FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25301

FusionGeneSummary for NXN_WRAP53

check button Fusion gene summary
Fusion gene informationFusion gene name: NXN_WRAP53
Fusion gene ID: 25301
HgeneTgene
Gene symbol

NXN

WRAP53

Gene ID

64359

55135

Gene namenucleoredoxinWD repeat containing antisense to TP53
SynonymsNRX|TRG-4DKCB3|TCAB1|WDR79
Cytomap

17p13.3

17p13.1

Type of geneprotein-codingprotein-coding
Descriptionnucleoredoxinnucleoredoxin 1telomerase Cajal body protein 1WD repeat-containing protein 79WD repeat-containing protein WRAP53WD40 protein Wrap53WD40 repeat-containing protein antisense to TP53WD40 repeat-containing protein encoding RNA antisense to p53
Modification date2018051920180519
UniProtAcc

Q6DKJ4

Q9BUR4

Ensembl transtripts involved in fusion geneENST00000336868, ENST00000577098, 
ENST00000575801, ENST00000538650, 
ENST00000537628, 
ENST00000431639, 
ENST00000316024, ENST00000457584, 
ENST00000396463, ENST00000534050, 
Fusion gene scores* DoF score9 X 5 X 7=3159 X 4 X 5=180
# samples 129
** MAII scorelog2(12/315*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/180*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NXN [Title/Abstract] AND WRAP53 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneWRAP53

GO:0007004

telomere maintenance via telomerase

23685356

TgeneWRAP53

GO:0051973

positive regulation of telomerase activity

19179534|23685356


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-CQ-7065-01ANXNchr17

882559

-WRAP53chr17

7604059

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000336868ENST00000431639NXNchr17

882559

-WRAP53chr17

7604059

+
In-frameENST00000336868ENST00000316024NXNchr17

882559

-WRAP53chr17

7604059

+
In-frameENST00000336868ENST00000457584NXNchr17

882559

-WRAP53chr17

7604059

+
In-frameENST00000336868ENST00000396463NXNchr17

882559

-WRAP53chr17

7604059

+
In-frameENST00000336868ENST00000534050NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000577098ENST00000431639NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000577098ENST00000316024NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000577098ENST00000457584NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000577098ENST00000396463NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000577098ENST00000534050NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000575801ENST00000431639NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000575801ENST00000316024NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000575801ENST00000457584NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000575801ENST00000396463NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000575801ENST00000534050NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000538650ENST00000431639NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000538650ENST00000316024NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000538650ENST00000457584NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000538650ENST00000396463NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000538650ENST00000534050NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000537628ENST00000431639NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000537628ENST00000316024NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000537628ENST00000457584NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000537628ENST00000396463NXNchr17

