FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25493

FusionGeneSummary for ORMDL3_PPP1R1B

check button Fusion gene summary
Fusion gene informationFusion gene name: ORMDL3_PPP1R1B
Fusion gene ID: 25493
HgeneTgene
Gene symbol

ORMDL3

PPP1R1B

Gene ID

94103

84152

Gene nameORMDL sphingolipid biosynthesis regulator 3protein phosphatase 1 regulatory inhibitor subunit 1B
Synonyms-DARPP-32|DARPP32
Cytomap

17q21.1

17q12

Type of geneprotein-codingprotein-coding
DescriptionORM1-like protein 3protein phosphatase 1 regulatory subunit 1Bdopamine and cAMP-regulated neuronal phosphoprotein 32
Modification date2018052320180527
UniProtAcc

Q8N138

Q9UD71

Ensembl transtripts involved in fusion geneENST00000304046, ENST00000579695, 
ENST00000394169, ENST00000584220, 
ENST00000582052, 
ENST00000580825, 
ENST00000254079, ENST00000579000, 
ENST00000394265, ENST00000394267, 
Fusion gene scores* DoF score3 X 2 X 2=1210 X 5 X 11=550
# samples 319
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(19/550*10)=-1.53343220008107
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ORMDL3 [Title/Abstract] AND PPP1R1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePPP1R1B

GO:0032515

negative regulation of phosphoprotein phosphatase activity

10807923


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDUCECTCGA-D1-A3JP-01AORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000304046ENST00000580825ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
In-frameENST00000304046ENST00000254079ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
In-frameENST00000304046ENST00000579000ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
5CDS-5UTRENST00000304046ENST00000394265ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
5CDS-5UTRENST00000304046ENST00000394267ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
Frame-shitENST00000579695ENST00000580825ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
Frame-shitENST00000579695ENST00000254079ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
Frame-shitENST00000579695ENST00000579000ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
5CDS-5UTRENST00000579695ENST00000394265ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
5CDS-5UTRENST00000579695ENST00000394267ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
In-frameENST00000394169ENST00000580825ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
In-frameENST00000394169ENST00000254079ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
In-frameENST00000394169ENST00000579000ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
5CDS-5UTRENST00000394169ENST00000394265ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
5CDS-5UTRENST00000394169ENST00000394267ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-3CDSENST00000584220ENST00000580825ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-3CDSENST00000584220ENST00000254079ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-3CDSENST00000584220ENST00000579000ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-5UTRENST00000584220ENST00000394265ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-5UTRENST00000584220ENST00000394267ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-3CDSENST00000582052ENST00000580825ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-3CDSENST00000582052ENST00000254079ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-3CDSENST00000582052ENST00000579000ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-5UTRENST00000582052ENST00000394265ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+
intron-5UTRENST00000582052ENST00000394267ORMDL3chr17

38080283

-PPP1R1Bchr17

37785423

+

Top

FusionProtFeatures for ORMDL3_PPP1R1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ORMDL3

Q8N138

PPP1R1B

Q9UD71

Negative regulator of sphingolipid synthesis. Mayindirectly regulate endoplasmic reticulum-mediated Ca(+2)signaling. {ECO:0000269|PubMed:20182505}. Inhibitor of protein-phosphatase 1.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneORMDL3chr17:38080283chr17:37785423ENST00000304046-241_2158154Topological domainCytoplasmic
HgeneORMDL3chr17:38080283chr17:37785423ENST00000394169-461_2158154Topological domainCytoplasmic
HgeneORMDL3chr17:38080283chr17:37785423ENST00000579695-241_2158154Topological domainCytoplasmic
HgeneORMDL3chr17:38080283chr17:37785423ENST00000304046-2422_4258154TransmembraneHelical
HgeneORMDL3chr17:38080283chr17:37785423ENST00000394169-4622_4258154TransmembraneHelical
HgeneORMDL3chr17:38080283chr17:37785423ENST00000579695-2422_4258154TransmembraneHelical
TgenePPP1R1Bchr17:38080283chr17:37785423ENST00000254079+07119_13627205Compositional biasNote=Asp/Glu-rich (acidic)
TgenePPP1R1Bchr17:38080283chr17:37785423ENST00000394265+07119_136-9169Compositional biasNote=Asp/Glu-rich (acidic)
TgenePPP1R1Bchr17:38080283chr17:37785423ENST00000394267+07119_136-9169Compositional biasNote=Asp/Glu-rich (acidic)
TgenePPP1R1Bchr17:38080283chr17:37785423ENST00000580825+18119_13627205Compositional biasNote=Asp/Glu-rich (acidic)

