENST00000368331ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000361247ENST00000271883ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000361247ENST00000361040ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
5CDS-5UTRENST00000361247ENST00000471341ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
Frame-shitENST00000368316ENST00000437809ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
Frame-shitENST00000368316ENST00000368331ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
Frame-shitENST00000368316ENST00000271883ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
Frame-shitENST00000368316ENST00000361040ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
5CDS-5UTRENST00000368316ENST00000471341ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
Frame-shitENST00000462460ENST00000437809ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
Frame-shitENST00000462460ENST00000368331ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
Frame-shitENST00000462460ENST00000271883ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
Frame-shitENST00000462460ENST00000361040ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
5CDS-5UTRENST00000462460ENST00000471341ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
intron-3CDSENST00000477754ENST00000437809ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
intron-3CDSENST00000477754ENST00000368331ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
intron-3CDSENST00000477754ENST00000271883ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
intron-3CDSENST00000477754ENST00000361040ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
intron-5UTRENST00000477754ENST00000471341ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000313667ENST00000437809ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000313667ENST00000368331ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000313667ENST00000271883ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
In-frameENST00000313667ENST00000361040ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-
5CDS-5UTRENST00000313667ENST00000471341ARHGEF2chr1

155924693

-GON4Lchr1

155755165

-

Top

FusionProtFeatures for ARHGEF2_GON4L


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARHGEF2

Q92974

GON4L

Q3T8J9

Activates Rho-GTPases by promoting the exchange of GDPfor GTP. May be involved in epithelial barrier permeability, cellmotility and polarization, dendritic spine morphology, antigenpresentation, leukemic cell differentiation, cell cycleregulation, innate immune response, and cancer. Binds Rac-GTPases,but does not seem to promote nucleotide exchange activity towardRac-GTPases, which was uniquely reported in PubMed:9857026. Maystimulate instead the cortical activity of Rac. Inactive towardCDC42, TC10, or Ras-GTPases. Forms an intracellular sensing systemalong with NOD1 for the detection of microbial effectors duringcell invasion by pathogens. Required for RHOA and RIP2 dependentNF-kappaB signaling pathways activation upon S.flexneri cellinvasion. Involved not only in sensing peptidoglycan (PGN)-derivedmuropeptides through NOD1 that is independent of its GEF activity,but also in the activation of NF-kappaB by Shigella effectorproteins (IpgB2 and OspB) which requires its GEF activity and theactivation of RhoA. Involved in innate immune signalingtransduction pathway promoting cytokine IL6/interleukin-6 and TNF-alpha secretion in macrophage upon stimulation by bacterialpeptidoglycans; acts as a signaling intermediate between NOD2receptor and RIPK2 kinase. Contributes to the tyrosinephosphorylation of RIPK2 through Src tyrosine kinase leading toNF-kappaB activation by NOD2. Overexpression activates Rho-, butnot Rac-GTPases, and increases paracellular permeability (Bysimilarity). Involved in neuronal progenitor cell division anddifferentiation (PubMed:28453519). Involved in the migration ofprecerebellar neurons (By similarity).{ECO:0000250|UniProtKB:Q60875, ECO:0000250|UniProtKB:Q865S3,ECO:0000269|PubMed:19043560, ECO:0000269|PubMed:21887730,ECO:0000269|PubMed:28453519, ECO:0000269|PubMed:9857026}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313667-1422235_432593986DomainDH
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313667-1422472_571593986DomainPH
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313695-1422235_432566959DomainDH
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000361247-1422235_432594987DomainDH
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000361247-1422472_571594987DomainPH
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000368316-1826235_432566959DomainDH
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313667-142239_86593986Zinc fingerPhorbol-ester/DAG-type
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313695-142239_86566959Zinc fingerPhorbol-ester/DAG-type
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000361247-142239_86594987Zinc fingerPhorbol-ester/DAG-type
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000368316-182639_86566959Zinc fingerPhorbol-ester/DAG-type
TgeneGON4Lchr1:155924693chr1:155755165ENST00000271883-11321449_15695822241Compositional biasNote=Glu-rich
TgeneGON4Lchr1:155924693chr1:155755165ENST00000361040-11211449_15695821530Compositional biasNote=Glu-rich
TgeneGON4Lchr1:155924693chr1:155755165ENST00000368331-11321449_15695822242Compositional biasNote=Glu-rich
TgeneGON4Lchr1:155924693chr1:155755165ENST00000437809-11321449_15695822241Compositional biasNote=Glu-rich
TgeneGON4Lchr1:155924693chr1:155755165ENST00000271883-11321624_16965822241DomainPAH 1
TgeneGON4Lchr1:155924693chr1:155755165ENST00000271883-11321706_17775822241DomainPAH 2
TgeneGON4Lchr1:155924693chr1:155755165ENST00000271883-11322148_22015822241DomainMyb-like
TgeneGON4Lchr1:155924693chr1:155755165ENST00000361040-11211624_16965821530DomainPAH 1
TgeneGON4Lchr1:155924693chr1:155755165ENST00000361040-11211706_17775821530DomainPAH 2
TgeneGON4Lchr1:155924693chr1:155755165ENST00000361040-11212148_22015821530DomainMyb-like
TgeneGON4Lchr1:155924693chr1:155755165ENST00000368331-11321624_16965822242DomainPAH 1
TgeneGON4Lchr1:155924693chr1:155755165ENST00000368331-11321706_17775822242DomainPAH 2
TgeneGON4Lchr1:155924693chr1:155755165ENST00000368331-11322148_22015822242DomainMyb-like
TgeneGON4Lchr1:155924693chr1:155755165ENST00000437809-11321624_16965822241DomainPAH 1
TgeneGON4Lchr1:155924693chr1:155755165ENST00000437809-11321706_17775822241DomainPAH 2
TgeneGON4Lchr1:155924693chr1:155755165ENST00000437809-11322148_22015822241DomainMyb-like

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313667-1422587_611593986Coiled coilOntology_term=ECO:0000255
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313667-1422798_867593986Coiled coilOntology_term=ECO:0000255
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313695-1422587_611566959Coiled coilOntology_term=ECO:0000255
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313695-1422798_867566959Coiled coilOntology_term=ECO:0000255
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000361247-1422587_611594987Coiled coilOntology_term=ECO:0000255
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000361247-1422798_867594987Coiled coilOntology_term=ECO:0000255
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000368316-1826587_611566959Coiled coilOntology_term=ECO:0000255
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000368316-1826798_867566959Coiled coilOntology_term=ECO:0000255
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313695-1422472_571566959DomainPH
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000368316-1826472_571566959DomainPH
TgeneGON4Lchr1:155924693chr1:155755165ENST00000271883-1132245_2485822241Compositional biasNote=Poly-Lys
TgeneGON4Lchr1:155924693chr1:155755165ENST00000271883-1132448_4545822241Compositional biasNote=Poly-Pro
TgeneGON4Lchr1:155924693chr1:155755165ENST00000271883-1132517_5765822241Compositional biasNote=Asp-rich
TgeneGON4Lchr1:155924693chr1:155755165ENST00000361040-1121245_2485821530Compositional biasNote=Poly-Lys
TgeneGON4Lchr1:155924693chr1:155755165ENST00000361040-1121448_4545821530Compositional biasNote=Poly-Pro
TgeneGON4Lchr1:155924693chr1:155755165ENST00000361040-1121517_5765821530Compositional biasNote=Asp-rich
TgeneGON4Lchr1:155924693chr1:155755165ENST00000368331-1132245_2485822242Compositional biasNote=Poly-Lys
TgeneGON4Lchr1:155924693chr1:155755165ENST00000368331-1132448_4545822242Compositional biasNote=Poly-Pro
TgeneGON4Lchr1:155924693chr1:155755165ENST00000368331-1132517_5765822242Compositional biasNote=Asp-rich
TgeneGON4Lchr1:155924693chr1:155755165ENST00000437809-1132245_2485822241Compositional biasNote=Poly-Lys
TgeneGON4Lchr1:155924693chr1:155755165ENST00000437809-1132448_4545822241Compositional biasNote=Poly-Pro
TgeneGON4Lchr1:155924693chr1:155755165ENST00000437809-1132517_5765822241Compositional biasNote=Asp-rich


Top

FusionGeneSequence for ARHGEF2_GON4L


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_2254aa
MCCCCGCCPLLAHLEQGSLRERTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKV
KQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLN
MRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEEL
HLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARD
KRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRM
DPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMF
LISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECV
AEPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHL
LATCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWI
LATSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKT
KQLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGV
VLKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFE
SPAALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSL
GGGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEP
KLEPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEIS
GSPERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSP
PGKPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENS
QEENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSK
LLLLTDEDILERDPLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQ
ALACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDF
EEINWTEEKETEFDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSK
VCDSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSGLAVGSTLPSPREVTVTERL
LLDGPPPHSPETPQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSK
TRDAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSS
TGEKVVLWTREADRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATSTSNADQLSDHGDLLSEEE

>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_2255aa
MCCCCGCCPLLAHLEQGSLRERTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKV
KQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLN
MRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEEL
HLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARD
KRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRM
DPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMF
LISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECV
AEPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHL
LATCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWI
LATSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKT
KQLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGV
VLKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFE
SPAALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSL
GGGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEP
KLEPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEIS
GSPERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSP
PGKPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENS
QEENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSK
LLLLTDEDILERDPLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQ
ALACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDF
EEINWTEEKETEFDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSK
VCDSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSAGLAVGSTLPSPREVTVTER
LLLDGPPPHSPETPQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSS
KTRDAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVS
STGEKVVLWTREADRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATSTSNADQLSDHGDLLSEE

>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_2254aa
MCCCCGCCPLLAHLEQGSLRERTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKV
KQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLN
MRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEEL
HLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARD
KRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRM
DPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMF
LISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECV
AEPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHL
LATCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWI
LATSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKT
KQLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGV
VLKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFE
SPAALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSL
GGGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEP
KLEPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEIS
GSPERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSP
PGKPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENS
QEENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSK
LLLLTDEDILERDPLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQ
ALACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDF
EEINWTEEKETEFDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSK
VCDSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSGLAVGSTLPSPREVTVTERL
LLDGPPPHSPETPQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSK
TRDAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSS
TGEKVVLWTREADRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATSTSNADQLSDHGDLLSEEE

>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_1543aa
MCCCCGCCPLLAHLEQGSLRERTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKV
KQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLN
MRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEEL
HLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARD
KRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRM
DPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMF
LISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECV
AEPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHL
LATCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWI
LATSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKT
KQLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGV
VLKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFE
SPAALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSL
GGGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEP
KLEPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEIS
GSPERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSP
PGKPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQVRAGETSQVFRGLSNMTHLLICHLLA