882559

-WRAP53chr17

7604059

+
intron-3CDSENST00000537628ENST00000534050NXNchr17

882559

-WRAP53chr17

7604059

+

Top

FusionProtFeatures for NXN_WRAP53


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NXN

Q6DKJ4

WRAP53

Q9BUR4

Functions as a redox-dependent negative regulator of theWnt signaling pathway, possibly by preventing ubiquitination ofDVL3 by the BCR(KLHL12) complex. May also function as atranscriptional regulator act as a regulator of proteinphosphatase 2A (PP2A) (By similarity). {ECO:0000250}. Essential component of the telomerase holoenzymecomplex, a ribonucleoprotein complex essential for the replicationof chromosome termini that elongates telomeres in most eukaryotes.In the telomerase holoenzyme complex, it controls telomeraselocalization to Cajal body. Required for delivery of TERC totelomeres during S phase and for telomerase activity. Binds smallCajal body RNAs (scaRNAs). The mRNA encoding this protein plays acritical role in the regulation of p53 expression at the post-transcriptional level; it is involved both in maintaining basalp53 mRNA levels and in p53 induction upon DNA damage.{ECO:0000269|PubMed:19179534, ECO:0000269|PubMed:19250907}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneWRAP53chr17:882559chr17:7604059ENST00000316024+210222_267214549RepeatNote=WD 2
TgeneWRAP53chr17:882559chr17:7604059ENST00000316024+210272_313214549RepeatNote=WD 3
TgeneWRAP53chr17:882559chr17:7604059ENST00000316024+210323_364214549RepeatNote=WD 4
TgeneWRAP53chr17:882559chr17:7604059ENST00000316024+210365_405214549RepeatNote=WD 5
TgeneWRAP53chr17:882559chr17:7604059ENST00000316024+210411_450214549RepeatNote=WD 6
TgeneWRAP53chr17:882559chr17:7604059ENST00000396463+311222_267214549RepeatNote=WD 2
TgeneWRAP53chr17:882559chr17:7604059ENST00000396463+311272_313214549RepeatNote=WD 3
TgeneWRAP53chr17:882559chr17:7604059ENST00000396463+311323_364214549RepeatNote=WD 4
TgeneWRAP53chr17:882559chr17:7604059ENST00000396463+311365_405214549RepeatNote=WD 5
TgeneWRAP53chr17:882559chr17:7604059ENST00000396463+311411_450214549RepeatNote=WD 6
TgeneWRAP53chr17:882559chr17:7604059ENST00000431639+311222_267214549RepeatNote=WD 2
TgeneWRAP53chr17:882559chr17:7604059ENST00000431639+311272_313214549RepeatNote=WD 3
TgeneWRAP53chr17:882559chr17:7604059ENST00000431639+311323_364214549RepeatNote=WD 4
TgeneWRAP53chr17:882559chr17:7604059ENST00000431639+311365_405214549RepeatNote=WD 5
TgeneWRAP53chr17:882559chr17:7604059ENST00000431639+311411_450214549RepeatNote=WD 6
TgeneWRAP53chr17:882559chr17:7604059ENST00000457584+311222_267214549RepeatNote=WD 2
TgeneWRAP53chr17:882559chr17:7604059ENST00000457584+311272_313214549RepeatNote=WD 3
TgeneWRAP53chr17:882559chr17:7604059ENST00000457584+311323_364214549RepeatNote=WD 4
TgeneWRAP53chr17:882559chr17:7604059ENST00000457584+311365_405214549RepeatNote=WD 5
TgeneWRAP53chr17:882559chr17:7604059ENST00000457584+311411_450214549RepeatNote=WD 6

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNXNchr17:882559chr17:7604059ENST00000336868-18167_321120436DomainThioredoxin
HgeneNXNchr17:882559chr17:7604059ENST00000537628-18167_321-200187DomainThioredoxin
HgeneNXNchr17:882559chr17:7604059ENST00000575801-18167_321-21328DomainThioredoxin
TgeneWRAP53chr17:882559chr17:7604059ENST00000316024+2108_57214549Compositional biasNote=Pro-rich
TgeneWRAP53chr17:882559chr17:7604059ENST00000396463+3118_57214549Compositional biasNote=Pro-rich
TgeneWRAP53chr17:882559chr17:7604059ENST00000431639+3118_57214549Compositional biasNote=Pro-rich
TgeneWRAP53chr17:882559chr17:7604059ENST00000457584+3118_57214549Compositional biasNote=Pro-rich
TgeneWRAP53chr17:882559chr17:7604059ENST00000316024+210167_206214549RepeatNote=WD 1
TgeneWRAP53chr17:882559chr17:7604059ENST00000396463+311167_206214549RepeatNote=WD 1
TgeneWRAP53chr17:882559chr17:7604059ENST00000431639+311167_206214549RepeatNote=WD 1
TgeneWRAP53chr17:882559chr17:7604059ENST00000457584+311167_206214549RepeatNote=WD 1


Top

FusionGeneSequence for NXN_WRAP53


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000431639_chr17_7604059_+_455aa
MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGPGAGAGAAAEPEPRRRLEIVF
VSSDQDQRQWQDFVRDMPWLALPYKEKHRKVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHL
DELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLG
GHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPV
LSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGV

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000316024_chr17_7604059_+_455aa
MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGPGAGAGAAAEPEPRRRLEIVF
VSSDQDQRQWQDFVRDMPWLALPYKEKHRKVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHL
DELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLG
GHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPV
LSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGV

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000457584_chr17_7604059_+_455aa
MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGPGAGAGAAAEPEPRRRLEIVF
VSSDQDQRQWQDFVRDMPWLALPYKEKHRKVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHL
DELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLG
GHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPV
LSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGV

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000396463_chr17_7604059_+_455aa
MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGPGAGAGAAAEPEPRRRLEIVF
VSSDQDQRQWQDFVRDMPWLALPYKEKHRKVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHL
DELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLG
GHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPV
LSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGV