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneORMDL3chr17:38080283chr17:37785423ENST00000304046-24118_15358154Topological domainCytoplasmic
HgeneORMDL3chr17:38080283chr17:37785423ENST00000304046-2443_9458154Topological domainLumenal
HgeneORMDL3chr17:38080283chr17:37785423ENST00000394169-46118_15358154Topological domainCytoplasmic
HgeneORMDL3chr17:38080283chr17:37785423ENST00000394169-4643_9458154Topological domainLumenal
HgeneORMDL3chr17:38080283chr17:37785423ENST00000579695-24118_15358154Topological domainCytoplasmic
HgeneORMDL3chr17:38080283chr17:37785423ENST00000579695-2443_9458154Topological domainLumenal
HgeneORMDL3chr17:38080283chr17:37785423ENST00000584220-13118_1530138Topological domainCytoplasmic
HgeneORMDL3chr17:38080283chr17:37785423ENST00000584220-131_210138Topological domainCytoplasmic
HgeneORMDL3chr17:38080283chr17:37785423ENST00000584220-1343_940138Topological domainLumenal
HgeneORMDL3chr17:38080283chr17:37785423ENST00000304046-2495_11758154TransmembraneHelical
HgeneORMDL3chr17:38080283chr17:37785423ENST00000394169-4695_11758154TransmembraneHelical
HgeneORMDL3chr17:38080283chr17:37785423ENST00000579695-2495_11758154TransmembraneHelical
HgeneORMDL3chr17:38080283chr17:37785423ENST00000584220-1322_420138TransmembraneHelical
HgeneORMDL3chr17:38080283chr17:37785423ENST00000584220-1395_1170138TransmembraneHelical


Top

FusionGeneSequence for ORMDL3_PPP1R1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ORMDL3_ENST00000304046_chr17_38080283_-_PPP1R1B_ENST00000580825_chr17_37785423_+_236aa
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASG
EGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGTPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSA

>In-frame_ORMDL3_ENST00000304046_chr17_38080283_-_PPP1R1B_ENST00000254079_chr17_37785423_+_236aa
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASG
EGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGTPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSA

>In-frame_ORMDL3_ENST00000304046_chr17_38080283_-_PPP1R1B_ENST00000579000_chr17_37785423_+_203aa
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMIRRRRPTPAMLFRLSEHSSPAVQRIAESHLQS
ISNLNENQASEEEDELGELRELGTPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQV

>In-frame_ORMDL3_ENST00000394169_chr17_38080283_-_PPP1R1B_ENST00000580825_chr17_37785423_+_236aa
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASG
EGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGTPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSA

>In-frame_ORMDL3_ENST00000394169_chr17_38080283_-_PPP1R1B_ENST00000254079_chr17_37785423_+_236aa
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASG
EGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGTPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSA

>In-frame_ORMDL3_ENST00000394169_chr17_38080283_-_PPP1R1B_ENST00000579000_chr17_37785423_+_203aa
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMIRRRRPTPAMLFRLSEHSSPAVQRIAESHLQS
ISNLNENQASEEEDELGELRELGTPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ORMDL3_ENST00000304046_chr17_38080283_-_PPP1R1B_ENST00000580825_chr17_37785423_+_708nt
ATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATC
GGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGG
CGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGA
GAGGGGCACCATCTCAAGTCGAAGAGACCCAACCCCTGTGCCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCAC
CTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAG
GAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCT
GGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAG

>In-frame_ORMDL3_ENST00000304046_chr17_38080283_-_PPP1R1B_ENST00000254079_chr17_37785423_+_708nt
ATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATC
GGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGG
CGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGA
GAGGGGCACCATCTCAAGTCGAAGAGACCCAACCCCTGTGCCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCAC
CTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAG
GAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCT
GGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAG

>In-frame_ORMDL3_ENST00000304046_chr17_38080283_-_PPP1R1B_ENST00000579000_chr17_37785423_+_609nt
ATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATC
GGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGG
CGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACCAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCT
ATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAG
GAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAG
ACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTG

>In-frame_ORMDL3_ENST00000394169_chr17_38080283_-_PPP1R1B_ENST00000580825_chr17_37785423_+_708nt
ATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATC
GGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGG
CGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGA
GAGGGGCACCATCTCAAGTCGAAGAGACCCAACCCCTGTGCCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCAC
CTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAG
GAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCT
GGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAG