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_2225aa
MKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIR
ERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEEVIYSELMSDFEMD
EKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLL
ERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVT
QRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGC
LLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQ
SVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAEPRPNFNTPQALRFEEPLANLLNEQHRT
VKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEATTTRIFLKELGTFAQSS
IALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELLPVCSLKAKNPQDKIVF
TKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQLPVLGKCCEEIQPHQWKPPIEREEHRL
PFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVLKLKPVATRFPRKAWRQKRSSVLKPLLI
QPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAVPPEARTSFPLSESQTLLSSAP
VPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQSPQTIPITTLLVN
PTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPLADA
ECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGSPERDICDDIKVEHAVELDTGAPSEELS
SAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPGKPEDSSSVDGQSVGTPVGPETGGEKNG
PEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQEENSEPEEEEEEEAEGMESLQKEDEMTD
EAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLLLLTDEDILERDPLREQKDLAFAQATLT
RVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQALACGLFEEQQAFEKSRKFLRQLEICFAE
NPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFEEINWTEEKETEFDGFEEVALPDVEEEEE
PPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSKVCDSKSYKSKEPHELVGSSPHREASPMPG
AKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSGLAVGSTLPSPREVTVTERLLLDGPPPHSPETPQFPPTTGAVLYTVKRN
QVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSKTRDAGRRHVSGKPDTQERWLPSSRARVKT
RDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSSTGEKVVLWTREADRVILTMCQEQGAQPQT

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_2226aa
MKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIR
ERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEEVIYSELMSDFEMD
EKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLL
ERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVT
QRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGC
LLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQ
SVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAEPRPNFNTPQALRFEEPLANLLNEQHRT
VKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEATTTRIFLKELGTFAQSS
IALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELLPVCSLKAKNPQDKIVF
TKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQLPVLGKCCEEIQPHQWKPPIEREEHRL
PFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVLKLKPVATRFPRKAWRQKRSSVLKPLLI
QPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAVPPEARTSFPLSESQTLLSSAP
VPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQSPQTIPITTLLVN
PTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPLADA
ECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGSPERDICDDIKVEHAVELDTGAPSEELS
SAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPGKPEDSSSVDGQSVGTPVGPETGGEKNG
PEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQEENSEPEEEEEEEAEGMESLQKEDEMTD
EAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLLLLTDEDILERDPLREQKDLAFAQATLT
RVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQALACGLFEEQQAFEKSRKFLRQLEICFAE
NPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFEEINWTEEKETEFDGFEEVALPDVEEEEE
PPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSKVCDSKSYKSKEPHELVGSSPHREASPMPG
AKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSAGLAVGSTLPSPREVTVTERLLLDGPPPHSPETPQFPPTTGAVLYTVKR
NQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSKTRDAGRRHVSGKPDTQERWLPSSRARVK
TRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSSTGEKVVLWTREADRVILTMCQEQGAQPQ

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_2225aa
MKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIR
ERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEEVIYSELMSDFEMD
EKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLL
ERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVT
QRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGC
LLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQ
SVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAEPRPNFNTPQALRFEEPLANLLNEQHRT
VKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEATTTRIFLKELGTFAQSS
IALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELLPVCSLKAKNPQDKIVF
TKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQLPVLGKCCEEIQPHQWKPPIEREEHRL
PFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVLKLKPVATRFPRKAWRQKRSSVLKPLLI
QPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAVPPEARTSFPLSESQTLLSSAP
VPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQSPQTIPITTLLVN
PTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPLADA
ECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGSPERDICDDIKVEHAVELDTGAPSEELS
SAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPGKPEDSSSVDGQSVGTPVGPETGGEKNG
PEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQEENSEPEEEEEEEAEGMESLQKEDEMTD
EAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLLLLTDEDILERDPLREQKDLAFAQATLT
RVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQALACGLFEEQQAFEKSRKFLRQLEICFAE
NPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFEEINWTEEKETEFDGFEEVALPDVEEEEE
PPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSKVCDSKSYKSKEPHELVGSSPHREASPMPG
AKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSGLAVGSTLPSPREVTVTERLLLDGPPPHSPETPQFPPTTGAVLYTVKRN
QVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSKTRDAGRRHVSGKPDTQERWLPSSRARVKT
RDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSSTGEKVVLWTREADRVILTMCQEQGAQPQT

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_1514aa
MKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIR
ERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEEVIYSELMSDFEMD
EKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLL
ERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVT
QRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGC
LLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQ
SVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAEPRPNFNTPQALRFEEPLANLLNEQHRT
VKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEATTTRIFLKELGTFAQSS
IALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELLPVCSLKAKNPQDKIVF
TKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQLPVLGKCCEEIQPHQWKPPIEREEHRL
PFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVLKLKPVATRFPRKAWRQKRSSVLKPLLI
QPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAVPPEARTSFPLSESQTLLSSAP
VPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQSPQTIPITTLLVN
PTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPLADA
ECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGSPERDICDDIKVEHAVELDTGAPSEELS
SAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPGKPEDSSSVDGQSVGTPVGPETGGEKNG

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_2253aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVK
QKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELH
LEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDK
RFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMD
PRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFL
ISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVA
EPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLL
ATCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWIL
ATSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTK
QLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVV
LKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFES
PAALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLG
GGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPK
LEPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISG
SPERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPP
GKPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQ
EENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKL
LLLTDEDILERDPLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQA
LACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFE
EINWTEEKETEFDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSKV
CDSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSGLAVGSTLPSPREVTVTERLL
LDGPPPHSPETPQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSKT
RDAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSST
GEKVVLWTREADRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATSTSNADQLSDHGDLLSEEEL

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_2254aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVK
QKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELH
LEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDK
RFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMD
PRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFL
ISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVA
EPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLL
ATCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWIL
ATSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTK
QLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVV
LKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFES
PAALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLG
GGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPK
LEPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISG
SPERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPP
GKPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQ
EENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKL
LLLTDEDILERDPLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQA
LACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFE
EINWTEEKETEFDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSKV
CDSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSAGLAVGSTLPSPREVTVTERL
LLDGPPPHSPETPQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSK
TRDAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSS
TGEKVVLWTREADRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATSTSNADQLSDHGDLLSEEE

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_2253aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVK
QKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELH
LEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDK
RFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMD
PRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFL
ISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVA
EPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLL
ATCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWIL
ATSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTK
QLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVV
LKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFES
PAALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLG
GGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPK
LEPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISG
SPERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPP
GKPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQ
EENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKL
LLLTDEDILERDPLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQA
LACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFE
EINWTEEKETEFDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSKV
CDSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSGLAVGSTLPSPREVTVTERLL
LDGPPPHSPETPQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSKT
RDAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSST
GEKVVLWTREADRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATSTSNADQLSDHGDLLSEEEL

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_1542aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVK
QKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELH
LEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDK
RFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMD
PRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFL
ISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVA
EPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLL
ATCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWIL
ATSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTK
QLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVV
LKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFES
PAALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLG
GGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPK
LEPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISG
SPERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPP
GKPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQVRAGETSQVFRGLSNMTHLLICHLLAC

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_2252aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVK
QKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHL
EPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKR
FQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDP
RAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLI
SAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAE
PRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLA
TCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILA
TSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQ
LPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVL
KLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESP
AALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGG
GCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKL
EPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGS
PERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPG
KPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQE
ENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLL
LLTDEDILERDPLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQAL
ACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFEE
INWTEEKETEFDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSKVC
DSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSGLAVGSTLPSPREVTVTERLLL
DGPPPHSPETPQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSKTR
DAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSSTG
EKVVLWTREADRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATSTSNADQLSDHGDLLSEEELD

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_2253aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVK
QKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHL
EPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKR
FQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDP
RAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLI
SAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAE
PRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLA
TCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILA
TSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQ
LPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVL
KLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESP
AALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGG
GCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKL
EPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGS
PERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPG
KPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQE
ENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLL
LLTDEDILERDPLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQAL
ACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFEE
INWTEEKETEFDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSKVC
DSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSAGLAVGSTLPSPREVTVTERLL
LDGPPPHSPETPQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSKT
RDAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSST
GEKVVLWTREADRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATSTSNADQLSDHGDLLSEEEL

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_2252aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVK
QKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHL
EPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKR
FQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDP
RAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLI
SAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAE
PRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLA
TCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILA
TSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQ
LPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVL
KLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESP
AALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGG
GCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKL
EPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGS
PERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPG
KPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQE
ENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLL
LLTDEDILERDPLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQAL
ACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFEE
INWTEEKETEFDGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPDSKLKKSKRRSCSHCSSKVC
DSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEEAPEERESTEATQSRTVRTTRKGEMPVSGLAVGSTLPSPREVTVTERLLL
DGPPPHSPETPQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEKLPGTVEPPASFLSPVSSKTR
DAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSGIDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSSTG
EKVVLWTREADRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATSTSNADQLSDHGDLLSEEELD

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_1541aa
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVK
QKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHL
EPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKR
FQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDP
RAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLI
SAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAE
PRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLA
TCNPNLNPEATTTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILA
TSKVFMTPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQ
LPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVL
KLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESP
AALPAVPPEARTSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGG
GCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKL
EPQELSPLSATVFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGS
PERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPG
KPEDSSSVDGQSVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQVRAGETSQVFRGLSNMTHLLICHLLACC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_6762nt
ATGTGCTGCTGCTGTGGCTGCTGCCCGCTGCTGGCCCACCTAGAGCAGGGGTCACTTCGAGAGAGGACCCGGGAAAAGGAGAAGATGAAG
GAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGC
ATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTC
AAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGG
CCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGT
GTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAAC
ATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAG
AAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTC
ATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTA
CACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAA
CGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCT
AGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGAC
AAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAG
CGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTG
GGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATG
GACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTG
CTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAG
TACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTT
CTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGC
GTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAAT
GAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTA
GCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTG
AAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTT
CATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTT
CTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATC
GCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGC
ACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATT
CTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACC
AAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACC
TGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACC
AAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCA
TTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACC
ACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTA
GTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAA
CCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTC
CGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAG
TCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTG
CCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCC
TCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTT
GGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCT
ACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATA
CCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCC
AAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAG
TGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAG
GGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGT
GGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGT
GCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCT
GATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCC
CCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCA
GAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTC
CCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCT
CAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAA
GCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAG
AGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAG
CTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGG
GTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACG
GCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAA
GCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAAC
CCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGG
CAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTT
GAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCT
CCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCC
AAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAG
GTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCT
AAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGG
ACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTC
CTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAG
GTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCT
TTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAG
ACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGA
GACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGAC
AGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCC
ACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTC
AACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGT
GAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAG

>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_6765nt
ATGTGCTGCTGCTGTGGCTGCTGCCCGCTGCTGGCCCACCTAGAGCAGGGGTCACTTCGAGAGAGGACCCGGGAAAAGGAGAAGATGAAG
GAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGC
ATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTC
AAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGG
CCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGT
GTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAAC
ATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAG
AAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTC
ATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTA
CACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAA
CGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCT
AGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGAC
AAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAG
CGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTG
GGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATG
GACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTG
CTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAG
TACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTT
CTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGC
GTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAAT
GAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTA
GCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTG
AAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTT
CATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTT
CTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATC
GCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGC
ACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATT
CTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACC
AAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACC
TGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACC
AAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCA
TTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACC
ACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTA
GTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAA
CCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTC
CGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAG
TCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTG
CCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCC
TCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTT
GGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCT
ACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATA
CCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCC
AAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAG
TGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAG
GGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGT
GGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGT
GCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCT
GATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCC
CCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCA
GAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTC
CCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCT
CAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAA
GCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAG
AGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAG
CTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGG
GTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACG
GCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAA
GCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAAC
CCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGG
CAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTT
GAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCT
CCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCC
AAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAG
GTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCT
AAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGG
ACCACCAGAAAGGGAGAGATGCCTGTTTCAGCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGG
CTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAAC
CAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAG
GCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCA
AAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACA
AGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAA
GACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGC
TCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACC
TTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCC
TGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAG

>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_6762nt
ATGTGCTGCTGCTGTGGCTGCTGCCCGCTGCTGGCCCACCTAGAGCAGGGGTCACTTCGAGAGAGGACCCGGGAAAAGGAGAAGATGAAG
GAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGC
ATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTC
AAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGG
CCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGT
GTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAAC
ATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAG
AAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTC
ATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTA
CACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAA
CGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCT
AGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGAC
AAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAG
CGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTG
GGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATG
GACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTG
CTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAG
TACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTT
CTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGC
GTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAAT
GAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTA
GCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTG
AAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTT
CATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTT
CTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATC
GCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGC
ACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATT
CTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACC
AAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACC
TGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACC
AAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCA
TTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACC
ACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTA
GTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAA
CCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTC
CGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAG
TCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTG
CCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCC
TCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTT
GGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCT
ACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATA
CCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCC
AAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAG
TGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAG
GGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGT
GGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGT
GCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCT
GATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCC
CCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCA
GAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTC
CCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCT
CAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAA
GCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAG
AGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAG
CTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGG
GTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACG
GCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAA
GCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAAC
CCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGG
CAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTT
GAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCT
CCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCC
AAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAG
GTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCT
AAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGG
ACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTC
CTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAG
GTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCT
TTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAG
ACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGA
GACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGAC
AGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCC
ACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTC
AACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGT
GAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAG

>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_4629nt
ATGTGCTGCTGCTGTGGCTGCTGCCCGCTGCTGGCCCACCTAGAGCAGGGGTCACTTCGAGAGAGGACCCGGGAAAAGGAGAAGATGAAG
GAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGC
ATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTC
AAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGG
CCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGT
GTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAAC
ATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAG
AAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTC
ATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTA
CACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAA
CGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCT
AGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGAC
AAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAG
CGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTG
GGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATG
GACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTG
CTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAG
TACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTT
CTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGC
GTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAAT
GAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTA
GCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTG
AAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTT
CATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTT
CTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATC
GCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGC
ACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATT
CTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACC
AAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACC
TGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACC
AAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCA
TTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACC
ACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTA
GTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAA
CCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTC
CGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAG
TCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTG
CCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCC
TCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTT
GGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCT
ACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATA
CCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCC
AAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAG
TGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAG
GGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGT
GGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGT
GCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCT
GATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCC
CCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCA
GAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTC
CCAGAACTCCAGGTGAGAGCTGGAGAATATTCTCAAGTATTTCGTGGACTCAGTAATATGTATCACTTATTGATATGCCACCTGCTTGCT

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_6675nt
ATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAAC
AAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACC
AAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGG
GAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCC
AAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCC
CTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGAT
GAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGAT
GTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAG
CTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTA
GAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGT
CCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGA
GACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACT
CAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCA
CTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGC
ATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGC
CTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAG
AAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATG
TTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAG
AGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTA
AATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGT
GTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACA
GTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAA
GTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCAC
CTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCC
ATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTC
AGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGG
ATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTC
ACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTA
ACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAG
ACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTC
CCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGA
ACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGT
GTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATC
CAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTG
CTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTT
GAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCT
GTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAG
GCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGC
CTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAAC
CCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCT
ATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAA
CCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCA
GAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCT
CAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATC
AGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGC
AGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCC
CCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGC
CCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGG
CCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCT
GTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAAT
TCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGAT
GAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGA
GAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCC
AAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACC
AGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGG
ACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAG
CAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAG
AACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATG
TGGCAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGAC
TTTGAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAG
CCTCCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGG
GCCAAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGC
AAGGTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGT
GCTAAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTC
AGGACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGG
CTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAAC
CAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAG
GCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCA
AAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACA
AGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAA
GACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGC
TCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACC
TTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCC
TGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAG

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_6678nt
ATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAAC
AAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACC
AAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGG
GAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCC
AAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCC
CTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGAT
GAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGAT
GTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAG
CTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTA
GAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGT
CCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGA
GACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACT
CAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCA
CTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGC
ATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGC
CTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAG
AAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATG
TTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAG
AGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTA
AATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGT
GTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACA
GTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAA
GTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCAC
CTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCC
ATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTC
AGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGG
ATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTC
ACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTA
ACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAG
ACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTC
CCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGA
ACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGT
GTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATC
CAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTG
CTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTT
GAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCT
GTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAG
GCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGC
CTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAAC
CCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCT
ATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAA
CCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCA
GAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCT
CAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATC
AGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGC
AGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCC
CCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGC
CCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGG
CCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCT
GTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAAT
TCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGAT
GAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGA
GAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCC
AAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACC
AGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGG
ACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAG
CAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAG
AACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATG
TGGCAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGAC
TTTGAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAG
CCTCCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGG
GCCAAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGC
AAGGTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGT
GCTAAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTC
AGGACCACCAGAAAGGGAGAGATGCCTGTTTCAGCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAA
CGGCTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGA
AACCAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCA
GAGGCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCC
TCAAAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAG
ACAAGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCT
AAAGACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTC
AGCTCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAG
ACCTTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACT
GCCTGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAA

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_6675nt
ATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAAC
AAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACC
AAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGG
GAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCC
AAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCC
CTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGAT
GAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGAT
GTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAG
CTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTA
GAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGT
CCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGA
GACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACT
CAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCA
CTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGC
ATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGC
CTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAG
AAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATG
TTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAG
AGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTA
AATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGT
GTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACA
GTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAA
GTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCAC
CTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCC
ATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTC
AGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGG
ATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTC
ACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTA
ACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAG
ACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTC
CCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGA
ACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGT
GTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATC
CAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTG
CTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTT
GAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCT
GTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAG
GCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGC
CTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAAC
CCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCT
ATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAA
CCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCA
GAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCT
CAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATC
AGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGC
AGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCC
CCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGC
CCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGG
CCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCT
GTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAAT
TCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGAT
GAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGA
GAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCC
AAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACC
AGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGG
ACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAG
CAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAG
AACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATG
TGGCAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGAC
TTTGAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAG
CCTCCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGG
GCCAAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGC
AAGGTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGT
GCTAAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTC
AGGACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGG
CTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAAC
CAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAG
GCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCA
AAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACA
AGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAA
GACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGC
TCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACC
TTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCC
TGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAG

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_4542nt
ATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAAC
AAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACC
AAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGG
GAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCC
AAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCC
CTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGAT
GAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGAT
GTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAG
CTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTA
GAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGT
CCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGA
GACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACT
CAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCA
CTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGC
ATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGC
CTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAG
AAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATG
TTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAG
AGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTA
AATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGT
GTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACA
GTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAA
GTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCAC
CTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCC
ATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTC
AGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGG
ATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTC
ACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTA
ACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAG
ACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTC
CCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGA
ACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGT
GTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATC
CAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTG
CTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTT
GAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCT
GTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAG
GCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGC
CTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAAC
CCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCT
ATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAA
CCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCA
GAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCT
CAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATC
AGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGC
AGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCC
CCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGC
CCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGG
CCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCT
GTCCCAGAACTCCAGGTGAGAGCTGGAGAATATTCTCAAGTATTTCGTGGACTCAGTAATATGTATCACTTATTGATATGCCACCTGCTT

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_6759nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAG
GACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATC
TATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACAC
TTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGC
CGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGT
GCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAA
CGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGC
ATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGG
CTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGAC
CCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTC
TGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTAC
ATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTG
ATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTG
CGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAG
CTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCT
GAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAG
GAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCAT
CAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTT
GCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCC
CTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACA
CATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTG
GCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAG
GCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGC
AAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAA
CAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTC
TGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACT
GAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTC
CTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCC
AGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGG
ATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCT
CCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCC
AAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCT
CCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGC
GGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACT
TCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCA
TCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAA
TTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGC
CAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGC
ATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGA
TCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCT
GGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGAT
GAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCA
GGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAA
GAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCA
GAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAG
GAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCA
GTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGC
ATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTG
CTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTG
CGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCT
GTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCT
CTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCC
TCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGGCAG
CTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTTGAA
GAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCTCCC
AAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCCAAG
GACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAGGTC
TGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCTAAG
GAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGGACC
ACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTCCTC
CTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAGGTT
GGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCTTTG
ATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAGACC
AGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGAGAC
AGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGACAGT
GGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCCACT
GGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTCAAC
ATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGTGAA
GCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAGCTG

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_6762nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAG
GACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATC
TATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACAC
TTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGC
CGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGT
GCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAA
CGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGC
ATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGG
CTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGAC
CCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTC
TGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTAC
ATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTG
ATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTG
CGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAG
CTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCT
GAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAG
GAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCAT
CAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTT
GCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCC
CTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACA
CATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTG
GCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAG
GCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGC
AAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAA
CAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTC
TGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACT
GAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTC
CTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCC
AGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGG
ATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCT
CCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCC
AAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCT
CCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGC
GGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACT
TCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCA
TCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAA
TTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGC
CAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGC
ATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGA
TCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCT
GGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGAT
GAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCA
GGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAA
GAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCA
GAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAG
GAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCA
GTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGC
ATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTG
CTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTG
CGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCT
GTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCT
CTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCC
TCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGGCAG
CTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTTGAA
GAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCTCCC
AAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCCAAG
GACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAGGTC
TGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCTAAG
GAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGGACC
ACCAGAAAGGGAGAGATGCCTGTTTCAGCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTC
CTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAG
GTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCT
TTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAG
ACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGA
GACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGAC
AGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCC
ACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTC
AACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGT
GAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAG

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_6759nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAG
GACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATC
TATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACAC
TTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGC
CGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGT
GCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAA
CGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGC
ATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGG
CTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGAC
CCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTC
TGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTAC
ATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTG
ATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTG
CGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAG
CTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCT
GAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAG
GAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCAT
CAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTT
GCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCC
CTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACA
CATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTG
GCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAG
GCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGC
AAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAA
CAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTC
TGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACT
GAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTC
CTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCC
AGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGG
ATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCT
CCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCC
AAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCT
CCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGC
GGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACT
TCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCA
TCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAA
TTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGC
CAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGC
ATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGA
TCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCT
GGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGAT
GAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCA
GGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAA
GAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCA
GAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAG
GAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCA
GTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGC
ATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTG
CTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTG
CGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCT
GTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCT
CTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCC
TCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGGCAG
CTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTTGAA
GAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCTCCC
AAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCCAAG
GACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAGGTC
TGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCTAAG
GAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGGACC
ACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTCCTC
CTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAGGTT
GGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCTTTG
ATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAGACC
AGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGAGAC
AGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGACAGT
GGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCCACT
GGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTCAAC
ATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGTGAA
GCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAGCTG

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_4626nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAG
GACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATC
TATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACAC
TTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGC
CGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGT
GCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAA
CGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGC
ATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGG
CTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGAC
CCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTC
TGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTAC
ATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTG
ATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTG
CGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAG
CTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCT
GAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAG
GAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCAT
CAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTT
GCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCC
CTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACA
CATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTG
GCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAG
GCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGC
AAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAA
CAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTC
TGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACT
GAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTC
CTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCC
AGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGG
ATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCT
CCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCC
AAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCT
CCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGC
GGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACT
TCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCA
TCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAA
TTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGC
CAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGC
ATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGA
TCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCT
GGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGAT
GAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCA
GGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAA
GAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCA
GAACTCCAGGTGAGAGCTGGAGAATATTCTCAAGTATTTCGTGGACTCAGTAATATGTATCACTTATTGATATGCCACCTGCTTGCTTGC

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_6756nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGAC
TTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTAT
GAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTG
GAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGA
CGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCG
GAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGC
TTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATC
ACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTA
GTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCT
CGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGG
AAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATC
TTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATC
AGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGC
ACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAGCTG
ATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAG
CCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAG
CTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAG
ACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCC
ACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAA
ACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAG
CTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGG
TTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAG
ATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTG
AAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGC
CCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATT
CCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCT
GCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAG
GTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCC
TGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGT
GGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCC
TTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCC
ACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTA
GAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAA
GAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATC
CAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCC
CCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGA
GAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAA
GGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGG
AAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAA
GAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAA
CTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAG
GAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTT
GGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATC
AAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTG
TTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGA
GAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTA
GATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTG
GCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCA
CACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGGCAGCTC
CTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTTGAAGAG
ATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCTCCCAAG
ATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCCAAGGAC
TGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAGGTCTGT
GACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCTAAGGAA
GCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGGACCACC
AGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTCCTCCTG
GATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAGGTTGGG
CCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCTTTGATG
CTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAGACCAGA
GATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGAGACAGG
ACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGACAGTGGA
ACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCCACTGGG
GAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTCAACATC
ATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGTGAAGCC
AGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAGCTGGAT

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_6759nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGAC
TTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTAT
GAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTG
GAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGA
CGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCG
GAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGC
TTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATC
ACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTA
GTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCT
CGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGG
AAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATC
TTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATC
AGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGC
ACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAGCTG
ATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAG
CCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAG
CTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAG
ACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCC
ACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAA
ACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAG
CTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGG
TTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAG
ATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTG
AAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGC
CCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATT
CCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCT
GCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAG
GTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCC
TGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGT
GGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCC
TTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCC
ACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTA
GAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAA
GAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATC
CAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCC
CCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGA
GAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAA
GGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGG
AAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAA
GAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAA
CTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAG
GAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTT
GGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATC
AAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTG
TTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGA
GAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTA
GATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTG
GCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCA
CACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGGCAGCTC
CTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTTGAAGAG
ATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCTCCCAAG
ATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCCAAGGAC
TGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAGGTCTGT
GACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCTAAGGAA
GCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGGACCACC
AGAAAGGGAGAGATGCCTGTTTCAGCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTCCTC
CTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAGGTT
GGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCTTTG
ATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAGACC
AGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGAGAC
AGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGACAGT
GGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCCACT
GGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTCAAC
ATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGTGAA
GCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAGCTG

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_6756nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGAC
TTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTAT
GAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTG
GAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGA
CGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCG
GAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGC
TTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATC
ACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTA
GTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCT
CGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGG
AAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATC
TTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATC
AGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGC
ACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAGCTG
ATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAG
CCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAG
CTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAG
ACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCC
ACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAA
ACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAG
CTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGG
TTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAG
ATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTG
AAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGC
CCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATT
CCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCT
GCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAG
GTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCC
TGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGT
GGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCC
TTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCC
ACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTA
GAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAA
GAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATC
CAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCC
CCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGA
GAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAA
GGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGG
AAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAA
GAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAA
CTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAG
GAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTT
GGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATC
AAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTG
TTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGA
GAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTA
GATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTG
GCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCA
CACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGGCAGCTC
CTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTTGAAGAG
ATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCTCCCAAG
ATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCCAAGGAC
TGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAGGTCTGT
GACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCTAAGGAA
GCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGGACCACC
AGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTCCTCCTG
GATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAGGTTGGG
CCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCTTTGATG
CTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAGACCAGA
GATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGAGACAGG
ACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGACAGTGGA
ACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCCACTGGG
GAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTCAACATC
ATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGTGAAGCC
AGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAGCTGGAT

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_4623nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGAC
TTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTAT
GAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTG
GAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGA
CGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCG
GAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGC
TTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATC
ACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTA
GTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCT
CGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGG
AAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATC
TTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATC
AGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGC
ACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAGCTG
ATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAG
CCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAG
CTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAG
ACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCC
ACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAA
ACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAG
CTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGG
TTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAG
ATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTG
AAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGC
CCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATT
CCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCT
GCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAG
GTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCC
TGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGT
GGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCC
TTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCC
ACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTA
GAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAA
GAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATC
CAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCC
CCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGA
GAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAA
GGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGG
AAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAA
GAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAA
CTCCAGGTGAGAGCTGGAGAATATTCTCAAGTATTTCGTGGACTCAGTAATATGTATCACTTATTGATATGCCACCTGCTTGCTTGCTGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_7629nt
ATGTGCTGCTGCTGTGGCTGCTGCCCGCTGCTGGCCCACCTAGAGCAGGGGTCACTTCGAGAGAGGACCCGGGAAAAGGAGAAGATGAAG
GAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGC
ATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTC
AAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGG
CCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGT
GTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAAC
ATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAG
AAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTC
ATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTA
CACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAA
CGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCT
AGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGAC
AAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAG
CGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTG
GGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATG
GACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTG
CTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAG
TACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTT
CTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGC
GTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAAT
GAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTA
GCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTG
AAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTT
CATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTT
CTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATC
GCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGC
ACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATT
CTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACC
AAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACC
TGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACC
AAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCA
TTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACC
ACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTA
GTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAA
CCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTC
CGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAG
TCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTG
CCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCC
TCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTT
GGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCT
ACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATA
CCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCC
AAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAG
TGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAG
GGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGT
GGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGT
GCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCT
GATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCC
CCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCA
GAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTC
CCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCT
CAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAA
GCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAG
AGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAG
CTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGG
GTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACG
GCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAA
GCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAAC
CCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGG
CAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTT
GAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCT
CCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCC
AAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAG
GTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCT
AAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGG
ACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTC
CTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAG
GTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCT
TTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAG
ACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGA
GACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGAC
AGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCC
ACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTC
AACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGT
GAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAG
CTGGATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGGGGAGGGGGTAGTTGTACTCTGCTTG
TACAGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGAGGATGGAGTAGGACCCAGGGGCTCT
GCCATCCTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGCATCGAGAGTGGAGTTCAGCTCCTTTCTC
TACTTTTTTTTGGTCTGATGGCACATATTTATTGTTCTGTGGTCTAATCACAGTGTTTCTAAATGTAAAAAGTGCATATGTTGGTGTAGC
TAGTCCCGCGACATTGAGCTCCTCTGCATGAAGACACTGGGCTCCTGCATCCAGCTGTTTTTATTGCAAACTAGCTCCTTTCTCCCACAC
TGGGAACTTTAGTCCACGAGGCTGTCACCACCCTGGTAGCACTGGGCCAGGCTTTGTAGCTCCTGCAGCAGCTCTGCTACGTCATCGTGC
TCCACTCCAGCATCCATGAAGCTGGCCCAGCGCCGCAAGTCGAGTTTGGTGAGGTCTCTGGCCAAGGCTTCCAGGGTCTGGTGCAGGGAC
GAAGAGGAACACAGTGCCCCAAACACTGGGATGCTCTCCACTGCTGTGGAGGGAGAGGAAACAGAGACCTGTAGATGGATGATTATTCTG
CCCTGGGACTCGCCAAACTGATAAGGAAGTCCAACCTTAGTAGACTTGATTGTAAACTCAACAAATTTGGTGTATTGTCCCCTTAGTACA

>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_7630nt
ATGTGCTGCTGCTGTGGCTGCTGCCCGCTGCTGGCCCACCTAGAGCAGGGGTCACTTCGAGAGAGGACCCGGGAAAAGGAGAAGATGAAG
GAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGC
ATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTC
AAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGG
CCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGT
GTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAAC
ATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAG
AAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTC
ATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTA
CACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAA
CGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCT
AGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGAC
AAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAG
CGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTG
GGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATG
GACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTG
CTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAG
TACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTT
CTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGC
GTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAAT
GAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTA
GCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTG
AAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTT
CATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTT
CTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATC
GCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGC
ACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATT
CTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACC
AAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACC
TGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACC
AAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCA
TTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACC
ACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTA
GTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAA
CCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTC
CGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAG
TCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTG
CCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCC
TCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTT
GGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCT
ACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATA
CCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCC
AAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAG
TGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAG
GGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGT
GGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGT
GCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCT
GATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCC
CCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCA
GAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTC
CCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCT
CAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAA
GCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAG
AGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAG
CTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGG
GTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACG
GCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAA
GCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAAC
CCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGG
CAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTT
GAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCT
CCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCC
AAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAG
GTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCT
AAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGG
ACCACCAGAAAGGGAGAGATGCCTGTTTCAGCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGG
CTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAAC
CAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAG
GCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCA
AAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACA
AGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAA
GACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGC
TCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACC
TTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCC
TGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAG
GAGCTGGATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGGGGAGGGGGTAGTTGTACTCTGC
TTGTACAGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGAGGATGGAGTAGGACCCAGGGGC
TCTGCCATCCTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGCATCGAGAGTGGAGTTCAGCTCCTTT
CTCTACTTTTTTTTGGTCTGATGGCACATATTTATTGTTCTGTGGTCTAATCACAGTGTTTCTAAATGTAAAAAGTGCATATGTTGGTGT
AGCTAGTCCCGCGACATTGAGCTCCTCTGCATGAAGACACTGGGCTCCTGCATCCAGCTGTTTTTATTGCAAACTAGCTCCTTTCTCCCA
CACTGGGAACTTTAGTCCACGAGGCTGTCACCACCCTGGTAGCACTGGGCCAGGCTTTGTAGCTCCTGCAGCAGCTCTGCTACGTCATCG
TGCTCCACTCCAGCATCCATGAAGCTGGCCCAGCGCCGCAAGTCGAGTTTGGTGAGGTCTCTGGCCAAGGCTTCCAGGGTCTGGTGCAGG
GACGAAGAGGAACACAGTGCCCCAAACACTGGGATGCTCTCCACTGCTGTGGAGGGAGAGGAAACAGAGACCTGTAGATGGATGATTATT
CTGCCCTGGGACTCGCCAAACTGATAAGGAAGTCCAACCTTAGTAGACTTGATTGTAAACTCAACAAATTTGGTGTATTGTCCCCTTAGT

