FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25229

FusionGeneSummary for NUP214_TOM1L2

check button Fusion gene summary
Fusion gene informationFusion gene name: NUP214_TOM1L2
Fusion gene ID: 25229
HgeneTgene
Gene symbol

NUP214

TOM1L2

Gene ID

8021

146691

Gene namenucleoporin 214target of myb1 like 2 membrane trafficking protein
SynonymsCAIN|CAN-
Cytomap

9q34.13

17p11.2

Type of geneprotein-codingprotein-coding
Descriptionnuclear pore complex protein Nup214CAN protein, putative oncogenenucleoporin 214kDaTOM1-like protein 2target of Myb-like protein 2target of myb1-like 2
Modification date2018052320180519
UniProtAcc

P35658

Q6ZVM7

Ensembl transtripts involved in fusion geneENST00000359428, ENST00000411637, 
ENST00000451030, ENST00000483497, 
ENST00000465486, 
ENST00000581396, 
ENST00000379504, ENST00000318094, 
ENST00000395739, ENST00000535933, 
ENST00000540946, ENST00000542206, 
ENST00000478943, ENST00000577517, 
Fusion gene scores* DoF score11 X 11 X 4=4846 X 5 X 4=120
# samples 116
** MAII scorelog2(11/484*10)=-2.13750352374993
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NUP214 [Title/Abstract] AND TOM1L2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTOM1L2

GO:0007165

signal transduction

16479011

TgeneTOM1L2

GO:0045839

negative regulation of mitotic nuclear division

16479011


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A135-01ANUP214chr9

134072803

+TOM1L2chr17

17810845

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000359428ENST00000581396NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000359428ENST00000379504NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000359428ENST00000318094NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000359428ENST00000395739NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000359428ENST00000535933NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000359428ENST00000540946NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000359428ENST00000542206NUP214chr9

134072803

+TOM1L2chr17

17810845

-
5CDS-intronENST00000359428ENST00000478943NUP214chr9

134072803

+TOM1L2chr17

17810845

-
5CDS-intronENST00000359428ENST00000577517NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000411637ENST00000581396NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000411637ENST00000379504NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000411637ENST00000318094NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000411637ENST00000395739NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000411637ENST00000535933NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000411637ENST00000540946NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000411637ENST00000542206NUP214chr9

134072803

+TOM1L2chr17

17810845

-
5CDS-intronENST00000411637ENST00000478943NUP214chr9

134072803

+TOM1L2chr17

17810845

-
5CDS-intronENST00000411637ENST00000577517NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000451030ENST00000581396NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000451030ENST00000379504NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000451030ENST00000318094NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000451030ENST00000395739NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000451030ENST00000535933NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000451030ENST00000540946NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000451030ENST00000542206NUP214chr9

134072803

+TOM1L2chr17

17810845

-
5CDS-intronENST00000451030ENST00000478943NUP214chr9

134072803

+TOM1L2chr17

17810845

-
5CDS-intronENST00000451030ENST00000577517NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000483497ENST00000581396NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000483497ENST00000379504NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000483497ENST00000318094NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000483497ENST00000395739NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000483497ENST00000535933NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000483497ENST00000540946NUP214chr9

134072803

+TOM1L2chr17

17810845

-
In-frameENST00000483497ENST00000542206NUP214chr9

134072803

+TOM1L2chr17

17810845

-
5CDS-intronENST00000483497ENST00000478943NUP214chr9

134072803

+TOM1L2chr17

17810845

-
5CDS-intronENST00000483497ENST00000577517NUP214chr9

134072803

+TOM1L2chr17

17810845

-
3UTR-3CDSENST00000465486ENST00000581396NUP214chr9

134072803

+TOM1L2chr17

17810845

-
3UTR-3CDSENST00000465486ENST00000379504NUP214chr9

134072803

+TOM1L2chr17

17810845

-
3UTR-3CDSENST00000465486ENST00000318094NUP214chr9

134072803

+TOM1L2chr17

17810845

-
3UTR-3CDSENST00000465486ENST00000395739NUP214chr9

134072803

+TOM1L2chr17

17810845

-
3UTR-3CDSENST00000465486ENST00000535933NUP214chr9

134072803

+TOM1L2chr17

17810845

-
3UTR-3CDSENST00000465486ENST00000540946NUP214chr9

134072803

+TOM1L2chr17

17810845

-
3UTR-3CDSENST00000465486ENST00000542206NUP214chr9

134072803

+TOM1L2chr17

17810845

-
3UTR-intronENST00000465486ENST00000478943NUP214chr9

134072803

+TOM1L2chr17

17810845

-
3UTR-intronENST00000465486ENST00000577517NUP214chr9

134072803

+TOM1L2chr17

17810845

-

Top

FusionProtFeatures for NUP214_TOM1L2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NUP214

P35658

TOM1L2

Q6ZVM7

May serve as a docking site in the receptor-mediatedimport of substrates across the nuclear pore complex.{ECO:0000303|PubMed:8108440}. Probable role in protein transport. May regulate growthfactor-induced mitogenic signaling. {ECO:0000269|PubMed:16412388,ECO:0000269|PubMed:16479011}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000318094-01420_15217463DomainVHS
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000318094-014219_30717463DomainGAT
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000379504-01520_15217508DomainVHS
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000379504-015219_30717508DomainGAT
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000395739-01420_15217463DomainVHS
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000395739-014219_30717463DomainGAT
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000478943-0920_152-189241DomainVHS
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000478943-09219_307-189241DomainGAT
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000581396-01420_15217458DomainVHS
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000581396-014219_30717458DomainGAT
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000318094-014329_33417463MotifNote=Clathrin-binding
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000379504-015329_33417508MotifNote=Clathrin-binding
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000395739-014329_33417463MotifNote=Clathrin-binding
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000478943-09329_334-189241MotifNote=Clathrin-binding
TgeneTOM1L2chr9:134072803chr17:17810845ENST00000581396-014329_33417458MotifNote=Clathrin-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+136680_1209-482091Coiled coilOntology_term=ECO:0000269
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+136680_1209-402081Coiled coilOntology_term=ECO:0000269
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+136680_1209-372092Coiled coilOntology_term=ECO:0000269
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+1361213_2090-482091Compositional biasNote=Pro/Ser/Thr-rich
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+1361213_2090-402081Compositional biasNote=Pro/Ser/Thr-rich
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+1361213_2090-372092Compositional biasNote=Pro/Ser/Thr-rich
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+1361409_2084-482091RegionNote=18 X 4 AA approximate repeats
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+1361427_2085-482091RegionNote=11 X 3 AA approximate repeats
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+13641_404-482091RegionNote=Seven-bladed beta propeller
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+136481_2076-482091RegionNote=11 X 5 AA approximate repeats
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+136740_768-482091RegionNote=Leucine-zipper 1
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+136861_882-482091RegionNote=Leucine-zipper 2
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+1361409_2084-402081RegionNote=18 X 4 AA approximate repeats
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+1361427_2085-402081RegionNote=11 X 3 AA approximate repeats
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+13641_404-402081RegionNote=Seven-bladed beta propeller
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+136481_2076-402081RegionNote=11 X 5 AA approximate repeats
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+136740_768-402081RegionNote=Leucine-zipper 1
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+136861_882-402081RegionNote=Leucine-zipper 2
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+1361409_2084-372092RegionNote=18 X 4 AA approximate repeats
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+1361427_2085-372092RegionNote=11 X 3 AA approximate repeats
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+13641_404-372092RegionNote=Seven-bladed beta propeller
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+136481_2076-372092RegionNote=11 X 5 AA approximate repeats
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+136740_768-372092RegionNote=Leucine-zipper 1
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+136861_882-372092RegionNote=Leucine-zipper 2
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+136151_193-482091RepeatNote=Blade 3
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+136194_239-482091RepeatNote=Blade 4
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+136240_303-482091RepeatNote=Blade 5
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+136304_359-482091RepeatNote=Blade 6
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+136360_404-482091RepeatNote=Blade 7
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+13641_93-482091RepeatNote=Blade 1
HgeneNUP214chr9:134072803chr17:17810845ENST00000359428+13694_150-482091RepeatNote=Blade 2
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+136151_193-402081RepeatNote=Blade 3
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+136194_239-402081RepeatNote=Blade 4
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+136240_303-402081RepeatNote=Blade 5
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+136304_359-402081RepeatNote=Blade 6
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+136360_404-402081RepeatNote=Blade 7
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+13641_93-402081RepeatNote=Blade 1
HgeneNUP214chr9:134072803chr17:17810845ENST00000411637+13694_150-402081RepeatNote=Blade 2
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+136151_193-372092RepeatNote=Blade 3
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+136194_239-372092RepeatNote=Blade 4
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+136240_303-372092RepeatNote=Blade 5
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+136304_359-372092RepeatNote=Blade 6
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+136360_404-372092RepeatNote=Blade 7
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+13641_93-372092RepeatNote=Blade 1
HgeneNUP214chr9:134072803chr17:17810845ENST00000451030+13694_150-372092RepeatNote=Blade 2


Top

FusionGeneSequence for NUP214_TOM1L2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_2281aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSV
SQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLIN
SLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
KASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAP
PQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSS
PAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREV
MLALTAWADAFRSSPDLTGVVHITEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAPA
LSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNN
VFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMF
AQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDL

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_2331aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSV
SQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLIN
SLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
KASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAP
PQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSS
PAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREV
MLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHITEELKRKGVEFPMADLD
ALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVP
GQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGS
PAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGI

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_2286aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSV
SQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLIN
SLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
KASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAP
PQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSS
PAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREV
MLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSA
PQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVN
DDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRD
GFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAE

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_2286aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSV
SQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLIN
SLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
KASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAP
PQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSS
PAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREV
MLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSA
PQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVN
DDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRD
GFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAE

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_2307aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSV
SQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLIN
SLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
KASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAP
PQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSS
PAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREV
MLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHITEELKRKGVEFPMADLD
ALSPIHTPQRIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFL
RYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQT
RGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGTFLSSAQKRGRGGESDLEPIDSWLITQGMIPVAQPSVMDDIEVWLRTDLKGDDL

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_2213aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSV
SQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLIN
SLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
KASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAP
PQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSS
PAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREV
MLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDL
ELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMV
GNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGKGDDLEEGV

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_2212aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSV
SQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLIN
SLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
KASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAP
PQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSS
PAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREV
MLALTIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERF
ERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSL
AEQRKTVTTEDPQAVGGLASALDNRKQSSEGTFLSSAQKRGRGGESDLEPIDSWLITQGMIPVAQPSVMDDIEVWLRTDLKGDDLEEGVT

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_2271aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDAR
TSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQ
AAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPA
SGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPE
SSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTST
QPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTV
PPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKE
PVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSA
EAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGV
FGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSP
GFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTAWADA
FRSSPDLTGVVHITEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAPALSVTGPITAN
SEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFER
YRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAE
QRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSPPMEAPAP

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_2321aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDAR
TSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQ
AAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPA
SGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPE
SSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTST
QPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTV
PPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKE
PVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSA
EAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGV
FGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSP
GFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTVLETC
VKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHITEELKRKGVEFPMADLDALSPIHTPQR
SVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLEL
LQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGN
TAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDD

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_2276aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDAR
TSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQ
AAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPA
SGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPE
SSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTST
QPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTV
PPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKE
PVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSA
EAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGV
FGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSP
GFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTVLETC
VKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAPALSVTG
PITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRY
ERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRG
NSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSPPM

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_2276aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDAR
TSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQ
AAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPA
SGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPE
SSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTST
QPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTV
PPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKE
PVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSA
EAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGV
FGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSP
GFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTVLETC
VKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAPALSVTG
PITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRY
ERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRG
NSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSPPM

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_2297aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDAR
TSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQ
AAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPA
SGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPE
SSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTST
QPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTV
PPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKE
PVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSA
EAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGV
FGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSP
GFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTVLETC
VKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHITEELKRKGVEFPMADLDALSPIHTPQR
IARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRS
GRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRK
TVTTEDPQAVGGLASALDNRKQSSEGTFLSSAQKRGRGGESDLEPIDSWLITQGMIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFD

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_2203aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDAR
TSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQ
AAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPA
SGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPE
SSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTST
QPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTV
PPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKE
PVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSA
EAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGV
FGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSP
GFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTVLETC
VKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTC
RAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLS
SQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGKGDDLEEGVTSEEFDKFLE

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_2202aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDAR
TSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQ
AAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPA
SGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPE
SSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTST
QPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTV
PPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKE
PVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSA
EAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGV
FGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSP
GFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTIARLR
SELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQ
NASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTTE
DPQAVGGLASALDNRKQSSEGTFLSSAQKRGRGGESDLEPIDSWLITQGMIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEE

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_2282aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSS
VSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGA
PSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLI
NSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGG
GSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPT
NKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSF
SFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQA
PPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASS
TTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFS
SPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFG
QSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYRE
VMLALTAWADAFRSSPDLTGVVHITEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAP
ALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLN
NVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDM
FAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPD

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_2332aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSS
VSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGA
PSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLI
NSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGG
GSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPT
NKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSF
SFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQA
PPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASS
TTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFS
SPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFG
QSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYRE
VMLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHITEELKRKGVEFPMADL
DALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMV
PGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPG
SPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEG

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_2287aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSS
VSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGA
PSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLI
NSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGG
GSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPT
NKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSF
SFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQA
PPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASS
TTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFS
SPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFG
QSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYRE
VMLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYS
APQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHV
NDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPR
DGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAA

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_2287aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSS
VSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGA
PSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLI
NSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGG
GSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPT
NKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSF
SFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQA
PPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASS
TTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFS
SPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFG
QSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYRE
VMLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYS
APQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHV
NDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPR
DGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAA

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_2308aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSS
VSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGA
PSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLI
NSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGG
GSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPT
NKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSF
SFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQA
PPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASS
TTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFS
SPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFG
QSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYRE
VMLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHITEELKRKGVEFPMADL
DALSPIHTPQRIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVF
LRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQ
TRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGTFLSSAQKRGRGGESDLEPIDSWLITQGMIPVAQPSVMDDIEVWLRTDLKGDD

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_2214aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSS
VSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGA
PSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLI
NSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGG
GSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPT
NKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSF
SFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQA
PPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASS
TTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFS
SPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFG
QSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYRE
VMLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSD
LELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPM
VGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGKGDDLEEG

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_2213aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSS
VSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGA
PSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLI
NSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGG
GSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPT
NKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSF
SFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQA
PPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASS
TTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFS
SPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFG
QSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYRE
VMLALTIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYER
FERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNS
LAEQRKTVTTEDPQAVGGLASALDNRKQSSEGTFLSSAQKRGRGGESDLEPIDSWLITQGMIPVAQPSVMDDIEVWLRTDLKGDDLEEGV

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_1107aa
MKSSLLLRGVHFCFHLPGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPS
TEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASS
TSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQ
QTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTS
DSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIV
APGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFG
TTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAP
AFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLAL
TAWADAFRSSPDLTGVVHITEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAPALSVT
GPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLR
YERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTR
GNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSPP

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_1157aa
MKSSLLLRGVHFCFHLPGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPS
TEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASS
TSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQ
QTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTS
DSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIV
APGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFG
TTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAP
AFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLAL
TVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHITEELKRKGVEFPMADLDALSP
IHTPQRSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQED
SSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVV
SPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQ

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_1112aa
MKSSLLLRGVHFCFHLPGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPS
TEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASS
TSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQ
QTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTS
DSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIV
APGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFG
TTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAP
AFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLAL
TVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAP
ALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLN
NVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDM
FAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPD

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_1112aa
MKSSLLLRGVHFCFHLPGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPS
TEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASS
TSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQ
QTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTS
DSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIV
APGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFG
TTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAP
AFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLAL
TVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQSVPEVDPAATMPRSQSQQRTSAGSTSSPPPAPYSAPQAP
ALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLN
NVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDM
FAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPD

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_1133aa
MKSSLLLRGVHFCFHLPGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPS
TEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASS
TSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQ
QTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTS
DSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIV
APGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFG
TTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAP
AFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLAL
TVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHITEELKRKGVEFPMADLDALSP
IHTPQRIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYER
FERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNS
LAEQRKTVTTEDPQAVGGLASALDNRKQSSEGTFLSSAQKRGRGGESDLEPIDSWLITQGMIPVAQPSVMDDIEVWLRTDLKGDDLEEGV

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_1039aa
MKSSLLLRGVHFCFHLPGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPS
TEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASS
TSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQ
QTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTS
DSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIV
APGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFG
TTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAP
AFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLAL
TVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQ
ELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTA
PPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTTEDPQAVGGLASALDNRKQSSEGKGDDLEEGVTSEE

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_1038aa
MKSSLLLRGVHFCFHLPGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPS
TEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASS
TSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQ
QTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTS
DSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIV
APGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFG
TTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAP
AFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLAL
TIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYR
SGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQR
KTVTTEDPQAVGGLASALDNRKQSSEGTFLSSAQKRGRGGESDLEPIDSWLITQGMIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_6843nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTC
TCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGC
ACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGA
ACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCT
AGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACT
TTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGT
TCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAAT
TCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTG
ACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCA
ACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGA
AGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCA
TCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTT
CTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAAT
AAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTA
GGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTT
TTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCA
TTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACA
TTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCT
TTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCT
CCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTT
GTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTG
CCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACC
ACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCT
GCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGC
ACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGC
CCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCA
AGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGT
GTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAA
AGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCA
ACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGT
GACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTG
ATGCTGGCATTAACAGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAA
GGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACC
ATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCT
CTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTC
ATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCC
ATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAAC
GTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAA
GACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAG
CTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTT
GCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTA
GACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAG
GGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTC
CCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTG

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_6993nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTC
TCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGC
ACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGA
ACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCT
AGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACT
TTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGT
TCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAAT
TCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTG
ACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCA
ACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGA
AGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCA
TCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTT
CTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAAT
AAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTA
GGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTT
TTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCA
TTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACA
TTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCT
TTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCT
CCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTT
GTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTG
CCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACC
ACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCT
GCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGC
ACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGC
CCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCA
AGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGT
GTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAA
AGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCA
ACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGT
GACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTG
ATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGT
GTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCC
TTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGAC
GCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACA
AGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAAT
TCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCT
GGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCC
CGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGA
TACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCT
CCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGC
GTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAG
CAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATC
CCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGT
GAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCA

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_6858nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTC
TCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGC
ACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGA
ACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCT
AGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACT
TTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGT
TCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAAT
TCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTG
ACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCA
ACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGA
AGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCA
TCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTT
CTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAAT
AAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTA
GGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTT
TTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCA
TTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACA
TTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCT
TTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCT
CCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTT
GTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTG
CCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACC
ACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCT
GCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGC
ACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGC
CCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCA
AGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGT
GTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAA
AGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCA
ACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGT
GACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTG
ATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGT
GTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTG
GATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCA
CCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGA
GGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAAC
AGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAAC
GATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTG
AATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCT
TCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGAC
GGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGA
CTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTC
AGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAA
ATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGAT

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_6858nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTC
TCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGC
ACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGA
ACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCT
AGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACT
TTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGT
TCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAAT
TCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTG
ACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCA
ACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGA
AGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCA
TCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTT
CTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAAT
AAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTA
GGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTT
TTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCA
TTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACA
TTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCT
TTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCT
CCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTT
GTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTG
CCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACC
ACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCT
GCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGC
ACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGC
CCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCA
AGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGT
GTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAA
AGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCA
ACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGT
GACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTG
ATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGT
GTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTG
GATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCA
CCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGA
GGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAAC
AGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAAC
GATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTG
AATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCT
TCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGAC
GGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGA
CTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTC
AGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAA
ATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGAT

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_6921nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTC
TCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGC
ACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGA
ACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCT
AGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACT
TTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGT
TCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAAT
TCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTG
ACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCA
ACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGA
AGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCA
TCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTT
CTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAAT
AAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTA
GGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTT
TTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCA
TTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACA
TTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCT
TTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCT
CCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTT
GTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTG
CCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACC
ACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCT
GCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGC
ACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGC
CCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCA
AGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGT
GTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAA
AGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCA
ACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGT
GACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTG
ATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGT
GTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCC
TTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGAC
GCTCTGTCTCCCATACACACACCACAGCGGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAG
ATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAG
CGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTT
CGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTA
ATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGC
TTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACG
AGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGA
AAACAGAGTTCAGAAGGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTT
ATAACCCAAGGAATGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTG
GAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCC

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_6639nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTC
TCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGC
ACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGA
ACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCT
AGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACT
TTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGT
TCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAAT
TCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTG
ACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCA
ACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGA
AGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCA
TCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTT
CTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAAT
AAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTA
GGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTT
TTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCA
TTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACA
TTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCT
TTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCT
CCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTT
GTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTG
CCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACC
ACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCT
GCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGC
ACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGC
CCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCA
AGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGT
GTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAA
AGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCA
ACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGT
GACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTG
ATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGT
GTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGATTGCCAGGCTGCGG
AGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTG
GAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACC
GAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAA
AATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTG
GGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTC
CAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAG
GATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGAAGGGTGATGATCTGGAGGAGGGTGTC
ACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCT

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_6636nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTC
TCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGC
ACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGA
ACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCT
AGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACT
TTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGT
TCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAAT
TCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTG
ACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCA
ACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGA
AGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCA
TCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTT
CTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAAT
AAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTA
GGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTT
TTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCA
TTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACA
TTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCT
TTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCT
CCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTT
GTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTG
CCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACC
ACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCT
GCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGC
ACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGC
CCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCA
AGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGT
GTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAA
AGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCA
ACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGT
GACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTG
ATGCTGGCATTAACAATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATG
GTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTC
ATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTC
GAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCA
GGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACA
GAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTG
GCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAA
GGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGAATG
ATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACA
AGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCC

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_6813nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCA
GCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGG
ACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCC
CATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATT
ATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAG
GCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCT
CAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACA
CCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCA
TCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTC
AGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAA
GGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAA
AGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGA
ACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACT
CTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACC
CAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCC
TCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGA
TCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTG
CCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCA
ACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTC
TCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAA
CCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCC
ACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCT
ATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCA
GAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTC
ACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACT
GGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTC
TTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTC
AGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGC
TCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCT
GGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCA
GAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGGGCCA
AAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGCATGGGCTGATGCC
TTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGAC
GCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACA
AGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAAT
TCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCT
GGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCC
CGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGA
TACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCT
CCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGC
GTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAG
CAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATC
CCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGT
GAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCA

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_6963nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCA
GCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGG
ACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCC
CATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATT
ATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAG
GCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCT
CAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACA
CCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCA
TCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTC
AGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAA
GGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAA
AGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGA
ACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACT
CTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACC
CAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCC
TCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGA
TCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTG
CCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCA
ACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTC
TCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAA
CCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCC
ACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCT
ATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCA
GAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTC
ACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACT
GGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTC
TTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTC
AGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGC
TCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCT
GGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCA
GAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGGGCCA
AAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGT
GTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAAC
AACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTT
GTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACAGCGG
AGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCT
GCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAA
CTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTG
CTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAG
CTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCC
AGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAAC
ACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAA
TGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCT
CAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGAC
ATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGA
GCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCA

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_6828nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCA
GCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGG
ACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCC
CATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATT
ATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAG
GCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCT
CAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACA
CCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCA
TCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTC
AGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAA
GGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAA
AGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGA
ACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACT
CTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACC
CAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCC
TCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGA
TCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTG
CCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCA
ACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTC
TCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAA
CCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCC
ACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCT
ATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCA
GAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTC
ACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACT
GGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTC
TTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTC
AGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGC
TCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCT
GGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCA
GAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGGGCCA
AAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGT
GTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAAC
AACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAA
TCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGC
CCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTA
ACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATC
GTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATAC
GAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGAC
CTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGAC
TTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGA
AACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAG
AGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAG
GAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATG

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_6828nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCA
GCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGG
ACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCC
CATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATT
ATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAG
GCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCT
CAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACA
CCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCA
TCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTC
AGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAA
GGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAA
AGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGA
ACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACT
CTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACC
CAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCC
TCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGA
TCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTG
CCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCA
ACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTC
TCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAA
CCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCC
ACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCT
ATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCA
GAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTC
ACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACT
GGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTC
TTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTC
AGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGC
TCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCT
GGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCA
GAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGGGCCA
AAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGT
GTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAAC
AACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAA
TCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGC
CCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTA
ACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATC
GTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATAC
GAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGAC
CTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGAC
TTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGA
AACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAG
AGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAG
GAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATG

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_6891nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCA
GCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGG
ACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCC
CATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATT
ATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAG
GCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCT
CAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACA
CCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCA
TCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTC
AGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAA
GGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAA
AGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGA
ACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACT
CTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACC
CAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCC
TCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGA
TCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTG
CCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCA
ACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTC
TCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAA
CCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCC
ACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCT
ATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCA
GAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTC
ACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACT
GGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTC
TTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTC
AGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGC
TCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCT
GGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCA
GAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGGGCCA
AAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGT
GTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAAC
AACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTT
GTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACAGCGG
ATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAG
GATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCC
AATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCT
GGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTG
GTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGC
ACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAG
ACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGACTTTTCTGTCC
TCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGAATGATCCCCGTTGCGCAG
CCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGAT
AAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCT

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_6609nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCA
GCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGG
ACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCC
CATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATT
ATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAG
GCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCT
CAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACA
CCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCA
TCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTC
AGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAA
GGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAA
AGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGA
ACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACT
CTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACC
CAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCC
TCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGA
TCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTG
CCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCA
ACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTC
TCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAA
CCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCC
ACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCT
ATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCA
GAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTC
ACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACT
GGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTC
TTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTC
AGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGC
TCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCT
GGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCA
GAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGGGCCA
AAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGT
GTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAAC
AACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACA
AAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGT
CGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTC
AACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTA
ACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCC
TCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGAC
ATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCT
GCACTAGACAATCGAAAACAGAGTTCAGAAGGGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAA
GAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAG

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_6606nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCA
GCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGG
ACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCC
CATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATT
ATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAG
GCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCT
CAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACA
CCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCA
TCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTC
AGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAA
GGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAA
AGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGA
ACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACT
CTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACC
CAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCC
TCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGA
TCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTG
CCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCA
ACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTC
TCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAA
CCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCC
ACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCT
ATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCA
GAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTC
ACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACT
GGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTC
TTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTC
AGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGC
TCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCT
GGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCA
GAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGGGCCA
AAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAATTGCCAGGCTGCGG
AGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTG
GAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACC
GAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAA
AATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTG
GGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTC
CAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAG
GATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGACTTTTCTGTCCTCGGCCCAGAAGAGA
GGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGAATGATCCCCGTTGCGCAGCCATCTGTCATGGAC
GACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAA
AGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAG

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_6846nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCT
GTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTT
CGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATG
GGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCA
CCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAAC
ACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATG
GGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATA
AATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCT
GTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACA
CCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGG
GGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCC
GCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAG
CTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACC
AATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTG
TTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCC
GTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTT
TCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCC
ACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCA
GCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCT
CCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGT
CTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCT
GTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGC
ACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCT
GCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCC
AGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGC
AGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCT
GCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGA
AGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGC
CAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCA
GCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATC
TGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAG
GTGATGCTGGCATTAACAGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGG
AAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCG
ACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCA
GCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAA
GTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGG
GCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAAC
AACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACC
GAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCC
CAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATG
TTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCA
CTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTG
AAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGAC
CTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCC

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_6996nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCT
GTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTT
CGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATG
GGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCA
CCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAAC
ACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATG
GGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATA
AATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCT
GTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACA
CCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGG
GGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCC
GCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAG
CTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACC
AATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTG
TTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCC
GTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTT
TCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCC
ACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCA
GCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCT
CCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGT
CTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCT
GTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGC
ACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCT
GCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCC
AGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGC
AGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCT
GCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGA
AGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGC
CAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCA
GCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATC
TGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAG
GTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGAC
AGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGAT
GCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTG
GACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGG
ACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCC
AATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTC
CCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATC
TCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAA
CGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGG
TCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAG
AGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCT
GAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGG
ATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACA
AGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCC

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_6861nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCT
GTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTT
CGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATG
GGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCA
CCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAAC
ACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATG
GGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATA
AATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCT
GTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACA
CCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGG
GGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCC
GCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAG
CTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACC
AATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTG
TTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCC
GTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTT
TCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCC
ACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCA
GCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCT
CCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGT
CTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCT
GTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGC
ACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCT
GCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCC
AGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGC
AGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCT
GCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGA
AGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGC
CAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCA
GCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATC
TGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAG
GTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGAC
AGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAA
GTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCC
GCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTT
CGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTC
AACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTG
AACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTA
CTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCA
TCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGT
GACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGA
GGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGG
CTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCT
GAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAG

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_6861nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCT
GTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTT
CGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATG
GGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCA
CCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAAC
ACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATG
GGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATA
AATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCT
GTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACA
CCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGG
GGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCC
GCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAG
CTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACC
AATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTG
TTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCC
GTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTT
TCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCC
ACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCA
GCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCT
CCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGT
CTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCT
GTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGC
ACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCT
GCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCC
AGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGC
AGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCT
GCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGA
AGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGC
CAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCA
GCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATC
TGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAG
GTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGAC
AGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAA
GTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCC
GCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTT
CGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTC
AACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTG
AACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTA
CTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCA
TCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGT
GACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGA
GGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGG
CTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCT
GAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAG

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_6924nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCT
GTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTT
CGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATG
GGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCA
CCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAAC
ACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATG
GGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATA
AATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCT
GTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACA
CCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGG
GGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCC
GCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAG
CTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACC
AATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTG
TTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCC
GTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTT
TCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCC
ACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCA
GCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCT
CCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGT
CTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCT
GTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGC
ACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCT
GCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCC
AGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGC
AGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCT
GCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGA
AGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGC
CAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCA
GCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATC
TGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAG
GTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGAC
AGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGAT
GCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTG
GACGCTCTGTCTCCCATACACACACCACAGCGGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCT
GAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAG
CAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTC
CTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAAC
TTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCA
GGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAG
ACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAAT
CGAAAACAGAGTTCAGAAGGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGG
CTTATAACCCAAGGAATGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGAT
CTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCC

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_6642nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCT
GTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTT
CGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATG
GGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCA
CCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAAC
ACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATG
GGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATA
AATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCT
GTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACA
CCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGG
GGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCC
GCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAG
CTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACC
AATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTG
TTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCC
GTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTT
TCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCC
ACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCA
GCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCT
CCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGT
CTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCT
GTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGC
ACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCT
GCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCC
AGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGC
AGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCT
GCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGA
AGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGC
CAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCA
GCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATC
TGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAG
GTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGAC
AGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGATTGCCAGGCTG
CGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGAT
CTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTC
ACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTT
CAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATG
GTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCA
CTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTAT
GAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGAAGGGTGATGATCTGGAGGAGGGT
GTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCT

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_6639nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCT
GTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTT
CGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATG
GGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCA
CCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAAC
ACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATG
GGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATA
AATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCT
GTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACA
CCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGG
GGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCC
GCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAG
CTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACC
AATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTG
TTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCC
GTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTT
TCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCC
ACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCA
GCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCT
CCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGT
CTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCT
GTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGC
ACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCT
GCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCC
AGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGC
AGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCT
GCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGA
AGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGC
CAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCA
GCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATC
TGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAG
GTGATGCTGGCATTAACAATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAA
ATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAG
CTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGG
TTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGG
CCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGG
ACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCC
TTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCA
GAAGGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGA
ATGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTC
ACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCT

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_3321nt
ATGAAATCCTCTCTTTTGTTACGAGGTGTTCACTTCTGTTTTCACTTGCCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCA
TCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCT
AATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCT
TATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGA
CCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGT
TCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCC
ACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACG
GAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTG
CCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAA
CAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGT
AGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAG
CCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCT
GACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCT
GCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACT
GCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTT
GCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGC
TCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGT
CTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGT
ACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCC
TTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCC
GCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCT
GCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTC
AGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAAT
GAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTA
ACAGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTT
CCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCC
CAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACT
GGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATG
TTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGC
ATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGA
TACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATA
GACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTA
GACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGA
GGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAA
CAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTG
GAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCC

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_3471nt
ATGAAATCCTCTCTTTTGTTACGAGGTGTTCACTTCTGTTTTCACTTGCCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCA
TCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCT
AATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCT
TATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGA
CCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGT
TCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCC
ACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACG
GAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTG
CCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAA
CAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGT
AGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAG
CCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCT
GACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCT
GCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACT
GCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTT
GCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGC
TCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGT
CTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGT
ACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCC
TTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCC
GCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCT
GCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTC
AGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAAT
GAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTA
ACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAA
ATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCCTTTCGAAGCAGT
CCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCC
ATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCC
TATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATT
GCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGAT
TCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAAT
GAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGC
CGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTG
AGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACC
CTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACG
GTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAG
CCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGAT
AAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCT

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_3336nt
ATGAAATCCTCTCTTTTGTTACGAGGTGTTCACTTCTGTTTTCACTTGCCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCA
TCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCT
AATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCT
TATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGA
CCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGT
TCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCC
ACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACG
GAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTG
CCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAA
CAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGT
AGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAG
CCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCT
GACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCT
GCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACT
GCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTT
GCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGC
TCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGT
CTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGT
ACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCC
TTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCC
GCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCT
GCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTC
AGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAAT
GAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTA
ACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAA
ATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTGGATCCAGCTGCG
ACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCA
GCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAA
GTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGG
GCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAAC
AACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACC
GAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCC
CAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATG
TTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCA
CTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTG
AAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGAC
CTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCC

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_3336nt
ATGAAATCCTCTCTTTTGTTACGAGGTGTTCACTTCTGTTTTCACTTGCCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCA
TCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCT
AATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCT
TATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGA
CCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGT
TCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCC
ACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACG
GAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTG
CCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAA
CAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGT
AGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAG
CCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCT
GACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCT
GCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACT
GCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTT
GCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGC
TCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGT
CTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGT
ACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCC
TTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCC
GCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCT
GCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTC
AGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAAT
GAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTA
ACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAA
ATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTGGATCCAGCTGCG
ACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCA
GCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAA
GTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGG
GCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAAC
AACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACC
GAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCC
CAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATG
TTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCA
CTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTG
AAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGAC
CTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCC

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_3399nt
ATGAAATCCTCTCTTTTGTTACGAGGTGTTCACTTCTGTTTTCACTTGCCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCA
TCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCT
AATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCT
TATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGA
CCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGT
TCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCC
ACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACG
GAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTG
CCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAA
CAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGT
AGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAG
CCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCT
GACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCT
GCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACT
GCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTT
GCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGC
TCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGT
CTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGT
ACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCC
TTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCC
GCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCT
GCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTC
AGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAAT
GAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTA
ACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAA
ATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCCTTTCGAAGCAGT
CCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCC
ATACACACACCACAGCGGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAA
ATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAG
CTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGG
TTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGG
CCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGG
ACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCC
TTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCA
GAAGGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGA
ATGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTC
ACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCT

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_3117nt
ATGAAATCCTCTCTTTTGTTACGAGGTGTTCACTTCTGTTTTCACTTGCCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCA
TCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCT
AATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCT
TATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGA
CCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGT
TCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCC
ACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACG
GAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTG
CCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAA
CAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGT
AGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAG
CCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCT
GACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCT
GCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACT
GCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTT
GCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGC
TCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGT
CTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGT
ACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCC
TTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCC
GCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCT
GCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTC
AGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAAT
GAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTA
ACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAA
ATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGATTGCCAGGCTGCGGAGTGAACTGGAC
GTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAG
GAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTG
CATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAAT
GGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCG
CCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAAT
CCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCT
GTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAG
TTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCA

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_3114nt
ATGAAATCCTCTCTTTTGTTACGAGGTGTTCACTTCTGTTTTCACTTGCCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCA
TCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCT
AATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCT
TATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGA
CCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGT
TCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCC
ACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACG
GAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTG
CCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAA
CAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGT
AGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAG
CCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCT
GACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCT
GCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACT
GCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTT
GCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGC
TCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGT
CTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGT
ACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCC
TTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCC
GCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCT
GCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTC
AGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAAT
GAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTA
ACAATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAG
GAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTG
TCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGG
TCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCC
GTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGT
GGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGC
AAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGACTTTTCTG
TCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGAATGATCCCCGTTGCG
CAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTT
GATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_11148nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGT
GCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGC
AGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGA
GTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATAC
CTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGT
TGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGC
TCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCA
TCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAA
CCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGC
TGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACAC
CAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGT
GAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATC
TGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGT
TCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGAT
GGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGC
ACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAA
CACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCAT
GGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAAT
AAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGC
TGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCAC
ACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGG
GGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGC
CGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGA
GCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAAC
CAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGT
GTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGC
CGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTT
TTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCC
CACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATC
AGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGC
TCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAG
TCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTC
TGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAG
CACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCC
TGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGC
CAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAG
CAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGC
TGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGG
AAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGG
CCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGC
AGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGAT
CTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGA
GGTGATGCTGGCATTAACAGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAG
GAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGC
GACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCC
AGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAA
AGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCG
GGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAA
CAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAAC
CGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTC
CCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACAT
GTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGC
ACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCT
GAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGA
CCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGC
CCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCC
AGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCA
CTTCTTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAG
AGCGGGCAGAGTGGCCCAGCCCCAGGCAGTGCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGCCCATGGAGAAAGAGCACG
CCCGGCCCCGCCCTGTGCTCACCTCTGCCTGGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCTCTCTCCCTGAAGGGGCTT
TGTGGCATCTCTGGAAGAGCAGGGTGTGCTGCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTGTGACATTTGGCTTATCAG
CATTTGAGAAGGCTCTGCTGGGTCTCCATGGTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAGCTGCCAGCCCAGGCTTCA
CACCCAAGCTGGCTCAGCAGCCGAGCCTGGCACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCAAGGACAATTGGGAGGGCA
GCAGGCAGCCCGCAGATGGTGGCCATGTGGCACGCTGCTGAGACGACACTACCAATAAACCAAACTGCCACGCACACACTGCAGGCTCAC
ACCCGCACACCTGGTCCTGGCTTGTGGAGGGACTTGCACTGGAGGTATTGCTCTGGCTTGCCTGGGGAAGTGTCACAGATGTGCACATGG
GCCACACTCAGTGCTGTGGCCTGGCCTGCCGTAGCCTCACACATCTGCCTCAAGAGCCAGCAGCAAACAGCTTTGTGGCATCCTTGGAGG
TTCCCAGTGACTGAGAGGCCTGGGCAGCACTAAGGCCCCTGCTCTGCTCCCTGGCATAGGCCTTGGCCTCCTTGCACAGACTCTCCTGAC
AGTCTGGCCTCCTCCCACCTCAGAGGTCCTCTGGCCACCAATTTATACTCTCTCCCCAAGCTGATCCTGAAGGCAGGCAGAGCAGCTAGG
GGCTGGTAACATGTATTCCCATCCCGTGTCCTCACTGGTGTGTCTCCTGGCCATGGGCAAGGGACTCGGGTCATCCCAGGCCCTGGTCCA
GCCAGACACCTGGCCCCACACCTCCCACCAGGCTGCTGTTGCTCAGAAGGAGAATACTGCAGCTGTATGCATCCCCGTGTGTCTTGGGCC
CAGCTCGCTGGGTCAGTCTGCTCCTGTCCCCTCCAGCATGCACTGCCTAGGTCAGCACAGGTTCCTGATCCATGGTGTAGTTAGCCCTTC
CCACCTGGCAGGACGGCCCAGACCACCAGCCAAGCAGGGAAAGGGGGCTGGGCTTGACGGGAGAAGAGACCAGCGACATGGTCGTTGGGG
AGCATTCAGGATGGCGACTTCAGCTGGGGGTCATGCTGAGCACCAACAGGAACTATTCCAGTGAAGAGCAAGTGCTGCCCGACCCAGGAC
CCTGTGCCAGGCTAGCAGCCCTCCAGCTCCCTCCAGAGAGGAAACCTCTGTCTGGCTGAGGGTGGGACTAGCTGGGATGTCTCACTCCAG
TTGCTCAGGTTCACCCAGGAAGCTCCTCCGTGGAGTGGCCAGCCTGATTCTAGCCCTGTCCTCTCTGGCAGCACATGCCACACCTGCCTG
GGCCTTCTGCTCCCTGATGCTTGATGAGCCCCTGCCTCCTCAATGTTTCTCAAAGACAGACCCCCCTGAGGCCAGCTTGAATGTGAAGAC
TGCTGAAGTTAGCTGGCTTCACTTGAGCTGCAGAAAAGGTGGCTGGGATGGCCCAGGTGCACCCAGAGGCCCCAGCCCTTTGGCTGCCTT
TGGGTTGTGACTTGGGTTGTCTCTGAGGCCCTGCCAGAGCTGGGCCTGCGGGTGGTGGGCGGTCCGACCTCGGGCAGTCAGTGCTCCGCA
GCCTCAGCACTGCATCCCAGACCCAGTGTCCTCAGAGGGAAGAGCCAGCCTCCCTGCCTCATGGAACCAGGAGTCCCAAAAAGTCAGGAG
CCTGGAGGCTCTGAAAGGAGCAGGGATTCCATAGTGCGTGAAGCTGAAATAGGCGCCCTCCTGGGGAGCCCCCAGCAAAACTGTTTTTCA
TACCCACTCCCAGAACTGCCCCGCTCCAGCTCCAGCGCCAGCGCCAGCTGGTTGCCAGGCATCATTGGAGAGGCCTGGCTGCCCCAGGGG
CAGCAGGGAGTGGTGGACCTGTATGGGCTGGCAGGAGGCCATTGGCCATGCTGACAAGTGTCACCTGCCTTCCTAGCCTGGAGCCACCCC
TCAGGTGGCCTGCTTGCACCTCCTATCCGGAGGTAGCCTGCCCCACCTGTAGGCAGAGGGGGCTCTTGCTTGAGGCCTGCACAGGAAGCA
AGTATAGCCCCGGTGCCCCAGAGTGGGTTCCACTTAGCCCTGGCGAGATGGCCTGTCCTGAGATCTCTGCTCCCAGACCCCACCATCTGG
GGAGCACAGTCCTTAGGCTGCCTGGTCCAGGAAGGGGGTGCGGCTCTGTCAGGAAACCTGGACTCTCAAGGCCCACCAGCCTCTCCGTGA
GTGTTAGAAATCACAGATACAGTATATACTTAATTACACTAAATTATTGCTGGGATTCCTTATAAGCACTAATTATACCTGATTATAGGT
TAAAATATTTATTTTGTCAAAATATTTTCTTGGGAATGTGTTTAACCCTTTCTGCGTTCATTGTTGCTGAGATGTGAAAACTAACCATTC
CCTCCTGCCTACCTTTTTGGCCACTGGGCGGCAGAGAATGGCGCTATGTGCAGTTGGGCCCCTGGCACCATGGGCCTTTGGCCTGCCTGC
TGCAGAGTAGCCCTGCCTGGGCAGTCTCCAGGCACTGAGCAGGCCATCTGTGGCCAGGCTGAGAGAATGACTGGCTCGCTTACCAGCGTG
CATGGGACAAGGAGCTTTGGAGCCTCAAGGGGTTGTTGCTGGCCTGGGCTAGAGGGAAAGGTGACCATCCGTCTGTCCTCCTGTCTTTCT
ATTAGCGCCTCCATGTGAGTGATGGTGCCTTGGTTCACTAGCCTTCCCCCACCACCCCACCATGCCACCTGGTGGTCTTGGGGCCTGTGC
TGTCACTCCAGCCCCTGGGGAGGAGAGGACCCAGCCCGGAGAGTTGGGGCAAGGGCTCCACATGGCCCAAGGGCAACAGATGCTCGCAGG
GCAGCTGCTGCCGATGCTCACGCTCCTGCCCCCCTCCTTCCCGCTGCCACACCCCACCCTGGGCCCCCGCAGACACGCATCTCTAACTCA
GTTGGGCCCAGCCTTCTGGATGGCTTGGGGTAGGCCATGGGCCCACCTGGGGCCAGGCCAGCCCCTGGGGCAGCTCTGGAAGAGCAGTGT
GGAGGAGCACTTGCTTGCAGCCTGGCTTCAGCCTCTGGCACTGCTGGAGTGGTCCCTGGGAGCTTCTGCACTGTCGGCTTTGGGGACGTC
TCACCCACTTGGGTTACAGTAGGCCTTCCCCACCCAGAGAGAAGTGTTTCCACCCCAGAGACATTGTCTGTCAGCCCCTGAAGTGCTCGC
CTCCCCCAGTGCCCGTCACCAGCCCTTCCTATCTGTGGGGTCCAAGTCAGGCTTCCCCTGCGGCCACCAGCCATAGGGAGCAGCCATCAG
CCCCCGAGTCAGAACTGCTTCTGTCTGTCCATACCTCCAGGCTCTCCCGGAGAGGGGGACGGATATTTATTTCCTAAAGTTTGCACTTAA
TTGTGAGGATTCTCAGGATTGTTGGGGGCTACTGAAAAGAGGAATGTGTTGAATGTCGCGTTTGCTGTCCACTCGTCCTAGAAGTTTAGT
GTTTTTGTCACTGTCATGTGTTTCTGTGGGCAGAGCTGGTTCTGGAGGGTGGGTCAGTGCACCCGAGGCTCAGAGCATCCATCCACCCCA

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_7987nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGT
GCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGC
AGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGA
GTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATAC
CTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGT
TGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGC
TCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCA
TCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAA
CCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGC
TGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACAC
CAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGT
GAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATC
TGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGT
TCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGAT
GGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGC
ACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAA
CACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCAT
GGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAAT
AAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGC
TGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCAC
ACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGG
GGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGC
CGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGA
GCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAAC
CAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGT
GTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGC
CGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTT
TTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCC
CACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATC
AGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGC
TCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAG
TCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTC
TGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAG
CACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCC
TGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGC
CAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAG
CAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGC
TGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGG
AAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGG
CCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGC
AGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGAT
CTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGA
GGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGA
CAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGA
TGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTT
GGACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAG
GACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGC
CAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGT
CCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCAT
CTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGA
ACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGG
GTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGA
GAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGC
TGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGG
GATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCAC
AAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGC
CCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCC
AGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTC
CATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGTGGGACAACTGC
AGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCGGGCAGAGTGGCCCAGCCCCAGGCAGT
GCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGCCCATGGAGAAAGAGCACGCCCGGCCCCGCCCTGTGCTCACCTCTGCCT
GGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCTCTCTCCCTGAAGGGGCTTTGTGGCATCTCTGGAAGAGCAGGGTGTGCT
GCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTGTGACATTTGGCTTATCAGCATTTGAGAAGGCTCTGCTGGGTCTCCATG
GTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAGCTGCCAGCCCAGGCTTCACACCCAAGCTGGCTCAGCAGCCGAGCCTGG
CACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCAAGGACAATTGGGAGGGCAGCAGGCAGCCCGCAGATGGTGGCCATGTGG