>In-frame_ORMDL3_ENST00000394169_chr17_38080283_-_PPP1R1B_ENST00000254079_chr17_37785423_+_708nt
ATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATC
GGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGG
CGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGA
GAGGGGCACCATCTCAAGTCGAAGAGACCCAACCCCTGTGCCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCAC
CTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAG
GAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCT
GGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAG

>In-frame_ORMDL3_ENST00000394169_chr17_38080283_-_PPP1R1B_ENST00000579000_chr17_37785423_+_609nt
ATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATC
GGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGG
CGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACCAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCT
ATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAG
GAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAG
ACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ORMDL3_ENST00000304046_chr17_38080283_-_PPP1R1B_ENST00000580825_chr17_37785423_+_983nt
GATTCGGCCGGAGCTGCCAGCGGGGAGGCTGCAGCCGCGGGTTGTTACAGCTGCTGGAGCAGCAGCGGCCCCCGCTCCCGGGAACCGTTC
CCGGGCCGTTGATCTTCGGCCCCACACGAACAGCAGAGAGGGGCAGCAGGATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACA
CGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATCGGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGA
GTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAG
AGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGAGAGGGGCACCATCTCAAGTCGAAGAGACCCAACCCCTGTG
CCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAG
AGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAG
AAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCT
GGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGGGGAGG
AACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGTGGAGGGGACATCGCTGTTCCCC

>In-frame_ORMDL3_ENST00000304046_chr17_38080283_-_PPP1R1B_ENST00000254079_chr17_37785423_+_1609nt
GATTCGGCCGGAGCTGCCAGCGGGGAGGCTGCAGCCGCGGGTTGTTACAGCTGCTGGAGCAGCAGCGGCCCCCGCTCCCGGGAACCGTTC
CCGGGCCGTTGATCTTCGGCCCCACACGAACAGCAGAGAGGGGCAGCAGGATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACA
CGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATCGGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGA
GTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAG
AGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGAGAGGGGCACCATCTCAAGTCGAAGAGACCCAACCCCTGTG
CCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAG
AGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAG
AAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCT
GGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGGGGAGG
AACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGTGGAGGGGACATCGCTGTTCCCC
AGAAACCCACTCTATCCTCACCCTGTTTTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGACTTCTAGAAGACTAAGGCTGGTC
TGTGTTTGCTTGTTTGCCCACCTTTGGCTGATACCCAGAGAACCTGGGCACTTGCTGCCTGATGCCCACCCCTGCCAGTCATTCCTCCAT
TCACCCAGCGGGAGGTGGGATGTGAGACAGCCCACATTGGAAAATCCAGAAAACCGGGAACAGGGATTTGCCCTTCACAATTCTACTCCC
CAGATCCTCTCCCCTGGACACAGGAGACCCACAGGGCAGGACCCTAAGATCTGGGGAAAGGAGGTCCTGAGAACCTTGAGGTACCCTTAG
ATCCTTTTCTACCCACTTTCCTATGGAGGATTCCAAGTCACCACTTCTCTCACCGGCTTCTACCAGGGTCCAGGACTAAGGCGTTTTTCT
CCATAGCCTCAACATTTTGGGAATCTTCCCTTAATCACCCTTGCTCCTCCTGGGTGCCTGGAAGATGGACTGGCAGAGACCTCTTTGTTG
CGTTTTGTGCTTTGATGCCAGGAATGCCGCCTAGTTTATGTCCCCGGTGGGGCACACAGCGGGGGGCGCCAGGTTTTCCTTGTCCCCCAG