>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_7014nt
ATGTGCTGCTGCTGTGGCTGCTGCCCGCTGCTGGCCCACCTAGAGCAGGGGTCACTTCGAGAGAGGACCCGGGAAAAGGAGAAGATGAAG
GAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGC
ATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTC
AAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGG
CCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGT
GTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAAC
ATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAG
AAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTC
ATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTA
CACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAA
CGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCT
AGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGAC
AAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAG
CGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTG
GGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATG
GACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTG
CTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAG
TACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTT
CTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGC
GTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAAT
GAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTA
GCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTG
AAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTT
CATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTT
CTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATC
GCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGC
ACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATT
CTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACC
AAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACC
TGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACC
AAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCA
TTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACC
ACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTA
GTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAA
CCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTC
CGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAG
TCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTG
CCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCC
TCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTT
GGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCT
ACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATA
CCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCC
AAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAG
TGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAG
GGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGT
GGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGT
GCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCT
GATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCC
CCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCA
GAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTC
CCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCT
CAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAA
GCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAG
AGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAG
CTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGG
GTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACG
GCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAA
GCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAAC
CCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGG
CAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTT
GAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCT
CCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCC
AAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAG
GTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCT
AAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGG
ACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTC
CTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAG
GTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCT
TTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAG
ACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGA
GACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGAC
AGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCC
ACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTC
AACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGT
GAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAG
CTGGATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGGGGAGGGGGTAGTTGTACTCTGCTTG
TACAGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGAGGATGGAGTAGGACCCAGGGGCTCT

>In-frame_ARHGEF2_ENST00000368315_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_5085nt
ATGTGCTGCTGCTGTGGCTGCTGCCCGCTGCTGGCCCACCTAGAGCAGGGGTCACTTCGAGAGAGGACCCGGGAAAAGGAGAAGATGAAG
GAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGC
ATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTC
AAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGG
CCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGT
GTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAAC
ATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAG
AAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTC
ATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTA
CACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAA
CGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCT
AGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGAC
AAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAG
CGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTG
GGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATG
GACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTG
CTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAG
TACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTT
CTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGC
GTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAAT
GAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTA
GCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTG
AAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTT
CATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTT
CTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATC
GCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGC
ACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATT
CTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACC
AAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACC
TGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACC
AAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCA
TTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACC
ACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTA
GTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAA
CCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTC
CGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAG
TCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTG
CCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCC
TCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTT
GGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCT
ACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATA
CCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCC
AAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAG
TGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAG
GGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGT
GGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGT
GCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCT
GATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCC
CCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCA
GAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTC
CCAGAACTCCAGGTGAGAGCTGGAGAATATTCTCAAGTATTTCGTGGACTCAGTAATATGTATCACTTATTGATATGCCACCTGCTTGCT
TGCTGCACTATGGATAGTCCTAAAATCATTTGTATTTGATTTGTGAATGCATTATGGGACATGATTGTGGAGTTGAGGTGAAATGAGATG
GAAAGGATGAAATTTTACTTATTATATTAAACTCGTTTACACATTAAATTGAATCACCTGACCATACTTTAAATGCCTTAAAAAATAGTA
ATAGGCTGGGCTTGGTGGCTCACTCCTGTAGTCCCAGCACTTTGGGAGGCTGAGGTGGGTGGATCACAAGGCCAGGAGTTTCAGACTGGC
CTGGCCGACGTGGTAAAACCCCATCTATATTAAAAATAACAAAAATTAGCCAGGCATGGTGGCGGACACCTGTAATCCCTGCTGCTTGGG
AGGCAGAGGCAGGAGAATTGCTTGAGCCCGAGAGACAGAGGTTGCAGTGAGCCGAGATCACGTCATTGCTCTCCAGCCTGGGCAACAGAG

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_7654nt
GGGATCCCGGGAGGGAGCGGAGCGGACCTGGGCTTGGTCGCCTCCAAGCCGGCGGGACCGAGTGCTTTAGGCCGCTTGAAAGAAAGTTGC
TCCGACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCAT
GACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAA
AGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCT
TCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGG
CCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGAT
CCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCT
GATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAA
GGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTT
CCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATAC
ACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCT
GCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCT
CTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACA
GGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGA
GCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCG
TCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCG
CAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGT
GTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACAT
TGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCAC
CTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCG
GCGAATTAAGAAAAAGGAAGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGA
TGGCCCAGAAGAGGAGGAGTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCT
GTTAAATGAACAACATCGGACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAA
GGTTAAACCCCAGAGTGAGAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGT
TCAGCTCTTGACCCAAATCCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCT
GGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGC
TATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTG
TTTGCCAAAGCAAGTGGCTTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAA
TCCCCAGGATAAGATCGTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCC
TCTAATCAGCAAGTACCTTCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAA
CATCATTAAATTTTATAAGAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTAT
AGAGAGAGAAGAACACCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAG
AGAGGTAGGAAATATGACTGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTA
CCCACTGCTATTGCCTAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATC
AGTCCTGAAGCCCCTCCTTATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGA
AGCCCCTCCGAGCAAAATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGG
GGTCAGTGGAGGTGAGAGTTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCA
GACTTTGCTCTCTTCTGCCCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACC
CTCAAAGAGAAGAGGAGTCAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGC
TACCACTGTGAAGATTGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCC
CATCACTACCCTCTTGGTTAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTC
TGGCAATTCTGTGAATCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGA
AAATGCCTTTCAGGGCCTAGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCC
AGGGCCTCCACTAGCAGATGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAG
GCAAGCTCTGGAGCCGCTCCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACC
TGAAGAAGCTAGAGAGGAAATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGG
TGCCCCAAGCGAGGAGTTGAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAAC
CCCTTCATCTTCTCAAGAGCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGA
TCCTGAAGTGAGGCTTAGTAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGA
AACTGGAGGAGAGAAGAATGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGC
TTCTGAGGAATCTGTGCTTTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGA
GGGTGAGTCTGAAGAAGAGAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCA
GAAAGAGGATGAAATGACGGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGA
GACCAGCAGAACTCCACCAGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGC
TCGGGCCAGCAAGGACACCTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGC
CTTTGCCCAAGCTTATCTGACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATT
TGAGTCAAGTACCCAGAGACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTT
TGCTGCTTTCCTGTTACCTGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCA
GCTGGAGATTTGCTTTGCAGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGAT
CACCGAGCTCAAGACACAGATGTGGCAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCC
AGCAGCTAGCCGGATGGGTGACTTTGAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCC
TGATGTGGAAGAAGAGGAGGAGCCTCCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAA
GGAGACTGAATGGCCAGATGGGGCCAAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCG
GAGCTGTAGCCACTGTAGCAGCAAGGTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCG
AGAGGCTAGTCCTATGCCTGGTGCTAAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGA
GGCCACCCAGAGCAGGACTGTCAGGACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCG
AGAAGTGACTGTTACAGAACGGCTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGT
ACTGTACACTGTTAAGAGAAACCAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCA
AAAGGCAGTGAGTGAGTCAGAGGCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTC
CTTCCTGAGTCCTGTTTCCTCAAAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTC
AAGCAGAGCTCGGGTGAAGACAAGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGC
CCCTAGAGGGGGTTTGGCTAAAGACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTG
TGCCAACAACAGCAAGGTCAGCTCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGA
GCAAGGGGCACAGCCACAGACCTTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACT
CATGCAGCTCTTCCACACTGCCTGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCA
TGGGGACCTTCTGTCTGAAGAGGAGCTGGATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGG
GGAGGGGGTAGTTGTACTCTGCTTGTACAGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGA
GGATGGAGTAGGACCCAGGGGCTCTGCCATCCTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGCATC
GAGAGTGGAGTTCAGCTCCTTTCTCTACTTTTTTTTGGTCTGATGGCACATATTTATTGTTCTGTGGTCTAATCACAGTGTTTCTAAATG
TAAAAAGTGCATATGTTGGTGTAGCTAGTCCCGCGACATTGAGCTCCTCTGCATGAAGACACTGGGCTCCTGCATCCAGCTGTTTTTATT
GCAAACTAGCTCCTTTCTCCCACACTGGGAACTTTAGTCCACGAGGCTGTCACCACCCTGGTAGCACTGGGCCAGGCTTTGTAGCTCCTG
CAGCAGCTCTGCTACGTCATCGTGCTCCACTCCAGCATCCATGAAGCTGGCCCAGCGCCGCAAGTCGAGTTTGGTGAGGTCTCTGGCCAA
GGCTTCCAGGGTCTGGTGCAGGGACGAAGAGGAACACAGTGCCCCAAACACTGGGATGCTCTCCACTGCTGTGGAGGGAGAGGAAACAGA
GACCTGTAGATGGATGATTATTCTGCCCTGGGACTCGCCAAACTGATAAGGAAGTCCAACCTTAGTAGACTTGATTGTAAACTCAACAAA
TTTGGTGTATTGTCCCCTTAGTACACCAGTACTCCAGAGGAAGAATGCTTTTCTTGGGAGCCATAGGGTGAATAAAGGAATGTTTAACTG

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_7655nt
GGGATCCCGGGAGGGAGCGGAGCGGACCTGGGCTTGGTCGCCTCCAAGCCGGCGGGACCGAGTGCTTTAGGCCGCTTGAAAGAAAGTTGC
TCCGACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCAT
GACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAA
AGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCT
TCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGG
CCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGAT
CCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCT
GATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAA
GGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTT
CCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATAC
ACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCT
GCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCT
CTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACA
GGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGA
GCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCG
TCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCG
CAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGT
GTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACAT
TGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCAC
CTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCG
GCGAATTAAGAAAAAGGAAGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGA
TGGCCCAGAAGAGGAGGAGTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCT
GTTAAATGAACAACATCGGACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAA
GGTTAAACCCCAGAGTGAGAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGT
TCAGCTCTTGACCCAAATCCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCT
GGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGC
TATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTG
TTTGCCAAAGCAAGTGGCTTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAA
TCCCCAGGATAAGATCGTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCC
TCTAATCAGCAAGTACCTTCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAA
CATCATTAAATTTTATAAGAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTAT
AGAGAGAGAAGAACACCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAG
AGAGGTAGGAAATATGACTGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTA
CCCACTGCTATTGCCTAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATC
AGTCCTGAAGCCCCTCCTTATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGA
AGCCCCTCCGAGCAAAATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGG
GGTCAGTGGAGGTGAGAGTTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCA
GACTTTGCTCTCTTCTGCCCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACC
CTCAAAGAGAAGAGGAGTCAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGC
TACCACTGTGAAGATTGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCC
CATCACTACCCTCTTGGTTAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTC
TGGCAATTCTGTGAATCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGA
AAATGCCTTTCAGGGCCTAGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCC
AGGGCCTCCACTAGCAGATGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAG
GCAAGCTCTGGAGCCGCTCCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACC
TGAAGAAGCTAGAGAGGAAATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGG
TGCCCCAAGCGAGGAGTTGAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAAC
CCCTTCATCTTCTCAAGAGCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGA
TCCTGAAGTGAGGCTTAGTAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGA
AACTGGAGGAGAGAAGAATGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGC
TTCTGAGGAATCTGTGCTTTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGA
GGGTGAGTCTGAAGAAGAGAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCA
GAAAGAGGATGAAATGACGGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGA
GACCAGCAGAACTCCACCAGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGC
TCGGGCCAGCAAGGACACCTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGC
CTTTGCCCAAGCTTATCTGACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATT
TGAGTCAAGTACCCAGAGACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTT
TGCTGCTTTCCTGTTACCTGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCA
GCTGGAGATTTGCTTTGCAGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGAT
CACCGAGCTCAAGACACAGATGTGGCAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCC
AGCAGCTAGCCGGATGGGTGACTTTGAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCC
TGATGTGGAAGAAGAGGAGGAGCCTCCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAA
GGAGACTGAATGGCCAGATGGGGCCAAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCG
GAGCTGTAGCCACTGTAGCAGCAAGGTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCG
AGAGGCTAGTCCTATGCCTGGTGCTAAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGA
GGCCACCCAGAGCAGGACTGTCAGGACCACCAGAAAGGGAGAGATGCCTGTTTCAGCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCC
TCGAGAAGTGACTGTTACAGAACGGCTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGC
TGTACTGTACACTGTTAAGAGAAACCAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGG
CCAAAAGGCAGTGAGTGAGTCAGAGGCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGC
TTCCTTCCTGAGTCCTGTTTCCTCAAAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCC
CTCAAGCAGAGCTCGGGTGAAGACAAGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAA
AGCCCCTAGAGGGGGTTTGGCTAAAGACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGT
GTGTGCCAACAACAGCAAGGTCAGCTCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCA
GGAGCAAGGGGCACAGCCACAGACCTTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGA
ACTCATGCAGCTCTTCCACACTGCCTGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGA
CCATGGGGACCTTCTGTCTGAAGAGGAGCTGGATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCAC
CGGGGAGGGGGTAGTTGTACTCTGCTTGTACAGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCT
GGAGGATGGAGTAGGACCCAGGGGCTCTGCCATCCTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGC
ATCGAGAGTGGAGTTCAGCTCCTTTCTCTACTTTTTTTTGGTCTGATGGCACATATTTATTGTTCTGTGGTCTAATCACAGTGTTTCTAA
ATGTAAAAAGTGCATATGTTGGTGTAGCTAGTCCCGCGACATTGAGCTCCTCTGCATGAAGACACTGGGCTCCTGCATCCAGCTGTTTTT
ATTGCAAACTAGCTCCTTTCTCCCACACTGGGAACTTTAGTCCACGAGGCTGTCACCACCCTGGTAGCACTGGGCCAGGCTTTGTAGCTC
CTGCAGCAGCTCTGCTACGTCATCGTGCTCCACTCCAGCATCCATGAAGCTGGCCCAGCGCCGCAAGTCGAGTTTGGTGAGGTCTCTGGC
CAAGGCTTCCAGGGTCTGGTGCAGGGACGAAGAGGAACACAGTGCCCCAAACACTGGGATGCTCTCCACTGCTGTGGAGGGAGAGGAAAC
AGAGACCTGTAGATGGATGATTATTCTGCCCTGGGACTCGCCAAACTGATAAGGAAGTCCAACCTTAGTAGACTTGATTGTAAACTCAAC
AAATTTGGTGTATTGTCCCCTTAGTACACCAGTACTCCAGAGGAAGAATGCTTTTCTTGGGAGCCATAGGGTGAATAAAGGAATGTTTAA