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_7828nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGT
GCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGC
AGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGA
GTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATAC
CTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGT
TGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGC
TCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCA
TCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAA
CCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGC
TGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACAC
CAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGT
GAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATC
TGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGT
TCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGAT
GGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGC
ACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAA
CACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCAT
GGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAAT
AAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGC
TGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCAC
ACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGG
GGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGC
CGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGA
GCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAAC
CAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGT
GTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGC
CGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTT
TTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCC
CACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATC
AGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGC
TCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAG
TCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTC
TGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAG
CACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCC
TGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGC
CAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAG
CAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGC
TGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGG
AAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGG
CCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGC
AGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGAT
CTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGA
GGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGA
CAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGA
AGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTC
CGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGT
TCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCT
CAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGT
GAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGT
ACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCC
ATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCG
TGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGG
AGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTG
GCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGC
TGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGA
GGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGC
CACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAG
GACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATG
TTTCCTCCCAGGAAGAGCGGGCAGAGTGGCCCAGCCCCAGGCAGTGCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGCCCA
TGGAGAAAGAGCACGCCCGGCCCCGCCCTGTGCTCACCTCTGCCTGGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCTCTC
TCCCTGAAGGGGCTTTGTGGCATCTCTGGAAGAGCAGGGTGTGCTGCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTGTGA
CATTTGGCTTATCAGCATTTGAGAAGGCTCTGCTGGGTCTCCATGGTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAGCTG
CCAGCCCAGGCTTCACACCCAAGCTGGCTCAGCAGCCGAGCCTGGCACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCAAGG

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_7328nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGT
GCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGC
AGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGA
GTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATAC
CTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGT
TGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGC
TCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCA
TCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAA
CCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGC
TGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACAC
CAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGT
GAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATC
TGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGT
TCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGAT
GGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGC
ACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAA
CACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCAT
GGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAAT
AAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGC
TGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCAC
ACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGG
GGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGC
CGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGA
GCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAAC
CAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGT
GTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGC
CGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTT
TTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCC
CACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATC
AGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGC
TCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAG
TCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTC
TGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAG
CACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCC
TGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGC
CAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAG
CAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGC
TGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGG
AAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGG
CCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGC
AGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGAT
CTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGA
GGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGA
CAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGA
AGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTC
CGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGT
TCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCT
CAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGT
GAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGT
ACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCC
ATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCG
TGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGG
AGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTG
GCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGC
TGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGA
GGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGC
CACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAG
GACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATG

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_7294nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGT
GCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGC
AGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGA
GTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATAC
CTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGT
TGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGC
TCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCA
TCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAA
CCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGC
TGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACAC
CAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGT
GAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATC
TGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGT
TCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGAT
GGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGC
ACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAA
CACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCAT
GGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAAT
AAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGC
TGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCAC
ACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGG
GGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGC
CGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGA
GCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAAC
CAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGT
GTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGC
CGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTT
TTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCC
CACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATC
AGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGC
TCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAG
TCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTC
TGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAG
CACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCC
TGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGC
CAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAG
CAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGC
TGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGG
AAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGG
CCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGC
AGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGAT
CTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGA
GGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGA
CAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGA
TGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTT
GGACGCTCTGTCTCCCATACACACACCACAGCGGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTC
TGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCA
GCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTT
CCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAA
CTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGC
AGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCA
GACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAA
TCGAAAACAGAGTTCAGAAGGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTG
GCTTATAACCCAAGGAATGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGA
TCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCC
CCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGC
TCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGG
CCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTCTCT

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_6989nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGT
GCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGC
AGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGA
GTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATAC
CTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGT
TGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGC
TCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCA
TCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAA
CCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGC
TGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACAC
CAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGT
GAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATC
TGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGT
TCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGAT
GGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGC
ACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAA
CACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCAT
GGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAAT
AAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGC
TGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCAC
ACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGG
GGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGC
CGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGA
GCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAAC
CAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGT
GTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGC
CGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTT
TTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCC
CACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATC
AGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGC
TCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAG
TCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTC
TGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAG
CACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCC
TGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGC
CAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAG
CAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGC
TGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGG
AAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGG
CCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGC
AGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGAT
CTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGA
GGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGA
CAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGATTGCCAGGCT
GCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGA
TCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGT
CACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGT
TCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAAT
GGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTC
ACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTA
TGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGAAGGGTGATGATCTGGAGGAGGG
TGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGC
TCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGC
CTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTG

>In-frame_NUP214_ENST00000359428_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_6886nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGT
GCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGC
AGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGA
GTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATAC
CTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGT
TGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGC
TCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCA
TCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAA
CCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGC
TGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACAC
CAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGT
GAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATC
TGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGT
TCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGAT
GGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGC
ACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAA
CACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCAT
GGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAAT
AAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGC
TGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCAC
ACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGG
GGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGC
CGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGA
GCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAAC
CAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGT
GTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGC
CGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTT
TTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCC
CACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATC
AGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGC
TCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAG
TCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTC
TGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAG
CACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCC
TGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGC
CAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAG
CAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGC
TGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGG
AAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGG
CCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGC
AGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGAT
CTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGA
GGTGATGCTGGCATTAACAATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGA
AATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGA
GCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAG
GTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGG
GCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGG
GACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTC
CTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTC
AGAAGGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGG
AATGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGT
CACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCC
TGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTC

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_11118nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTC
GCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAA
GTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGAT
AACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTC
AGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTT
CCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGA
GTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAA
TCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCA
GTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCT
GCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGT
GGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTT
TGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACT
GTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCG
ATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGC
ACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTT
GCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAA
AATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCC
GCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGT
CCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAA
AACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACC
AGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCA
GTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGC
ACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCC
TGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTC
TGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGA
GACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAG
TACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGAC
ATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGC
AGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCAC
AGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTC
AGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGA
GGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAA
AGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCC
AGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGC
TGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATC
TGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCA
GCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCA
GACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGG
GGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGG
GTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAG
TAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAG
TCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGC
TTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGG
GCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGCATGGGCTGA
TGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTT
GGACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAG
GACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGC
CAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGT
CCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCAT
CTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGA
ACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGG
GTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGA
GAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGC
TGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGG
GATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCAC
AAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGC
CCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCC
AGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTC
CATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGTGGGACAACTGC
AGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCGGGCAGAGTGGCCCAGCCCCAGGCAGT
GCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGCCCATGGAGAAAGAGCACGCCCGGCCCCGCCCTGTGCTCACCTCTGCCT
GGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCTCTCTCCCTGAAGGGGCTTTGTGGCATCTCTGGAAGAGCAGGGTGTGCT
GCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTGTGACATTTGGCTTATCAGCATTTGAGAAGGCTCTGCTGGGTCTCCATG
GTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAGCTGCCAGCCCAGGCTTCACACCCAAGCTGGCTCAGCAGCCGAGCCTGG
CACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCAAGGACAATTGGGAGGGCAGCAGGCAGCCCGCAGATGGTGGCCATGTGG
CACGCTGCTGAGACGACACTACCAATAAACCAAACTGCCACGCACACACTGCAGGCTCACACCCGCACACCTGGTCCTGGCTTGTGGAGG
GACTTGCACTGGAGGTATTGCTCTGGCTTGCCTGGGGAAGTGTCACAGATGTGCACATGGGCCACACTCAGTGCTGTGGCCTGGCCTGCC
GTAGCCTCACACATCTGCCTCAAGAGCCAGCAGCAAACAGCTTTGTGGCATCCTTGGAGGTTCCCAGTGACTGAGAGGCCTGGGCAGCAC
TAAGGCCCCTGCTCTGCTCCCTGGCATAGGCCTTGGCCTCCTTGCACAGACTCTCCTGACAGTCTGGCCTCCTCCCACCTCAGAGGTCCT
CTGGCCACCAATTTATACTCTCTCCCCAAGCTGATCCTGAAGGCAGGCAGAGCAGCTAGGGGCTGGTAACATGTATTCCCATCCCGTGTC
CTCACTGGTGTGTCTCCTGGCCATGGGCAAGGGACTCGGGTCATCCCAGGCCCTGGTCCAGCCAGACACCTGGCCCCACACCTCCCACCA
GGCTGCTGTTGCTCAGAAGGAGAATACTGCAGCTGTATGCATCCCCGTGTGTCTTGGGCCCAGCTCGCTGGGTCAGTCTGCTCCTGTCCC
CTCCAGCATGCACTGCCTAGGTCAGCACAGGTTCCTGATCCATGGTGTAGTTAGCCCTTCCCACCTGGCAGGACGGCCCAGACCACCAGC
CAAGCAGGGAAAGGGGGCTGGGCTTGACGGGAGAAGAGACCAGCGACATGGTCGTTGGGGAGCATTCAGGATGGCGACTTCAGCTGGGGG
TCATGCTGAGCACCAACAGGAACTATTCCAGTGAAGAGCAAGTGCTGCCCGACCCAGGACCCTGTGCCAGGCTAGCAGCCCTCCAGCTCC
CTCCAGAGAGGAAACCTCTGTCTGGCTGAGGGTGGGACTAGCTGGGATGTCTCACTCCAGTTGCTCAGGTTCACCCAGGAAGCTCCTCCG
TGGAGTGGCCAGCCTGATTCTAGCCCTGTCCTCTCTGGCAGCACATGCCACACCTGCCTGGGCCTTCTGCTCCCTGATGCTTGATGAGCC
CCTGCCTCCTCAATGTTTCTCAAAGACAGACCCCCCTGAGGCCAGCTTGAATGTGAAGACTGCTGAAGTTAGCTGGCTTCACTTGAGCTG
CAGAAAAGGTGGCTGGGATGGCCCAGGTGCACCCAGAGGCCCCAGCCCTTTGGCTGCCTTTGGGTTGTGACTTGGGTTGTCTCTGAGGCC
CTGCCAGAGCTGGGCCTGCGGGTGGTGGGCGGTCCGACCTCGGGCAGTCAGTGCTCCGCAGCCTCAGCACTGCATCCCAGACCCAGTGTC
CTCAGAGGGAAGAGCCAGCCTCCCTGCCTCATGGAACCAGGAGTCCCAAAAAGTCAGGAGCCTGGAGGCTCTGAAAGGAGCAGGGATTCC
ATAGTGCGTGAAGCTGAAATAGGCGCCCTCCTGGGGAGCCCCCAGCAAAACTGTTTTTCATACCCACTCCCAGAACTGCCCCGCTCCAGC
TCCAGCGCCAGCGCCAGCTGGTTGCCAGGCATCATTGGAGAGGCCTGGCTGCCCCAGGGGCAGCAGGGAGTGGTGGACCTGTATGGGCTG
GCAGGAGGCCATTGGCCATGCTGACAAGTGTCACCTGCCTTCCTAGCCTGGAGCCACCCCTCAGGTGGCCTGCTTGCACCTCCTATCCGG
AGGTAGCCTGCCCCACCTGTAGGCAGAGGGGGCTCTTGCTTGAGGCCTGCACAGGAAGCAAGTATAGCCCCGGTGCCCCAGAGTGGGTTC
CACTTAGCCCTGGCGAGATGGCCTGTCCTGAGATCTCTGCTCCCAGACCCCACCATCTGGGGAGCACAGTCCTTAGGCTGCCTGGTCCAG
GAAGGGGGTGCGGCTCTGTCAGGAAACCTGGACTCTCAAGGCCCACCAGCCTCTCCGTGAGTGTTAGAAATCACAGATACAGTATATACT
TAATTACACTAAATTATTGCTGGGATTCCTTATAAGCACTAATTATACCTGATTATAGGTTAAAATATTTATTTTGTCAAAATATTTTCT
TGGGAATGTGTTTAACCCTTTCTGCGTTCATTGTTGCTGAGATGTGAAAACTAACCATTCCCTCCTGCCTACCTTTTTGGCCACTGGGCG
GCAGAGAATGGCGCTATGTGCAGTTGGGCCCCTGGCACCATGGGCCTTTGGCCTGCCTGCTGCAGAGTAGCCCTGCCTGGGCAGTCTCCA
GGCACTGAGCAGGCCATCTGTGGCCAGGCTGAGAGAATGACTGGCTCGCTTACCAGCGTGCATGGGACAAGGAGCTTTGGAGCCTCAAGG
GGTTGTTGCTGGCCTGGGCTAGAGGGAAAGGTGACCATCCGTCTGTCCTCCTGTCTTTCTATTAGCGCCTCCATGTGAGTGATGGTGCCT
TGGTTCACTAGCCTTCCCCCACCACCCCACCATGCCACCTGGTGGTCTTGGGGCCTGTGCTGTCACTCCAGCCCCTGGGGAGGAGAGGAC
CCAGCCCGGAGAGTTGGGGCAAGGGCTCCACATGGCCCAAGGGCAACAGATGCTCGCAGGGCAGCTGCTGCCGATGCTCACGCTCCTGCC
CCCCTCCTTCCCGCTGCCACACCCCACCCTGGGCCCCCGCAGACACGCATCTCTAACTCAGTTGGGCCCAGCCTTCTGGATGGCTTGGGG
TAGGCCATGGGCCCACCTGGGGCCAGGCCAGCCCCTGGGGCAGCTCTGGAAGAGCAGTGTGGAGGAGCACTTGCTTGCAGCCTGGCTTCA
GCCTCTGGCACTGCTGGAGTGGTCCCTGGGAGCTTCTGCACTGTCGGCTTTGGGGACGTCTCACCCACTTGGGTTACAGTAGGCCTTCCC
CACCCAGAGAGAAGTGTTTCCACCCCAGAGACATTGTCTGTCAGCCCCTGAAGTGCTCGCCTCCCCCAGTGCCCGTCACCAGCCCTTCCT
ATCTGTGGGGTCCAAGTCAGGCTTCCCCTGCGGCCACCAGCCATAGGGAGCAGCCATCAGCCCCCGAGTCAGAACTGCTTCTGTCTGTCC
ATACCTCCAGGCTCTCCCGGAGAGGGGGACGGATATTTATTTCCTAAAGTTTGCACTTAATTGTGAGGATTCTCAGGATTGTTGGGGGCT
ACTGAAAAGAGGAATGTGTTGAATGTCGCGTTTGCTGTCCACTCGTCCTAGAAGTTTAGTGTTTTTGTCACTGTCATGTGTTTCTGTGGG
CAGAGCTGGTTCTGGAGGGTGGGTCAGTGCACCCGAGGCTCAGAGCATCCATCCACCCCACTGGCCCTCCTTCCAGATACCCTCTCTCTA