>In-frame_ORMDL3_ENST00000304046_chr17_38080283_-_PPP1R1B_ENST00000579000_chr17_37785423_+_1506nt
GATTCGGCCGGAGCTGCCAGCGGGGAGGCTGCAGCCGCGGGTTGTTACAGCTGCTGGAGCAGCAGCGGCCCCCGCTCCCGGGAACCGTTC
CCGGGCCGTTGATCTTCGGCCCCACACGAACAGCAGAGAGGGGCAGCAGGATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACA
CGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATCGGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGA
GTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAG
AGCACTCCTCACCAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGG
ATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGG
ACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCC
CACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGGGGAGGAACCTCAGC
GCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGTGGAGGGGACATCGCTGTTCCCCAGAAACCCA
CTCTATCCTCACCCTGTTTTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGACTTCTAGAAGACTAAGGCTGGTCTGTGTTTGC
TTGTTTGCCCACCTTTGGCTGATACCCAGAGAACCTGGGCACTTGCTGCCTGATGCCCACCCCTGCCAGTCATTCCTCCATTCACCCAGC
GGGAGGTGGGATGTGAGACAGCCCACATTGGAAAATCCAGAAAACCGGGAACAGGGATTTGCCCTTCACAATTCTACTCCCCAGATCCTC
TCCCCTGGACACAGGAGACCCACAGGGCAGGACCCTAAGATCTGGGGAAAGGAGGTCCTGAGAACCTTGAGGTACCCTTAGATCCTTTTC
TACCCACTTTCCTATGGAGGATTCCAAGTCACCACTTCTCTCACCGGCTTCTACCAGGGTCCAGGACTAAGGCGTTTTTCTCCATAGCCT
CAACATTTTGGGAATCTTCCCTTAATCACCCTTGCTCCTCCTGGGTGCCTGGAAGATGGACTGGCAGAGACCTCTTTGTTGCGTTTTGTG
CTTTGATGCCAGGAATGCCGCCTAGTTTATGTCCCCGGTGGGGCACACAGCGGGGGGCGCCAGGTTTTCCTTGTCCCCCAGCTGCTCTGC

>In-frame_ORMDL3_ENST00000394169_chr17_38080283_-_PPP1R1B_ENST00000580825_chr17_37785423_+_2338nt
GTGCTCCTCTTCCAGAAGACAGGAGGTTTGCTGTTGTGAGGGCTGCTCTTTCCTGGGGGAGGGAATGGGAAGGGCTCACCTGGTGGCTGC
CCTGGTGGTGCTCAGCCTTGGCTTGAGTGTCTGGCATACTGGCTGGGCCCGGATATTTGTATGTGGAGCCAAGAGGGTGGGGCGGGAAGG
AGGGGGAAAGAGCTACCAGCAAAAAAGTGGTTAACACAACAGAGTTGCTGCAGGCTCTGGTTTGAGGCAGGTTATGAAACCACATCAGGG
CCCAGCACTAAGCAGCCACCTGCCAGCTATGGCAGCAGAAGTTTTCGGCTCAACTCCTGTAGACCTAGTCGACCTCTGCCAGCCTCTTCT
CTCTGTTTCTCCCCATCTAGGGTAGGGGCCAGTTGGTTGTTTTACTAATGGAAGTGATATGTATCCATAGTCACACGAAAGTCTCAAGAG
TGTTTCCTCATTGCCAGTCTTTTTGTTAGTTTATTGATCTCTTCTTTTTCAGGGGTCTCTGGTGGTTTCCTGCTCTCAGGGCACCTAGTG
TTTAGGCTTCAGGAAGAAGCTTCTGAGGGTGTTGGCTAGGACCTAGGTCTAGGCTTTTCCTAGGCTCATCAAGTTTTGTTGGCTGCCCTG
TGAAAGCCAGAAAGGCGTATGGGGTCCTGTGATCTGGGATTCCCCAAGGCTTTTGGCACTCCTGGACAAATACTAGGAAGGGTTAGTGGA
CTTTCTATACCAGCACCCCTGTAGGTGCGGGTTACAGAGAGGTGATGGGGTGGCAGTTTCAGGTCAGACTTGGGAAGCTCTTTCCCTCTC
CTTAGTCAGAGTTAAGTCCTTCAGAGCCCTCACTTGTCAGCCACATGCCGCCCTCCCCTCTCAGGTGGAGGCTTTTGCGTAGCAGCTGTC
CCAGGGGCTGCTAGAGTAACTGAAGCCCCAAGGCCCTGGGAAGATAAACAATCTGAGCCAGCTCTGGCTTTCTAGATACTTGAATTTCTG
TTAGGCTCAATTATCCAGCCTAGTGGGCTGCGCTGATGGGTCCCAGGAGCATCTCTTCAATCAGAATGCGCCCCAGGCTGGCGCACGGGT
GTTTGCTTGTTGGGATGGCGTGTTGTGGGTCACATTTTCTCTGAGGTCTCTAAGCTTGGAGCTGTCTGAGAAGAGGAAACTTGCTCCTGT
TATCCTGGAAGTAAATAACTGGCCCCTGAGGACTCAGTCTCCTGTGCAGGGCCCTCAGGGATCTGGGGACAGCCAAACTCTGGATAAGGG
GCAGATCATTCCACCCCTTCCTTCTCTACTTCCCTCTGCTCACTGTGGGTTGCGGCCACCTCCTGGTTCCTCCTGCTGCAGGACTCCTAC
CGTTGGTGCTGGGCAGGGGAAGGCATGGTGCTAATATACACCTGGAAACAGGTGCTGAGAGGGGAGACTGAGTCCTCCTAAGTTGGGGTT
TGGGGAGATCCAGAATTGAAAAAATCAGAGGAGAACAGCAGAGAGGGGCAGCAGGATGAATGTGGGCACAGCGCACAGCGAGGTGAACCC
CAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATCGGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTT
TGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCT
CTCAGAGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGAGAGGGGCACCATCTCAAGTCGAAGAGACCCAACCC
CTGTGCCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGC
CTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGA
GGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGG
GCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGG
GGAGGAACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGTGGAGGGGACATCGCTGT

>In-frame_ORMDL3_ENST00000394169_chr17_38080283_-_PPP1R1B_ENST00000254079_chr17_37785423_+_2964nt
GTGCTCCTCTTCCAGAAGACAGGAGGTTTGCTGTTGTGAGGGCTGCTCTTTCCTGGGGGAGGGAATGGGAAGGGCTCACCTGGTGGCTGC
CCTGGTGGTGCTCAGCCTTGGCTTGAGTGTCTGGCATACTGGCTGGGCCCGGATATTTGTATGTGGAGCCAAGAGGGTGGGGCGGGAAGG
AGGGGGAAAGAGCTACCAGCAAAAAAGTGGTTAACACAACAGAGTTGCTGCAGGCTCTGGTTTGAGGCAGGTTATGAAACCACATCAGGG
CCCAGCACTAAGCAGCCACCTGCCAGCTATGGCAGCAGAAGTTTTCGGCTCAACTCCTGTAGACCTAGTCGACCTCTGCCAGCCTCTTCT
CTCTGTTTCTCCCCATCTAGGGTAGGGGCCAGTTGGTTGTTTTACTAATGGAAGTGATATGTATCCATAGTCACACGAAAGTCTCAAGAG
TGTTTCCTCATTGCCAGTCTTTTTGTTAGTTTATTGATCTCTTCTTTTTCAGGGGTCTCTGGTGGTTTCCTGCTCTCAGGGCACCTAGTG
TTTAGGCTTCAGGAAGAAGCTTCTGAGGGTGTTGGCTAGGACCTAGGTCTAGGCTTTTCCTAGGCTCATCAAGTTTTGTTGGCTGCCCTG
TGAAAGCCAGAAAGGCGTATGGGGTCCTGTGATCTGGGATTCCCCAAGGCTTTTGGCACTCCTGGACAAATACTAGGAAGGGTTAGTGGA
CTTTCTATACCAGCACCCCTGTAGGTGCGGGTTACAGAGAGGTGATGGGGTGGCAGTTTCAGGTCAGACTTGGGAAGCTCTTTCCCTCTC
CTTAGTCAGAGTTAAGTCCTTCAGAGCCCTCACTTGTCAGCCACATGCCGCCCTCCCCTCTCAGGTGGAGGCTTTTGCGTAGCAGCTGTC
CCAGGGGCTGCTAGAGTAACTGAAGCCCCAAGGCCCTGGGAAGATAAACAATCTGAGCCAGCTCTGGCTTTCTAGATACTTGAATTTCTG
TTAGGCTCAATTATCCAGCCTAGTGGGCTGCGCTGATGGGTCCCAGGAGCATCTCTTCAATCAGAATGCGCCCCAGGCTGGCGCACGGGT
GTTTGCTTGTTGGGATGGCGTGTTGTGGGTCACATTTTCTCTGAGGTCTCTAAGCTTGGAGCTGTCTGAGAAGAGGAAACTTGCTCCTGT
TATCCTGGAAGTAAATAACTGGCCCCTGAGGACTCAGTCTCCTGTGCAGGGCCCTCAGGGATCTGGGGACAGCCAAACTCTGGATAAGGG
GCAGATCATTCCACCCCTTCCTTCTCTACTTCCCTCTGCTCACTGTGGGTTGCGGCCACCTCCTGGTTCCTCCTGCTGCAGGACTCCTAC
CGTTGGTGCTGGGCAGGGGAAGGCATGGTGCTAATATACACCTGGAAACAGGTGCTGAGAGGGGAGACTGAGTCCTCCTAAGTTGGGGTT
TGGGGAGATCCAGAATTGAAAAAATCAGAGGAGAACAGCAGAGAGGGGCAGCAGGATGAATGTGGGCACAGCGCACAGCGAGGTGAACCC
CAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATCGGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTT
TGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCT
CTCAGAGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGAGAGGGGCACCATCTCAAGTCGAAGAGACCCAACCC
CTGTGCCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGC
CTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGA
GGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGG
GCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGG
GGAGGAACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGTGGAGGGGACATCGCTGT
TCCCCAGAAACCCACTCTATCCTCACCCTGTTTTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGACTTCTAGAAGACTAAGGC
TGGTCTGTGTTTGCTTGTTTGCCCACCTTTGGCTGATACCCAGAGAACCTGGGCACTTGCTGCCTGATGCCCACCCCTGCCAGTCATTCC
TCCATTCACCCAGCGGGAGGTGGGATGTGAGACAGCCCACATTGGAAAATCCAGAAAACCGGGAACAGGGATTTGCCCTTCACAATTCTA
CTCCCCAGATCCTCTCCCCTGGACACAGGAGACCCACAGGGCAGGACCCTAAGATCTGGGGAAAGGAGGTCCTGAGAACCTTGAGGTACC
CTTAGATCCTTTTCTACCCACTTTCCTATGGAGGATTCCAAGTCACCACTTCTCTCACCGGCTTCTACCAGGGTCCAGGACTAAGGCGTT
TTTCTCCATAGCCTCAACATTTTGGGAATCTTCCCTTAATCACCCTTGCTCCTCCTGGGTGCCTGGAAGATGGACTGGCAGAGACCTCTT
TGTTGCGTTTTGTGCTTTGATGCCAGGAATGCCGCCTAGTTTATGTCCCCGGTGGGGCACACAGCGGGGGGCGCCAGGTTTTCCTTGTCC