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_7039nt
GGGATCCCGGGAGGGAGCGGAGCGGACCTGGGCTTGGTCGCCTCCAAGCCGGCGGGACCGAGTGCTTTAGGCCGCTTGAAAGAAAGTTGC
TCCGACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCAT
GACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAA
AGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCT
TCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGG
CCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGAT
CCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCT
GATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAA
GGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTT
CCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATAC
ACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCT
GCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCT
CTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACA
GGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGA
GCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCG
TCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCG
CAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGT
GTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACAT
TGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCAC
CTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCG
GCGAATTAAGAAAAAGGAAGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGA
TGGCCCAGAAGAGGAGGAGTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCT
GTTAAATGAACAACATCGGACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAA
GGTTAAACCCCAGAGTGAGAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGT
TCAGCTCTTGACCCAAATCCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCT
GGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGC
TATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTG
TTTGCCAAAGCAAGTGGCTTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAA
TCCCCAGGATAAGATCGTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCC
TCTAATCAGCAAGTACCTTCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAA
CATCATTAAATTTTATAAGAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTAT
AGAGAGAGAAGAACACCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAG
AGAGGTAGGAAATATGACTGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTA
CCCACTGCTATTGCCTAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATC
AGTCCTGAAGCCCCTCCTTATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGA
AGCCCCTCCGAGCAAAATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGG
GGTCAGTGGAGGTGAGAGTTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCA
GACTTTGCTCTCTTCTGCCCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACC
CTCAAAGAGAAGAGGAGTCAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGC
TACCACTGTGAAGATTGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCC
CATCACTACCCTCTTGGTTAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTC
TGGCAATTCTGTGAATCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGA
AAATGCCTTTCAGGGCCTAGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCC
AGGGCCTCCACTAGCAGATGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAG
GCAAGCTCTGGAGCCGCTCCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACC
TGAAGAAGCTAGAGAGGAAATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGG
TGCCCCAAGCGAGGAGTTGAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAAC
CCCTTCATCTTCTCAAGAGCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGA
TCCTGAAGTGAGGCTTAGTAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGA
AACTGGAGGAGAGAAGAATGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGC
TTCTGAGGAATCTGTGCTTTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGA
GGGTGAGTCTGAAGAAGAGAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCA
GAAAGAGGATGAAATGACGGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGA
GACCAGCAGAACTCCACCAGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGC
TCGGGCCAGCAAGGACACCTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGC
CTTTGCCCAAGCTTATCTGACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATT
TGAGTCAAGTACCCAGAGACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTT
TGCTGCTTTCCTGTTACCTGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCA
GCTGGAGATTTGCTTTGCAGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGAT
CACCGAGCTCAAGACACAGATGTGGCAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCC
AGCAGCTAGCCGGATGGGTGACTTTGAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCC
TGATGTGGAAGAAGAGGAGGAGCCTCCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAA
GGAGACTGAATGGCCAGATGGGGCCAAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCG
GAGCTGTAGCCACTGTAGCAGCAAGGTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCG
AGAGGCTAGTCCTATGCCTGGTGCTAAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGA
GGCCACCCAGAGCAGGACTGTCAGGACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCG
AGAAGTGACTGTTACAGAACGGCTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGT
ACTGTACACTGTTAAGAGAAACCAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCA
AAAGGCAGTGAGTGAGTCAGAGGCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTC
CTTCCTGAGTCCTGTTTCCTCAAAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTC
AAGCAGAGCTCGGGTGAAGACAAGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGC
CCCTAGAGGGGGTTTGGCTAAAGACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTG
TGCCAACAACAGCAAGGTCAGCTCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGA
GCAAGGGGCACAGCCACAGACCTTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACT
CATGCAGCTCTTCCACACTGCCTGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCA
TGGGGACCTTCTGTCTGAAGAGGAGCTGGATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGG
GGAGGGGGTAGTTGTACTCTGCTTGTACAGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGA
GGATGGAGTAGGACCCAGGGGCTCTGCCATCCTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGCATC

>In-frame_ARHGEF2_ENST00000313695_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_5110nt
GGGATCCCGGGAGGGAGCGGAGCGGACCTGGGCTTGGTCGCCTCCAAGCCGGCGGGACCGAGTGCTTTAGGCCGCTTGAAAGAAAGTTGC
TCCGACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCAT
GACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAA
AGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCT
TCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGG
CCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGAT
CCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCT
GATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAA
GGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTT
CCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATAC
ACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCT
GCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCT
CTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACA
GGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGA
GCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCG
TCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCG
CAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGT
GTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACAT
TGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCAC
CTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCG
GCGAATTAAGAAAAAGGAAGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGA
TGGCCCAGAAGAGGAGGAGTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCT
GTTAAATGAACAACATCGGACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAA
GGTTAAACCCCAGAGTGAGAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGT
TCAGCTCTTGACCCAAATCCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCT
GGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGC
TATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTG
TTTGCCAAAGCAAGTGGCTTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAA
TCCCCAGGATAAGATCGTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCC
TCTAATCAGCAAGTACCTTCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAA
CATCATTAAATTTTATAAGAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTAT
AGAGAGAGAAGAACACCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAG
AGAGGTAGGAAATATGACTGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTA
CCCACTGCTATTGCCTAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATC
AGTCCTGAAGCCCCTCCTTATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGA
AGCCCCTCCGAGCAAAATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGG
GGTCAGTGGAGGTGAGAGTTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCA
GACTTTGCTCTCTTCTGCCCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACC
CTCAAAGAGAAGAGGAGTCAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGC
TACCACTGTGAAGATTGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCC
CATCACTACCCTCTTGGTTAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTC
TGGCAATTCTGTGAATCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGA
AAATGCCTTTCAGGGCCTAGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCC
AGGGCCTCCACTAGCAGATGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAG
GCAAGCTCTGGAGCCGCTCCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACC
TGAAGAAGCTAGAGAGGAAATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGG
TGCCCCAAGCGAGGAGTTGAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAAC
CCCTTCATCTTCTCAAGAGCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGA
TCCTGAAGTGAGGCTTAGTAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGA
AACTGGAGGAGAGAAGAATGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGC
TTCTGAGGAATCTGTGCTTTCTGTCCCAGAACTCCAGGTGAGAGCTGGAGAATATTCTCAAGTATTTCGTGGACTCAGTAATATGTATCA
CTTATTGATATGCCACCTGCTTGCTTGCTGCACTATGGATAGTCCTAAAATCATTTGTATTTGATTTGTGAATGCATTATGGGACATGAT
TGTGGAGTTGAGGTGAAATGAGATGGAAAGGATGAAATTTTACTTATTATATTAAACTCGTTTACACATTAAATTGAATCACCTGACCAT
ACTTTAAATGCCTTAAAAAATAGTAATAGGCTGGGCTTGGTGGCTCACTCCTGTAGTCCCAGCACTTTGGGAGGCTGAGGTGGGTGGATC
ACAAGGCCAGGAGTTTCAGACTGGCCTGGCCGACGTGGTAAAACCCCATCTATATTAAAAATAACAAAAATTAGCCAGGCATGGTGGCGG
ACACCTGTAATCCCTGCTGCTTGGGAGGCAGAGGCAGGAGAATTGCTTGAGCCCGAGAGACAGAGGTTGCAGTGAGCCGAGATCACGTCA