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_7957nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTC
GCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAA
GTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGAT
AACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTC
AGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTT
CCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGA
GTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAA
TCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCA
GTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCT
GCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGT
GGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTT
TGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACT
GTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCG
ATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGC
ACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTT
GCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAA
AATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCC
GCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGT
CCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAA
AACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACC
AGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCA
GTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGC
ACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCC
TGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTC
TGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGA
GACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAG
TACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGAC
ATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGC
AGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCAC
AGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTC
AGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGA
GGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAA
AGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCC
AGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGC
TGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATC
TGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCA
GCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCA
GACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGG
GGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGG
GTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAG
TAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAG
TCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGC
TTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGG
GCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGAC
ATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAA
GAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGG
CGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACA
GCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCC
TCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAG
TGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGA
GTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGA
GGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAA
TGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGG
GAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCA
GCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGA
TCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGA
CGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGA
AAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAA
GCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGG
ACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGG
CCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGG
GCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCGGGCAGAGTGGCCCAGCCCCAGGCAGTGCTTCCTGAGCAGACCACCCGGACTGTCTT
TCCTCCACCCGCCCATGGAGAAAGAGCACGCCCGGCCCCGCCCTGTGCTCACCTCTGCCTGGCTCAGCGACCTTCTCAGGCATTCTGCCC
TCCTGGGCCCCTCTCTCCCTGAAGGGGCTTTGTGGCATCTCTGGAAGAGCAGGGTGTGCTGCACTCATGGGCCTGGTCTCACTCCTTGGA
CTTGTCACCTTGTGACATTTGGCTTATCAGCATTTGAGAAGGCTCTGCTGGGTCTCCATGGTGGGGGTCTCTCACCTTCTTGACCCTCTC
TCCATCATTCAGCTGCCAGCCCAGGCTTCACACCCAAGCTGGCTCAGCAGCCGAGCCTGGCACCGAGGGTCCCTGCAGGCTCCCTGGGCA
GGGAGAGGGCCAAGGACAATTGGGAGGGCAGCAGGCAGCCCGCAGATGGTGGCCATGTGGCACGCTGCTGAGACGACACTACCAATAAAC

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_7798nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTC
GCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAA
GTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGAT
AACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTC
AGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTT
CCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGA
GTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAA
TCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCA
GTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCT
GCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGT
GGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTT
TGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACT
GTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCG
ATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGC
ACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTT
GCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAA
AATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCC
GCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGT
CCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAA
AACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACC
AGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCA
GTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGC
ACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCC
TGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTC
TGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGA
GACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAG
TACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGAC
ATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGC
AGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCAC
AGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTC
AGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGA
GGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAA
AGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCC
AGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGC
TGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATC
TGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCA
GCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCA
GACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGG
GGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGG
GTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAG
TAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAG
TCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGC
TTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGG
GCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGAC
ATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAA
GAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTC
CCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGAC
TGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGAT
GTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCG
CATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCG
ATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAAT
AGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTT
AGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAG
AGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAA
ACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCT
GGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCC
CATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCT
GTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCT
GCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTCTCTGAG
TGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCGGGCAGAGTGGC
CCAGCCCCAGGCAGTGCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGCCCATGGAGAAAGAGCACGCCCGGCCCCGCCCTG
TGCTCACCTCTGCCTGGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCTCTCTCCCTGAAGGGGCTTTGTGGCATCTCTGGA
AGAGCAGGGTGTGCTGCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTGTGACATTTGGCTTATCAGCATTTGAGAAGGCTC
TGCTGGGTCTCCATGGTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAGCTGCCAGCCCAGGCTTCACACCCAAGCTGGCTC
AGCAGCCGAGCCTGGCACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCAAGGACAATTGGGAGGGCAGCAGGCAGCCCGCAG

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_7298nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTC
GCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAA
GTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGAT
AACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTC
AGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTT
CCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGA
GTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAA
TCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCA
GTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCT
GCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGT
GGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTT
TGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACT
GTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCG
ATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGC
ACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTT
GCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAA
AATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCC
GCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGT
CCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAA
AACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACC
AGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCA
GTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGC
ACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCC
TGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTC
TGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGA
GACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAG
TACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGAC
ATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGC
AGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCAC
AGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTC
AGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGA
GGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAA
AGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCC
AGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGC
TGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATC
TGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCA
GCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCA
GACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGG
GGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGG
GTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAG
TAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAG
TCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGC
TTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGG
GCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGAC
ATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAA
GAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTC
CCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGAC
TGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGAT
GTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCG
CATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCG
ATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAAT
AGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTT
AGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAG
AGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAA
ACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCT
GGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCC
CATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCT
GTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCT
GCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTCTCTGAG
TGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCGGGCAGAGTGGC

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_7264nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTC
GCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAA
GTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGAT
AACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTC
AGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTT
CCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGA
GTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAA
TCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCA
GTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCT
GCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGT
GGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTT
TGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACT
GTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCG
ATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGC
ACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTT
GCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAA
AATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCC
GCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGT
CCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAA
AACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACC
AGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCA
GTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGC
ACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCC
TGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTC
TGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGA
GACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAG
TACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGAC
ATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGC
AGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCAC
AGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTC
AGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGA
GGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAA
AGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCC
AGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGC
TGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATC
TGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCA
GCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCA
GACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGG
GGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGG
GTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAG
TAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAG
TCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGC
TTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGG
GCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGAC
ATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAA
GAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGG
CGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACA
GCGGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACA
GGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGT
GTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAG
GTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGC
CGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAG
TGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCG
CAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGACTTTTCT
GTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGAATGATCCCCGTTGC
GCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTT
TGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAA
CCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTC
CCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCC

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_6959nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTC
GCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAA
GTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGAT
AACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTC
AGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTT
CCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGA
GTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAA
TCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCA
GTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCT
GCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGT
GGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTT
TGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACT
GTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCG
ATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGC
ACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTT
GCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAA
AATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCC
GCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGT
CCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAA
AACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACC
AGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCA
GTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGC
ACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCC
TGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTC
TGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGA
GACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAG
TACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGAC
ATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGC
AGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCAC
AGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTC
AGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGA
GGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAA
AGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCC
AGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGC
TGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATC
TGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCA
GCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCA
GACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGG
GGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGG
GTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAG
TAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAG
TCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGC
TTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGG
GCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAGTGCTGGAGAC
ATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATTATATCTCCCAA
GAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAA
CACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGAC
CTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGA
CCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGA
AGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCT
CTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTT
TGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGC
TTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCT
TGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCG
GAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACC
CCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCT

>In-frame_NUP214_ENST00000411637_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_6856nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTC
GCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAA
GTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGAT
AACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTC
AGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTT
CCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGA
GTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAA
TCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCA
GTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCT
GCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGT
GGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTT
TGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACT
GTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCG
ATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGC
ACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTT
GCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAA
AATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCC
GCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGT
CCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAA
AACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACC
AGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCA
GTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGC
ACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCC
TGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTC
TGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGA
GACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAG
TACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGAC
ATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGC
AGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCAC
AGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTC
AGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGA
GGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAA
AGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCC
AGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGC
TGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATC
TGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCA
GCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCA
GACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGG
GGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGG
GTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAG
TAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAG
TCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGC
TTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGG
GCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACAATTGCCAGGCT
GCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGA
TCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGT
CACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGT
TCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAAT
GGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTC
ACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTA
TGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGACTTTTCTGTCCTCGGCCCAGAA
GAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGAATGATCCCCGTTGCGCAGCCATCTGTCAT
GGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGA
AGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAA
GAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCG

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_11151nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCC
AGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGT
TGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGA
AGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCA
TACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGG
TGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGA
AGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCA
GCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCAT
CAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTC
GGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCA
CACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACC
AGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTC
ATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGT
GGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGT
GATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGG
TGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGT
AAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGC
CATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCT
AATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAAC
AGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAAT
CACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGG
TGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACC
TGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGG
AGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACC
AACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCC
GGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAAC
TGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAG
TTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATT
CCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTC
ATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCA
GGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTAC
TAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTT
TTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTC
CAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCC
TCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGC
AGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTT
TAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAG
TGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAG
TGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTT
TGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAAC
AGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGA
GATCTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAG
AGAGGTGATGCTGGCATTAACAGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAA
GAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGC
TGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGC
CCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACAC
AAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTG
TCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCT
CAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGT
AACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTC
CTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGA
CATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTC
TGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGA
CCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCC
CGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTT
CGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATC
CCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAG
CCACTTCTTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGG
AAGAGCGGGCAGAGTGGCCCAGCCCCAGGCAGTGCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGCCCATGGAGAAAGAGC
ACGCCCGGCCCCGCCCTGTGCTCACCTCTGCCTGGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCTCTCTCCCTGAAGGGG
CTTTGTGGCATCTCTGGAAGAGCAGGGTGTGCTGCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTGTGACATTTGGCTTAT
CAGCATTTGAGAAGGCTCTGCTGGGTCTCCATGGTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAGCTGCCAGCCCAGGCT
TCACACCCAAGCTGGCTCAGCAGCCGAGCCTGGCACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCAAGGACAATTGGGAGG
GCAGCAGGCAGCCCGCAGATGGTGGCCATGTGGCACGCTGCTGAGACGACACTACCAATAAACCAAACTGCCACGCACACACTGCAGGCT
CACACCCGCACACCTGGTCCTGGCTTGTGGAGGGACTTGCACTGGAGGTATTGCTCTGGCTTGCCTGGGGAAGTGTCACAGATGTGCACA
TGGGCCACACTCAGTGCTGTGGCCTGGCCTGCCGTAGCCTCACACATCTGCCTCAAGAGCCAGCAGCAAACAGCTTTGTGGCATCCTTGG
AGGTTCCCAGTGACTGAGAGGCCTGGGCAGCACTAAGGCCCCTGCTCTGCTCCCTGGCATAGGCCTTGGCCTCCTTGCACAGACTCTCCT
GACAGTCTGGCCTCCTCCCACCTCAGAGGTCCTCTGGCCACCAATTTATACTCTCTCCCCAAGCTGATCCTGAAGGCAGGCAGAGCAGCT
AGGGGCTGGTAACATGTATTCCCATCCCGTGTCCTCACTGGTGTGTCTCCTGGCCATGGGCAAGGGACTCGGGTCATCCCAGGCCCTGGT
CCAGCCAGACACCTGGCCCCACACCTCCCACCAGGCTGCTGTTGCTCAGAAGGAGAATACTGCAGCTGTATGCATCCCCGTGTGTCTTGG
GCCCAGCTCGCTGGGTCAGTCTGCTCCTGTCCCCTCCAGCATGCACTGCCTAGGTCAGCACAGGTTCCTGATCCATGGTGTAGTTAGCCC
TTCCCACCTGGCAGGACGGCCCAGACCACCAGCCAAGCAGGGAAAGGGGGCTGGGCTTGACGGGAGAAGAGACCAGCGACATGGTCGTTG
GGGAGCATTCAGGATGGCGACTTCAGCTGGGGGTCATGCTGAGCACCAACAGGAACTATTCCAGTGAAGAGCAAGTGCTGCCCGACCCAG
GACCCTGTGCCAGGCTAGCAGCCCTCCAGCTCCCTCCAGAGAGGAAACCTCTGTCTGGCTGAGGGTGGGACTAGCTGGGATGTCTCACTC
CAGTTGCTCAGGTTCACCCAGGAAGCTCCTCCGTGGAGTGGCCAGCCTGATTCTAGCCCTGTCCTCTCTGGCAGCACATGCCACACCTGC
CTGGGCCTTCTGCTCCCTGATGCTTGATGAGCCCCTGCCTCCTCAATGTTTCTCAAAGACAGACCCCCCTGAGGCCAGCTTGAATGTGAA
GACTGCTGAAGTTAGCTGGCTTCACTTGAGCTGCAGAAAAGGTGGCTGGGATGGCCCAGGTGCACCCAGAGGCCCCAGCCCTTTGGCTGC
CTTTGGGTTGTGACTTGGGTTGTCTCTGAGGCCCTGCCAGAGCTGGGCCTGCGGGTGGTGGGCGGTCCGACCTCGGGCAGTCAGTGCTCC
GCAGCCTCAGCACTGCATCCCAGACCCAGTGTCCTCAGAGGGAAGAGCCAGCCTCCCTGCCTCATGGAACCAGGAGTCCCAAAAAGTCAG
GAGCCTGGAGGCTCTGAAAGGAGCAGGGATTCCATAGTGCGTGAAGCTGAAATAGGCGCCCTCCTGGGGAGCCCCCAGCAAAACTGTTTT
TCATACCCACTCCCAGAACTGCCCCGCTCCAGCTCCAGCGCCAGCGCCAGCTGGTTGCCAGGCATCATTGGAGAGGCCTGGCTGCCCCAG
GGGCAGCAGGGAGTGGTGGACCTGTATGGGCTGGCAGGAGGCCATTGGCCATGCTGACAAGTGTCACCTGCCTTCCTAGCCTGGAGCCAC
CCCTCAGGTGGCCTGCTTGCACCTCCTATCCGGAGGTAGCCTGCCCCACCTGTAGGCAGAGGGGGCTCTTGCTTGAGGCCTGCACAGGAA
GCAAGTATAGCCCCGGTGCCCCAGAGTGGGTTCCACTTAGCCCTGGCGAGATGGCCTGTCCTGAGATCTCTGCTCCCAGACCCCACCATC
TGGGGAGCACAGTCCTTAGGCTGCCTGGTCCAGGAAGGGGGTGCGGCTCTGTCAGGAAACCTGGACTCTCAAGGCCCACCAGCCTCTCCG
TGAGTGTTAGAAATCACAGATACAGTATATACTTAATTACACTAAATTATTGCTGGGATTCCTTATAAGCACTAATTATACCTGATTATA
GGTTAAAATATTTATTTTGTCAAAATATTTTCTTGGGAATGTGTTTAACCCTTTCTGCGTTCATTGTTGCTGAGATGTGAAAACTAACCA
TTCCCTCCTGCCTACCTTTTTGGCCACTGGGCGGCAGAGAATGGCGCTATGTGCAGTTGGGCCCCTGGCACCATGGGCCTTTGGCCTGCC
TGCTGCAGAGTAGCCCTGCCTGGGCAGTCTCCAGGCACTGAGCAGGCCATCTGTGGCCAGGCTGAGAGAATGACTGGCTCGCTTACCAGC
GTGCATGGGACAAGGAGCTTTGGAGCCTCAAGGGGTTGTTGCTGGCCTGGGCTAGAGGGAAAGGTGACCATCCGTCTGTCCTCCTGTCTT
TCTATTAGCGCCTCCATGTGAGTGATGGTGCCTTGGTTCACTAGCCTTCCCCCACCACCCCACCATGCCACCTGGTGGTCTTGGGGCCTG
TGCTGTCACTCCAGCCCCTGGGGAGGAGAGGACCCAGCCCGGAGAGTTGGGGCAAGGGCTCCACATGGCCCAAGGGCAACAGATGCTCGC
AGGGCAGCTGCTGCCGATGCTCACGCTCCTGCCCCCCTCCTTCCCGCTGCCACACCCCACCCTGGGCCCCCGCAGACACGCATCTCTAAC
TCAGTTGGGCCCAGCCTTCTGGATGGCTTGGGGTAGGCCATGGGCCCACCTGGGGCCAGGCCAGCCCCTGGGGCAGCTCTGGAAGAGCAG
TGTGGAGGAGCACTTGCTTGCAGCCTGGCTTCAGCCTCTGGCACTGCTGGAGTGGTCCCTGGGAGCTTCTGCACTGTCGGCTTTGGGGAC
GTCTCACCCACTTGGGTTACAGTAGGCCTTCCCCACCCAGAGAGAAGTGTTTCCACCCCAGAGACATTGTCTGTCAGCCCCTGAAGTGCT
CGCCTCCCCCAGTGCCCGTCACCAGCCCTTCCTATCTGTGGGGTCCAAGTCAGGCTTCCCCTGCGGCCACCAGCCATAGGGAGCAGCCAT
CAGCCCCCGAGTCAGAACTGCTTCTGTCTGTCCATACCTCCAGGCTCTCCCGGAGAGGGGGACGGATATTTATTTCCTAAAGTTTGCACT
TAATTGTGAGGATTCTCAGGATTGTTGGGGGCTACTGAAAAGAGGAATGTGTTGAATGTCGCGTTTGCTGTCCACTCGTCCTAGAAGTTT
AGTGTTTTTGTCACTGTCATGTGTTTCTGTGGGCAGAGCTGGTTCTGGAGGGTGGGTCAGTGCACCCGAGGCTCAGAGCATCCATCCACC

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_7990nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCC
AGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGT
TGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGA
AGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCA
TACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGG
TGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGA
AGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCA
GCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCAT
CAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTC
GGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCA
CACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACC
AGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTC
ATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGT
GGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGT
GATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGG
TGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGT
AAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGC
CATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCT
AATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAAC
AGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAAT
CACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGG
TGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACC
TGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGG
AGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACC
AACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCC
GGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAAC
TGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAG
TTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATT
CCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTC
ATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCA
GGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTAC
TAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTT
TTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTC
CAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCC
TCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGC
AGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTT
TAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAG
TGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAG
TGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTT
TGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAAC
AGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGA
GATCTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAG
AGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCAT
CGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGC
TGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGA
CTTGGACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCA
GAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCAC
AGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAAT
GGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCT
CATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTT
CGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCC
AGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGAC
AGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTT
GGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGA
AGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGT
CACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCC
TGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTC
CCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGT
TTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGTGGGACAAC
TGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCGGGCAGAGTGGCCCAGCCCCAGGC
AGTGCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGCCCATGGAGAAAGAGCACGCCCGGCCCCGCCCTGTGCTCACCTCTG
CCTGGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCTCTCTCCCTGAAGGGGCTTTGTGGCATCTCTGGAAGAGCAGGGTGT
GCTGCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTGTGACATTTGGCTTATCAGCATTTGAGAAGGCTCTGCTGGGTCTCC
ATGGTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAGCTGCCAGCCCAGGCTTCACACCCAAGCTGGCTCAGCAGCCGAGCC
TGGCACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCAAGGACAATTGGGAGGGCAGCAGGCAGCCCGCAGATGGTGGCCATG

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_7831nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCC
AGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGT
TGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGA
AGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCA
TACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGG
TGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGA
AGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCA
GCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCAT
CAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTC
GGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCA
CACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACC
AGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTC
ATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGT
GGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGT
GATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGG
TGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGT
AAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGC
CATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCT
AATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAAC
AGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAAT
CACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGG
TGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACC
TGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGG
AGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACC
AACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCC
GGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAAC
TGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAG
TTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATT
CCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTC
ATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCA
GGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTAC
TAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTT
TTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTC
CAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCC
TCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGC
AGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTT
TAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAG
TGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAG
TGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTT
TGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAAC
AGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGA
GATCTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAG
AGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCAT
CGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCC
TGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTA
CTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGT
CGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGA
GCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCA
TGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGG
AGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCC
CCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCC
CCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGT
CGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGT
GTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGC
TGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTC
AGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACT
GGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGT
CAGGACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCC
ATGTTTCCTCCCAGGAAGAGCGGGCAGAGTGGCCCAGCCCCAGGCAGTGCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGC
CCATGGAGAAAGAGCACGCCCGGCCCCGCCCTGTGCTCACCTCTGCCTGGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCT
CTCTCCCTGAAGGGGCTTTGTGGCATCTCTGGAAGAGCAGGGTGTGCTGCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTG
TGACATTTGGCTTATCAGCATTTGAGAAGGCTCTGCTGGGTCTCCATGGTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAG
CTGCCAGCCCAGGCTTCACACCCAAGCTGGCTCAGCAGCCGAGCCTGGCACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCA
AGGACAATTGGGAGGGCAGCAGGCAGCCCGCAGATGGTGGCCATGTGGCACGCTGCTGAGACGACACTACCAATAAACCAAACTGCCACG