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000534050_chr17_7604059_+_455aa
MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGPGAGAGAAAEPEPRRRLEIVF
VSSDQDQRQWQDFVRDMPWLALPYKEKHRKVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHL
DELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLG
GHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPV
LSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000431639_chr17_7604059_+_1365nt
ATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCGGC
ATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCCTG
CGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCTTC
GTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGAAG
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000316024_chr17_7604059_+_1365nt
ATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCGGC
ATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCCTG
CGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCTTC
GTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGAAG
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000457584_chr17_7604059_+_1365nt
ATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCGGC
ATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCCTG
CGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCTTC
GTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGAAG
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000396463_chr17_7604059_+_1365nt
ATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCGGC
ATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCCTG
CGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCTTC
GTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGAAG
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000534050_chr17_7604059_+_1365nt
ATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCGGC
ATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCCTG
CGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCTTC
GTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGAAG
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000431639_chr17_7604059_+_1473nt
CCCAGCGCCTGCCGCCGACGCCGCCGCCTCCTCCCGCCGCGCGGACCGTGGAGCGGGGTCGCAGCCGCCTGCCCGCCCTGCGGTGGGCCA
GGATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCG
GCATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCC
TGCGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCT
TCGTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGA
AGGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCT
ACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACC
TGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTT
CCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCA
GCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGG
GAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGT
GCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGA
CCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCG
TGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTG
TGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGC
TTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTG

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000316024_chr17_7604059_+_1473nt
CCCAGCGCCTGCCGCCGACGCCGCCGCCTCCTCCCGCCGCGCGGACCGTGGAGCGGGGTCGCAGCCGCCTGCCCGCCCTGCGGTGGGCCA
GGATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCG
GCATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCC
TGCGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCT
TCGTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGA
AGGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCT
ACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACC
TGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTT
CCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCA
GCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGG
GAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGT
GCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGA
CCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCG
TGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTG
TGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGC
TTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTG

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000457584_chr17_7604059_+_1473nt
CCCAGCGCCTGCCGCCGACGCCGCCGCCTCCTCCCGCCGCGCGGACCGTGGAGCGGGGTCGCAGCCGCCTGCCCGCCCTGCGGTGGGCCA
GGATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCG
GCATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCC
TGCGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCT
TCGTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGA
AGGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCT
ACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACC
TGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTT
CCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCA
GCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGG
GAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGT
GCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGA
CCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCG
TGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTG
TGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGC
TTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTG

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000396463_chr17_7604059_+_1473nt
CCCAGCGCCTGCCGCCGACGCCGCCGCCTCCTCCCGCCGCGCGGACCGTGGAGCGGGGTCGCAGCCGCCTGCCCGCCCTGCGGTGGGCCA
GGATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCG
GCATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCC
TGCGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCT
TCGTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGA
AGGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCT
ACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACC
TGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTT
CCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCA
GCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGG
GAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGT
GCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGA
CCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCG
TGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTG
TGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGC
TTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTG

>In-frame_NXN_ENST00000336868_chr17_882559_-_WRAP53_ENST00000534050_chr17_7604059_+_1473nt
CCCAGCGCCTGCCGCCGACGCCGCCGCCTCCTCCCGCCGCGCGGACCGTGGAGCGGGGTCGCAGCCGCCTGCCCGCCCTGCGGTGGGCCA
GGATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAGGTGGACGTGCACTCGCTGGGCGCCCGCG
GCATCTCGCTGCTGGGTCTCTACTTCGGCTGCAGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCC
TGCGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCCGAGCCGCGGCGGCGCCTGGAGATCGTCT
TCGTGTCCTCGGACCAGGACCAGCGGCAGTGGCAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGA
AGGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCT
ACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACC
TGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTT
CCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCA
GCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGG
GAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGT
GCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGA
CCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCG
TGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTG
TGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGC
TTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTG


Top

FusionGenePPI for NXN_WRAP53


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NXNCHMP6, USP3, ELAVL1, C9orf9, GAS2L1, ARRDC1, CRY2, DUSP4, DVL3, CGB2, GORASP1, CDH23, NCKAP1, ABI1, WASF1, TRIM25WRAP53PRPF4, PTGES3, XPC, WAPAL, SNRPC, USP11, TNPO1, RBBP7, GAR1, FAM43A, MDC1, RNF8, H2AFX, HNRNPU, ZFHX3, CCT6A, DKC1, MYBPH, NDUFV3, TCP1, CCT3, STK24, CCT7, CCT4, CCT2, CCT8, CCT5, PRPF38B, PTPN1, RAP1B, RXRB, POLG2, CNTROB, MRPL14, KIAA1683, LYPD4, CRYL1, ARHGAP25, FAM46A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NXN_WRAP53


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NXN_WRAP53


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNXNC0009404Colorectal Neoplasms1CTD_human
TgeneWRAP53C3151442DYSKERATOSIS CONGENITA, AUTOSOMAL RECESSIVE, 31UNIPROT