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_7726nt
GAGACCAACGCGTGCGGGCCGAACCCCTCCCCCCGCCTTCCCCCAACAATACAGGACGCCGGGGTCCGCGCCGCGTCCTCCCTGGTCCCC
CCGTCCGATTATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAA
GATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAA
CAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTAC
CAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCG
GGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGC
CAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTC
CCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGAT
GGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCA
AGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGA
AGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCT
ATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTC
AGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGC
CCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGT
GACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCAC
AGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAA
CCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGG
CTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGA
CCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGG
GATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCA
GCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGA
AGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGA
GTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCG
GACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGA
GAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAAT
CCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAG
CTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGA
CTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGC
TTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGT
CTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCT
TCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAA
GAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCG
GCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGAC
TGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAA
GGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCT
TATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAAT
GGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAG
TTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGC
CCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGT
CAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGT
GAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGT
TAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCT
TCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCT
AGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGA
TGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCT
CCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGA
AATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTT
GAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGA
GCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAG
TAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAA
TGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCT
TTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGA
GAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGAC
GGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACC
AGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACAC
CTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCT
GACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAG
ACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACC
TGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGC
AGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACA
GATGTGGCAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGG
TGACTTTGAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGA
GGAGCCTCCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGA
TGGGGCCAAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAG
CAGCAAGGTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCC
TGGTGCTAAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGAC
TGTCAGGACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGA
ACGGCTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAG
AAACCAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTC
AGAGGCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTC
CTCAAAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAA
GACAAGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGC
TAAAGACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGT
CAGCTCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACA
GACCTTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACAC
TGCCTGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGA
AGAGGAGCTGGATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGGGGAGGGGGTAGTTGTACT
CTGCTTGTACAGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGAGGATGGAGTAGGACCCAG
GGGCTCTGCCATCCTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGCATCGAGAGTGGAGTTCAGCTC
CTTTCTCTACTTTTTTTTGGTCTGATGGCACATATTTATTGTTCTGTGGTCTAATCACAGTGTTTCTAAATGTAAAAAGTGCATATGTTG
GTGTAGCTAGTCCCGCGACATTGAGCTCCTCTGCATGAAGACACTGGGCTCCTGCATCCAGCTGTTTTTATTGCAAACTAGCTCCTTTCT
CCCACACTGGGAACTTTAGTCCACGAGGCTGTCACCACCCTGGTAGCACTGGGCCAGGCTTTGTAGCTCCTGCAGCAGCTCTGCTACGTC
ATCGTGCTCCACTCCAGCATCCATGAAGCTGGCCCAGCGCCGCAAGTCGAGTTTGGTGAGGTCTCTGGCCAAGGCTTCCAGGGTCTGGTG
CAGGGACGAAGAGGAACACAGTGCCCCAAACACTGGGATGCTCTCCACTGCTGTGGAGGGAGAGGAAACAGAGACCTGTAGATGGATGAT
TATTCTGCCCTGGGACTCGCCAAACTGATAAGGAAGTCCAACCTTAGTAGACTTGATTGTAAACTCAACAAATTTGGTGTATTGTCCCCT

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_7727nt
GAGACCAACGCGTGCGGGCCGAACCCCTCCCCCCGCCTTCCCCCAACAATACAGGACGCCGGGGTCCGCGCCGCGTCCTCCCTGGTCCCC
CCGTCCGATTATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAA
GATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAA
CAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTAC
CAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCG
GGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGC
CAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTC
CCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGAT
GGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCA
AGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGA
AGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCT
ATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTC
AGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGC
CCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGT
GACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCAC
AGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAA
CCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGG
CTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGA
CCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGG
GATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCA
GCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGA
AGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGA
GTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCG
GACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGA
GAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAAT
CCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAG
CTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGA
CTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGC
TTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGT
CTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCT
TCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAA
GAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCG
GCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGAC
TGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAA
GGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCT
TATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAAT
GGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAG
TTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGC
CCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGT
CAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGT
GAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGT
TAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCT
TCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCT
AGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGA
TGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCT
CCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGA
AATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTT
GAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGA
GCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAG
TAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAA
TGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCT
TTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGA
GAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGAC
GGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACC
AGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACAC
CTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCT
GACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAG
ACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACC
TGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGC
AGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACA
GATGTGGCAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGG
TGACTTTGAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGA
GGAGCCTCCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGA
TGGGGCCAAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAG
CAGCAAGGTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCC
TGGTGCTAAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGAC
TGTCAGGACCACCAGAAAGGGAGAGATGCCTGTTTCAGCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTAC
AGAACGGCTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAA
GAGAAACCAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGA
GTCAGAGGCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGT
TTCCTCAAAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGT
GAAGACAAGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTT
GGCTAAAGACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAA
GGTCAGCTCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCC
ACAGACCTTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCA
CACTGCCTGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTC
TGAAGAGGAGCTGGATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGGGGAGGGGGTAGTTGT
ACTCTGCTTGTACAGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGAGGATGGAGTAGGACC
CAGGGGCTCTGCCATCCTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGCATCGAGAGTGGAGTTCAG
CTCCTTTCTCTACTTTTTTTTGGTCTGATGGCACATATTTATTGTTCTGTGGTCTAATCACAGTGTTTCTAAATGTAAAAAGTGCATATG
TTGGTGTAGCTAGTCCCGCGACATTGAGCTCCTCTGCATGAAGACACTGGGCTCCTGCATCCAGCTGTTTTTATTGCAAACTAGCTCCTT
TCTCCCACACTGGGAACTTTAGTCCACGAGGCTGTCACCACCCTGGTAGCACTGGGCCAGGCTTTGTAGCTCCTGCAGCAGCTCTGCTAC
GTCATCGTGCTCCACTCCAGCATCCATGAAGCTGGCCCAGCGCCGCAAGTCGAGTTTGGTGAGGTCTCTGGCCAAGGCTTCCAGGGTCTG
GTGCAGGGACGAAGAGGAACACAGTGCCCCAAACACTGGGATGCTCTCCACTGCTGTGGAGGGAGAGGAAACAGAGACCTGTAGATGGAT
GATTATTCTGCCCTGGGACTCGCCAAACTGATAAGGAAGTCCAACCTTAGTAGACTTGATTGTAAACTCAACAAATTTGGTGTATTGTCC

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_7111nt
GAGACCAACGCGTGCGGGCCGAACCCCTCCCCCCGCCTTCCCCCAACAATACAGGACGCCGGGGTCCGCGCCGCGTCCTCCCTGGTCCCC
CCGTCCGATTATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAA
GATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAA
CAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTAC
CAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCG
GGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGC
CAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTC
CCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGAT
GGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCA
AGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGA
AGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCT
ATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTC
AGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGC
CCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGT
GACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCAC
AGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAA
CCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGG
CTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGA
CCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGG
GATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCA
GCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGA
AGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGA
GTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCG
GACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGA
GAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAAT
CCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAG
CTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGA
CTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGC
TTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGT
CTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCT
TCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAA
GAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCG
GCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGAC
TGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAA
GGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCT
TATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAAT
GGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAG
TTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGC
CCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGT
CAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGT
GAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGT
TAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCT
TCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCT
AGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGA
TGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCT
CCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGA
AATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTT
GAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGA
GCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAG
TAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAA
TGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCT
TTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGA
GAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGAC
GGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACC
AGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACAC
CTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCT
GACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAG
ACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACC
TGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGC
AGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACA
GATGTGGCAGCTCCTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGG
TGACTTTGAAGAGATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGA
GGAGCCTCCCAAGATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGA
TGGGGCCAAGGACTGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAG
CAGCAAGGTCTGTGACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCC
TGGTGCTAAGGAAGCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGAC
TGTCAGGACCACCAGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGA
ACGGCTCCTCCTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAG
AAACCAGGTTGGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTC
AGAGGCTTTGATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTC
CTCAAAGACCAGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAA
GACAAGAGACAGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGC
TAAAGACAGTGGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGT
CAGCTCCACTGGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACA
GACCTTCAACATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACAC
TGCCTGTGAAGCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGA
AGAGGAGCTGGATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGGGGAGGGGGTAGTTGTACT
CTGCTTGTACAGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGAGGATGGAGTAGGACCCAG
GGGCTCTGCCATCCTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGCATCGAGAGTGGAGTTCAGCTC

>In-frame_ARHGEF2_ENST00000361247_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_5182nt
GAGACCAACGCGTGCGGGCCGAACCCCTCCCCCCGCCTTCCCCCAACAATACAGGACGCCGGGGTCCGCGCCGCGTCCTCCCTGGTCCCC
CCGTCCGATTATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAA
GATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAA
CAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTAC
CAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCG
GGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGC
CAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTC
CCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGAT
GGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCA
AGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGA
AGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCT
ATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTC
AGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGC
CCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGT
GACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCAC
AGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAA
CCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGG
CTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGA
CCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGG
GATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCA
GCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGA
AGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGA
GTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCG
GACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGA
GAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAAT
CCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAG
CTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGA
CTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGC
TTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGT
CTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCT
TCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAA
GAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCG
GCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGAC
TGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAA
GGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCT
TATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAAT
GGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAG
TTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGC
CCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGT
CAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGT
GAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGT
TAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCT
TCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCT
AGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGA
TGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCT
CCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGA
AATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTT
GAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGA
GCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAG
TAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAA
TGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCT
TTCTGTCCCAGAACTCCAGGTGAGAGCTGGAGAATATTCTCAAGTATTTCGTGGACTCAGTAATATGTATCACTTATTGATATGCCACCT
GCTTGCTTGCTGCACTATGGATAGTCCTAAAATCATTTGTATTTGATTTGTGAATGCATTATGGGACATGATTGTGGAGTTGAGGTGAAA
TGAGATGGAAAGGATGAAATTTTACTTATTATATTAAACTCGTTTACACATTAAATTGAATCACCTGACCATACTTTAAATGCCTTAAAA
AATAGTAATAGGCTGGGCTTGGTGGCTCACTCCTGTAGTCCCAGCACTTTGGGAGGCTGAGGTGGGTGGATCACAAGGCCAGGAGTTTCA
GACTGGCCTGGCCGACGTGGTAAAACCCCATCTATATTAAAAATAACAAAAATTAGCCAGGCATGGTGGCGGACACCTGTAATCCCTGCT
GCTTGGGAGGCAGAGGCAGGAGAATTGCTTGAGCCCGAGAGACAGAGGTTGCAGTGAGCCGAGATCACGTCATTGCTCTCCAGCCTGGGC

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000437809_chr1_155755165_-_7623nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGAC
TTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTAT
GAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTG
GAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGA
CGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCG
GAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGC
TTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATC
ACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTA
GTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCT
CGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGG
AAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATC
TTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATC
AGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGC
ACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAGCTG
ATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAG
CCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAG
CTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAG
ACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCC
ACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAA
ACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAG
CTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGG
TTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAG
ATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTG
AAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGC
CCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATT
CCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCT
GCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAG
GTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCC
TGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGT
GGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCC
TTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCC
ACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTA
GAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAA
GAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATC
CAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCC
CCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGA
GAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAA
GGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGG
AAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAA
GAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAA
CTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAG
GAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTT
GGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATC
AAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTG
TTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGA
GAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTA
GATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTG
GCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCA
CACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGGCAGCTC
CTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTTGAAGAG
ATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCTCCCAAG
ATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCCAAGGAC
TGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAGGTCTGT
GACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCTAAGGAA
GCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGGACCACC
AGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTCCTCCTG
GATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAGGTTGGG
CCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCTTTGATG
CTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAGACCAGA
GATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGAGACAGG
ACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGACAGTGGA
ACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCCACTGGG
GAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTCAACATC
ATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGTGAAGCC
AGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAGCTGGAT
GAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGGGGAGGGGGTAGTTGTACTCTGCTTGTACAGT
CCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGAGGATGGAGTAGGACCCAGGGGCTCTGCCATC
CTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGCATCGAGAGTGGAGTTCAGCTCCTTTCTCTACTTT
TTTTTGGTCTGATGGCACATATTTATTGTTCTGTGGTCTAATCACAGTGTTTCTAAATGTAAAAAGTGCATATGTTGGTGTAGCTAGTCC
CGCGACATTGAGCTCCTCTGCATGAAGACACTGGGCTCCTGCATCCAGCTGTTTTTATTGCAAACTAGCTCCTTTCTCCCACACTGGGAA
CTTTAGTCCACGAGGCTGTCACCACCCTGGTAGCACTGGGCCAGGCTTTGTAGCTCCTGCAGCAGCTCTGCTACGTCATCGTGCTCCACT
CCAGCATCCATGAAGCTGGCCCAGCGCCGCAAGTCGAGTTTGGTGAGGTCTCTGGCCAAGGCTTCCAGGGTCTGGTGCAGGGACGAAGAG
GAACACAGTGCCCCAAACACTGGGATGCTCTCCACTGCTGTGGAGGGAGAGGAAACAGAGACCTGTAGATGGATGATTATTCTGCCCTGG
GACTCGCCAAACTGATAAGGAAGTCCAACCTTAGTAGACTTGATTGTAAACTCAACAAATTTGGTGTATTGTCCCCTTAGTACACCAGTA