>In-frame_ORMDL3_ENST00000394169_chr17_38080283_-_PPP1R1B_ENST00000579000_chr17_37785423_+_2861nt
GTGCTCCTCTTCCAGAAGACAGGAGGTTTGCTGTTGTGAGGGCTGCTCTTTCCTGGGGGAGGGAATGGGAAGGGCTCACCTGGTGGCTGC
CCTGGTGGTGCTCAGCCTTGGCTTGAGTGTCTGGCATACTGGCTGGGCCCGGATATTTGTATGTGGAGCCAAGAGGGTGGGGCGGGAAGG
AGGGGGAAAGAGCTACCAGCAAAAAAGTGGTTAACACAACAGAGTTGCTGCAGGCTCTGGTTTGAGGCAGGTTATGAAACCACATCAGGG
CCCAGCACTAAGCAGCCACCTGCCAGCTATGGCAGCAGAAGTTTTCGGCTCAACTCCTGTAGACCTAGTCGACCTCTGCCAGCCTCTTCT
CTCTGTTTCTCCCCATCTAGGGTAGGGGCCAGTTGGTTGTTTTACTAATGGAAGTGATATGTATCCATAGTCACACGAAAGTCTCAAGAG
TGTTTCCTCATTGCCAGTCTTTTTGTTAGTTTATTGATCTCTTCTTTTTCAGGGGTCTCTGGTGGTTTCCTGCTCTCAGGGCACCTAGTG
TTTAGGCTTCAGGAAGAAGCTTCTGAGGGTGTTGGCTAGGACCTAGGTCTAGGCTTTTCCTAGGCTCATCAAGTTTTGTTGGCTGCCCTG
TGAAAGCCAGAAAGGCGTATGGGGTCCTGTGATCTGGGATTCCCCAAGGCTTTTGGCACTCCTGGACAAATACTAGGAAGGGTTAGTGGA
CTTTCTATACCAGCACCCCTGTAGGTGCGGGTTACAGAGAGGTGATGGGGTGGCAGTTTCAGGTCAGACTTGGGAAGCTCTTTCCCTCTC
CTTAGTCAGAGTTAAGTCCTTCAGAGCCCTCACTTGTCAGCCACATGCCGCCCTCCCCTCTCAGGTGGAGGCTTTTGCGTAGCAGCTGTC
CCAGGGGCTGCTAGAGTAACTGAAGCCCCAAGGCCCTGGGAAGATAAACAATCTGAGCCAGCTCTGGCTTTCTAGATACTTGAATTTCTG
TTAGGCTCAATTATCCAGCCTAGTGGGCTGCGCTGATGGGTCCCAGGAGCATCTCTTCAATCAGAATGCGCCCCAGGCTGGCGCACGGGT
GTTTGCTTGTTGGGATGGCGTGTTGTGGGTCACATTTTCTCTGAGGTCTCTAAGCTTGGAGCTGTCTGAGAAGAGGAAACTTGCTCCTGT
TATCCTGGAAGTAAATAACTGGCCCCTGAGGACTCAGTCTCCTGTGCAGGGCCCTCAGGGATCTGGGGACAGCCAAACTCTGGATAAGGG
GCAGATCATTCCACCCCTTCCTTCTCTACTTCCCTCTGCTCACTGTGGGTTGCGGCCACCTCCTGGTTCCTCCTGCTGCAGGACTCCTAC
CGTTGGTGCTGGGCAGGGGAAGGCATGGTGCTAATATACACCTGGAAACAGGTGCTGAGAGGGGAGACTGAGTCCTCCTAAGTTGGGGTT
TGGGGAGATCCAGAATTGAAAAAATCAGAGGAGAACAGCAGAGAGGGGCAGCAGGATGAATGTGGGCACAGCGCACAGCGAGGTGAACCC
CAACACGCGGGTGATGAACAGCCGTGGCATCTGGCTCTCCTACGTGCTGGCCATCGGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTT
TGTGAGTGTCCCTGTCGTCTGGACCCTCACCAACCTCATTCACAACATGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCT
CTCAGAGCACTCCTCACCAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGA
GGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGA
AGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGA
GCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGGGGAGGAACC
TCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGTGGAGGGGACATCGCTGTTCCCCAGAA
ACCCACTCTATCCTCACCCTGTTTTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGACTTCTAGAAGACTAAGGCTGGTCTGTG
TTTGCTTGTTTGCCCACCTTTGGCTGATACCCAGAGAACCTGGGCACTTGCTGCCTGATGCCCACCCCTGCCAGTCATTCCTCCATTCAC
CCAGCGGGAGGTGGGATGTGAGACAGCCCACATTGGAAAATCCAGAAAACCGGGAACAGGGATTTGCCCTTCACAATTCTACTCCCCAGA
TCCTCTCCCCTGGACACAGGAGACCCACAGGGCAGGACCCTAAGATCTGGGGAAAGGAGGTCCTGAGAACCTTGAGGTACCCTTAGATCC
TTTTCTACCCACTTTCCTATGGAGGATTCCAAGTCACCACTTCTCTCACCGGCTTCTACCAGGGTCCAGGACTAAGGCGTTTTTCTCCAT
AGCCTCAACATTTTGGGAATCTTCCCTTAATCACCCTTGCTCCTCCTGGGTGCCTGGAAGATGGACTGGCAGAGACCTCTTTGTTGCGTT
TTGTGCTTTGATGCCAGGAATGCCGCCTAGTTTATGTCCCCGGTGGGGCACACAGCGGGGGGCGCCAGGTTTTCCTTGTCCCCCAGCTGC


Top

FusionGenePPI for ORMDL3_PPP1R1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ORMDL3EEF1A1, SPTLC1, ELAVL1, LNX1, APP, TCTN3, SLC1A1, SLC22A9, SPRY4, SLC2A12, PTPN11, LMNAPPP1R1BDLGAP4, CSNK2A1, PPP1CC, PPP1CA, TFCP2, KLHL6, ACTBL2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ORMDL3_PPP1R1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ORMDL3_PPP1R1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneORMDL3C0004096Asthma2CTD_human
HgeneORMDL3C0009324Ulcerative Colitis1CTD_human
TgenePPP1R1BC0036341Schizophrenia5PSYGENET
TgenePPP1R1BC0005586Bipolar Disorder4PSYGENET
TgenePPP1R1BC0001973Alcoholic Intoxication, Chronic1PSYGENET
TgenePPP1R1BC0007370Catalepsy1CTD_human
TgenePPP1R1BC0011570Mental Depression1PSYGENET
TgenePPP1R1BC0011581Depressive disorder1PSYGENET
TgenePPP1R1BC0013384Dyskinetic syndrome1CTD_human