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000368331_chr1_155755165_-_7624nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGAC
TTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTAT
GAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTG
GAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGA
CGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCG
GAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGC
TTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATC
ACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTA
GTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCT
CGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGG
AAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATC
TTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATC
AGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGC
ACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAGCTG
ATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAG
CCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAG
CTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAG
ACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCC
ACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAA
ACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAG
CTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGG
TTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAG
ATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTG
AAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGC
CCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATT
CCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCT
GCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAG
GTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCC
TGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGT
GGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCC
TTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCC
ACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTA
GAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAA
GAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATC
CAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCC
CCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGA
GAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAA
GGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGG
AAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAA
GAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAA
CTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAG
GAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTT
GGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATC
AAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTG
TTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGA
GAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTA
GATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTG
GCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCA
CACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGGCAGCTC
CTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTTGAAGAG
ATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCTCCCAAG
ATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCCAAGGAC
TGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAGGTCTGT
GACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCTAAGGAA
GCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGGACCACC
AGAAAGGGAGAGATGCCTGTTTCAGCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTCCTC
CTGGATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAGGTT
GGGCCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCTTTG
ATGCTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAGACC
AGAGATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGAGAC
AGGACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGACAGT
GGAACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCCACT
GGGGAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTCAAC
ATCATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGTGAA
GCCAGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAGCTG
GATGAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGGGGAGGGGGTAGTTGTACTCTGCTTGTAC
AGTCCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGAGGATGGAGTAGGACCCAGGGGCTCTGCC
ATCCTAGGCATCATTCAAGGTCTTTTATGAAGACTTTACAGATGTCCTCTGTAAATAGCATCGAGAGTGGAGTTCAGCTCCTTTCTCTAC
TTTTTTTTGGTCTGATGGCACATATTTATTGTTCTGTGGTCTAATCACAGTGTTTCTAAATGTAAAAAGTGCATATGTTGGTGTAGCTAG
TCCCGCGACATTGAGCTCCTCTGCATGAAGACACTGGGCTCCTGCATCCAGCTGTTTTTATTGCAAACTAGCTCCTTTCTCCCACACTGG
GAACTTTAGTCCACGAGGCTGTCACCACCCTGGTAGCACTGGGCCAGGCTTTGTAGCTCCTGCAGCAGCTCTGCTACGTCATCGTGCTCC
ACTCCAGCATCCATGAAGCTGGCCCAGCGCCGCAAGTCGAGTTTGGTGAGGTCTCTGGCCAAGGCTTCCAGGGTCTGGTGCAGGGACGAA
GAGGAACACAGTGCCCCAAACACTGGGATGCTCTCCACTGCTGTGGAGGGAGAGGAAACAGAGACCTGTAGATGGATGATTATTCTGCCC
TGGGACTCGCCAAACTGATAAGGAAGTCCAACCTTAGTAGACTTGATTGTAAACTCAACAAATTTGGTGTATTGTCCCCTTAGTACACCA

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000271883_chr1_155755165_-_7008nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGAC
TTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTAT
GAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTG
GAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGA
CGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCG
GAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGC
TTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATC
ACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTA
GTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCT
CGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGG
AAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATC
TTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATC
AGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGC
ACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAGCTG
ATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAG
CCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAG
CTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAG
ACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCC
ACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAA
ACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAG
CTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGG
TTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAG
ATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTG
AAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGC
CCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATT
CCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCT
GCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAG
GTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCC
TGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGT
GGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCC
TTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCC
ACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTA
GAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAA
GAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATC
CAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCC
CCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGA
GAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAA
GGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGG
AAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAA
GAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAA
CTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAG
GAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTT
GGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATC
AAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTG
TTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGA
GAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTA
GATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTG
GCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCA
CACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGCTCAAGACACAGATGTGGCAGCTC
CTCAAGGGCCACGACCACCTGCAGGATGAGTTTTCTATCTTCTTTGACCACTTGCGCCCAGCAGCTAGCCGGATGGGTGACTTTGAAGAG
ATCAATTGGACTGAGGAAAAGGAGTATGAGTTTGATGGCTTTGAAGAAGTGGCCCTGCCTGATGTGGAAGAAGAGGAGGAGCCTCCCAAG
ATACCCACAGCCTCAAAGAACAAGAGGAAAAAAGAGATCGGGGTCCAAAATCATGATAAGGAGACTGAATGGCCAGATGGGGCCAAGGAC
TGTGCCTGCTCCTGCCATGAAGGAGGTCCAGATTCCAAGCTGAAGAAGAGCAAAAGGCGGAGCTGTAGCCACTGTAGCAGCAAGGTCTGT
GACAGCAAATCCTACAAGAGCAAGGAGCCCCATGAGTTGGTGGGCAGCAGCCCCCACCGAGAGGCTAGTCCTATGCCTGGTGCTAAGGAA
GCTGGGCAGGGCAAGGATATGATGGAAGAGGAAGCCCCAGAGGAGCGGGAGAGCACTGAGGCCACCCAGAGCAGGACTGTCAGGACCACC
AGAAAGGGAGAGATGCCTGTTTCAGGATTGGCAGTGGGGAGCACTTTGCCATCCCCTCGAGAAGTGACTGTTACAGAACGGCTCCTCCTG
GATGGCCCACCACCTCATTCACCAGAGACTCCTCAATTTCCCCCCACAACTGGAGCTGTACTGTACACTGTTAAGAGAAACCAGGTTGGG
CCTGAGGTTCGCTCCTGCCCCAAGGCATCCCCCAGACTTCAGAAAGAGAGGGAGGGCCAAAAGGCAGTGAGTGAGTCAGAGGCTTTGATG
CTGGTCTGGGATGCATCAGAAACTGAGAAATTGCCTGGTACCGTGGAACCCCCTGCTTCCTTCCTGAGTCCTGTTTCCTCAAAGACCAGA
GATGCAGGGAGAAGACATGTGTCCGGGAAACCAGACACTCAAGAGAGATGGCTGCCCTCAAGCAGAGCTCGGGTGAAGACAAGAGACAGG
ACGTGCCCTGTCCATGAATCTCCATCAGGAATTGACACCTCAGAGACTTCTCCCAAAGCCCCTAGAGGGGGTTTGGCTAAAGACAGTGGA
ACACAGGCCAAGGGTCCAGAGGGGGAGCAGCAGCCAAAGGCCGCAGAAGCTACGGTGTGTGCCAACAACAGCAAGGTCAGCTCCACTGGG
GAAAAGGTTGTCCTGTGGACAAGGGAAGCTGACCGTGTGATCCTCACCATGTGCCAGGAGCAAGGGGCACAGCCACAGACCTTCAACATC
ATCTCCCAGCAGCTGGGAAATAAGACCCCTGCTGAGGTTTCCCACCGTTTTCGAGAACTCATGCAGCTCTTCCACACTGCCTGTGAAGCC
AGCTCTGAGGATGAGGATGATGCAACCAGTACCAGCAATGCAGACCAGCTGTCTGACCATGGGGACCTTCTGTCTGAAGAGGAGCTGGAT
GAATGAGACTCTGGGAATCATCTACACAGGACCAAACCCAACAGGCGCCCTGGCACCGGGGAGGGGGTAGTTGTACTCTGCTTGTACAGT
CCTTGAGCCCAGTTTACAGATCTGGAGAGCAGGAGGCCAGGACAAGGACAAAGGCTGGAGGATGGAGTAGGACCCAGGGGCTCTGCCATC

>In-frame_ARHGEF2_ENST00000313667_chr1_155924693_-_GON4L_ENST00000361040_chr1_155755165_-_5079nt
ATGTCTCGGATCGAATCCCTCACGCGGGCGCGGATCGACCGGAGCAGAGAGCTGGCGAGCAAGACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGAC
TTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTAT
GAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTG
GAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGA
CGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCG
GAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGC
TTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATC
ACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTA
GTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCT
CGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGG
AAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATC
TTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATC
AGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGC
ACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGAAAAAGGAAGTAAATGAGCTG
ATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAG
CCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAG
CTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAG
ACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCC
ACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAA
ACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAG
CTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGG
TTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAG
ATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTG
AAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGC
CCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATT
CCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCT
GCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAG
GTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCC
TGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGT
GGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCC
TTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCC
ACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTA
GAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAA
GAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATC
CAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCC
CCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGA
GAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAA
GGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGG
AAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAA
GAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAA
CTCCAGGTGAGAGCTGGAGAATATTCTCAAGTATTTCGTGGACTCAGTAATATGTATCACTTATTGATATGCCACCTGCTTGCTTGCTGC
ACTATGGATAGTCCTAAAATCATTTGTATTTGATTTGTGAATGCATTATGGGACATGATTGTGGAGTTGAGGTGAAATGAGATGGAAAGG
ATGAAATTTTACTTATTATATTAAACTCGTTTACACATTAAATTGAATCACCTGACCATACTTTAAATGCCTTAAAAAATAGTAATAGGC
TGGGCTTGGTGGCTCACTCCTGTAGTCCCAGCACTTTGGGAGGCTGAGGTGGGTGGATCACAAGGCCAGGAGTTTCAGACTGGCCTGGCC
GACGTGGTAAAACCCCATCTATATTAAAAATAACAAAAATTAGCCAGGCATGGTGGCGGACACCTGTAATCCCTGCTGCTTGGGAGGCAG
AGGCAGGAGAATTGCTTGAGCCCGAGAGACAGAGGTTGCAGTGAGCCGAGATCACGTCATTGCTCTCCAGCCTGGGCAACAGAGCAAGGC


Top

FusionGenePPI for ARHGEF2_GON4L


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARHGEF2MYC, PAK1, YWHAQ, RAC1, RHOA, PLCG1, MARK2, TAF10, MAPK1, YWHAG, MARK4, YWHAH, ELAVL1, USP21, YWHAZ, NOTCH1, VCP, PEX14, MMS19, FBXO6, ANKRD28, PPP6C, PPP6R1, YWHAB, RPA3, RPA2, RPA1, CEP250, RPP25L, MOV10, NXF1, CCDC8, EGFR, WDR83, FGL1, NTRK1, COPS7A, KLC2, PRDX1, PSME3, CEP170, CNTRL, SCLT1, DCTN1, PPP2R1A, FOXO3, SNW1, CDC5L, PPP2CA, PPP2CB, PAK7, UBE2AGON4LDHX16, PNKD, HIST1H2BA, KRAS, HIST1H2BG, CRAMP1L, H2AFX, ASB3, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313667-1422131_161593986DYNLT1
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000313695-1422131_161566959DYNLT1
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000361247-1422131_161594987DYNLT1
HgeneARHGEF2chr1:155924693chr1:155755165ENST00000368316-1826131_161566959DYNLT1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARHGEF2_GON4L


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARHGEF2_GON4L


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneGON4LC3714756Intellectual Disability1CTD_human