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_7331nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCC
AGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGT
TGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGA
AGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCA
TACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGG
TGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGA
AGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCA
GCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCAT
CAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTC
GGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCA
CACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACC
AGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTC
ATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGT
GGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGT
GATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGG
TGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGT
AAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGC
CATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCT
AATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAAC
AGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAAT
CACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGG
TGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACC
TGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGG
AGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACC
AACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCC
GGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAAC
TGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAG
TTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATT
CCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTC
ATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCA
GGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTAC
TAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTT
TTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTC
CAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCC
TCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGC
AGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTT
TAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAG
TGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAG
TGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTT
TGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAAC
AGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGA
GATCTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAG
AGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCAT
CGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCC
TGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTA
CTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGT
CGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGA
GCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCA
TGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGG
AGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCC
CCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCC
CCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGT
CGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGT
GTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGC
TGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTC
AGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACT
GGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGT
CAGGACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCC

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_7297nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCC
AGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGT
TGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGA
AGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCA
TACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGG
TGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGA
AGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCA
GCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCAT
CAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTC
GGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCA
CACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACC
AGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTC
ATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGT
GGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGT
GATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGG
TGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGT
AAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGC
CATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCT
AATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAAC
AGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAAT
CACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGG
TGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACC
TGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGG
AGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACC
AACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCC
GGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAAC
TGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAG
TTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATT
CCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTC
ATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCA
GGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTAC
TAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTT
TTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTC
CAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCC
TCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGC
AGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTT
TAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAG
TGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAG
TGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTT
TGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAAC
AGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGA
GATCTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAG
AGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCAT
CGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGC
TGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGA
CTTGGACGCTCTGTCTCCCATACACACACCACAGCGGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCAT
GTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCAT
GCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGT
CTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGA
CAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCT
TGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGC
CCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGA
CAATCGAAAACAGAGTTCAGAAGGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAG
CTGGCTTATAACCCAAGGAATGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGA
TGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTC
GCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGC
AGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACA
CGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTC

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_6992nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCC
AGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGT
TGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGA
AGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCA
TACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGG
TGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGA
AGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCA
GCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCAT
CAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTC
GGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCA
CACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACC
AGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTC
ATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGT
GGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGT
GATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGG
TGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGT
AAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGC
CATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCT
AATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAAC
AGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAAT
CACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGG
TGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACC
TGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGG
AGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACC
AACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCC
GGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAAC
TGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAG
TTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATT
CCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTC
ATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCA
GGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTAC
TAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTT
TTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTC
CAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCC
TCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGC
AGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTT
TAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAG
TGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAG
TGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTT
TGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAAC
AGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGA
GATCTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAG
AGAGGTGATGCTGGCATTAACAGTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCAT
CGACAGTGTTCTGGTCAAAATTATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGATTGCCAG
GCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATC
TGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGA
GGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATC
CGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCC
AATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAG
TTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAAC
CTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGAAGGGTGATGATCTGGAGGA
GGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGA
GGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTT
TGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACAC

>In-frame_NUP214_ENST00000451030_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_6889nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGA
CTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTT
GCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGT
TCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCAT
TATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGG
AGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGT
CACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGT
GGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCA
TCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCC
AGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCAC
GGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCT
TGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGA
CTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCT
CATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCG
ACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGC
TTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCC
CACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTC
CAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGT
GGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAA
TATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCC
TGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACC
TCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCC
AGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGT
TGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGA
AGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCA
TACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGG
TGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGA
AGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCA
GCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCAT
CAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTC
GGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCA
CACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACC
AGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTC
ATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGT
GGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGT
GATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGG
TGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGT
AAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGC
CATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCT
AATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAAC
AGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAAT
CACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGG
TGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACC
TGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGG
AGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACC
AACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCC
GGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAAC
TGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAG
TTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATT
CCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTC
ATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCA
GGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTAC
TAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTT
TTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTC
CAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCC
TCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGC
AGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTT
TAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAG
TGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAG
TGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTT
TGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAAC
AGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGA
GATCTGTGACATCATCAATGAGACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAG
AGAGGTGATGCTGGCATTAACAATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAAC
AGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGT
GGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGA
GAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCT
GGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTT
GGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAA
CTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAG
TTCAGAAGGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCA
AGGAATGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGG
TGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGC
TCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGC

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000581396_chr17_17810845_-_7619nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCT
GCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAAT
TTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTAT
GAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCT
GTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCT
TTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACA
AGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAG
CCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCA
GTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAG
ACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGC
CTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCA
GGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGAC
TCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCA
GAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCT
GTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCT
CCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCA
GCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTG
TTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACC
ACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTC
AGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCC
TCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCT
TTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGC
TTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAG
ACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACA
GCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCC
ATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAA
TCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGC
CCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTA
ACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATC
GTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATAC
GAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGAC
CTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGAC
TTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGA
AACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAG
AGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAG
GAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATG
GAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGG
TTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCAC
ACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGT
GGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCGGGCAGAGTGGCCCAG
CCCCAGGCAGTGCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGCCCATGGAGAAAGAGCACGCCCGGCCCCGCCCTGTGCT
CACCTCTGCCTGGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCTCTCTCCCTGAAGGGGCTTTGTGGCATCTCTGGAAGAG
CAGGGTGTGCTGCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTGTGACATTTGGCTTATCAGCATTTGAGAAGGCTCTGCT
GGGTCTCCATGGTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAGCTGCCAGCCCAGGCTTCACACCCAAGCTGGCTCAGCA
GCCGAGCCTGGCACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCAAGGACAATTGGGAGGGCAGCAGGCAGCCCGCAGATGG
TGGCCATGTGGCACGCTGCTGAGACGACACTACCAATAAACCAAACTGCCACGCACACACTGCAGGCTCACACCCGCACACCTGGTCCTG
GCTTGTGGAGGGACTTGCACTGGAGGTATTGCTCTGGCTTGCCTGGGGAAGTGTCACAGATGTGCACATGGGCCACACTCAGTGCTGTGG
CCTGGCCTGCCGTAGCCTCACACATCTGCCTCAAGAGCCAGCAGCAAACAGCTTTGTGGCATCCTTGGAGGTTCCCAGTGACTGAGAGGC
CTGGGCAGCACTAAGGCCCCTGCTCTGCTCCCTGGCATAGGCCTTGGCCTCCTTGCACAGACTCTCCTGACAGTCTGGCCTCCTCCCACC
TCAGAGGTCCTCTGGCCACCAATTTATACTCTCTCCCCAAGCTGATCCTGAAGGCAGGCAGAGCAGCTAGGGGCTGGTAACATGTATTCC
CATCCCGTGTCCTCACTGGTGTGTCTCCTGGCCATGGGCAAGGGACTCGGGTCATCCCAGGCCCTGGTCCAGCCAGACACCTGGCCCCAC
ACCTCCCACCAGGCTGCTGTTGCTCAGAAGGAGAATACTGCAGCTGTATGCATCCCCGTGTGTCTTGGGCCCAGCTCGCTGGGTCAGTCT
GCTCCTGTCCCCTCCAGCATGCACTGCCTAGGTCAGCACAGGTTCCTGATCCATGGTGTAGTTAGCCCTTCCCACCTGGCAGGACGGCCC
AGACCACCAGCCAAGCAGGGAAAGGGGGCTGGGCTTGACGGGAGAAGAGACCAGCGACATGGTCGTTGGGGAGCATTCAGGATGGCGACT
TCAGCTGGGGGTCATGCTGAGCACCAACAGGAACTATTCCAGTGAAGAGCAAGTGCTGCCCGACCCAGGACCCTGTGCCAGGCTAGCAGC
CCTCCAGCTCCCTCCAGAGAGGAAACCTCTGTCTGGCTGAGGGTGGGACTAGCTGGGATGTCTCACTCCAGTTGCTCAGGTTCACCCAGG
AAGCTCCTCCGTGGAGTGGCCAGCCTGATTCTAGCCCTGTCCTCTCTGGCAGCACATGCCACACCTGCCTGGGCCTTCTGCTCCCTGATG
CTTGATGAGCCCCTGCCTCCTCAATGTTTCTCAAAGACAGACCCCCCTGAGGCCAGCTTGAATGTGAAGACTGCTGAAGTTAGCTGGCTT
CACTTGAGCTGCAGAAAAGGTGGCTGGGATGGCCCAGGTGCACCCAGAGGCCCCAGCCCTTTGGCTGCCTTTGGGTTGTGACTTGGGTTG
TCTCTGAGGCCCTGCCAGAGCTGGGCCTGCGGGTGGTGGGCGGTCCGACCTCGGGCAGTCAGTGCTCCGCAGCCTCAGCACTGCATCCCA
GACCCAGTGTCCTCAGAGGGAAGAGCCAGCCTCCCTGCCTCATGGAACCAGGAGTCCCAAAAAGTCAGGAGCCTGGAGGCTCTGAAAGGA
GCAGGGATTCCATAGTGCGTGAAGCTGAAATAGGCGCCCTCCTGGGGAGCCCCCAGCAAAACTGTTTTTCATACCCACTCCCAGAACTGC
CCCGCTCCAGCTCCAGCGCCAGCGCCAGCTGGTTGCCAGGCATCATTGGAGAGGCCTGGCTGCCCCAGGGGCAGCAGGGAGTGGTGGACC
TGTATGGGCTGGCAGGAGGCCATTGGCCATGCTGACAAGTGTCACCTGCCTTCCTAGCCTGGAGCCACCCCTCAGGTGGCCTGCTTGCAC
CTCCTATCCGGAGGTAGCCTGCCCCACCTGTAGGCAGAGGGGGCTCTTGCTTGAGGCCTGCACAGGAAGCAAGTATAGCCCCGGTGCCCC
AGAGTGGGTTCCACTTAGCCCTGGCGAGATGGCCTGTCCTGAGATCTCTGCTCCCAGACCCCACCATCTGGGGAGCACAGTCCTTAGGCT
GCCTGGTCCAGGAAGGGGGTGCGGCTCTGTCAGGAAACCTGGACTCTCAAGGCCCACCAGCCTCTCCGTGAGTGTTAGAAATCACAGATA
CAGTATATACTTAATTACACTAAATTATTGCTGGGATTCCTTATAAGCACTAATTATACCTGATTATAGGTTAAAATATTTATTTTGTCA
AAATATTTTCTTGGGAATGTGTTTAACCCTTTCTGCGTTCATTGTTGCTGAGATGTGAAAACTAACCATTCCCTCCTGCCTACCTTTTTG
GCCACTGGGCGGCAGAGAATGGCGCTATGTGCAGTTGGGCCCCTGGCACCATGGGCCTTTGGCCTGCCTGCTGCAGAGTAGCCCTGCCTG
GGCAGTCTCCAGGCACTGAGCAGGCCATCTGTGGCCAGGCTGAGAGAATGACTGGCTCGCTTACCAGCGTGCATGGGACAAGGAGCTTTG
GAGCCTCAAGGGGTTGTTGCTGGCCTGGGCTAGAGGGAAAGGTGACCATCCGTCTGTCCTCCTGTCTTTCTATTAGCGCCTCCATGTGAG
TGATGGTGCCTTGGTTCACTAGCCTTCCCCCACCACCCCACCATGCCACCTGGTGGTCTTGGGGCCTGTGCTGTCACTCCAGCCCCTGGG
GAGGAGAGGACCCAGCCCGGAGAGTTGGGGCAAGGGCTCCACATGGCCCAAGGGCAACAGATGCTCGCAGGGCAGCTGCTGCCGATGCTC
ACGCTCCTGCCCCCCTCCTTCCCGCTGCCACACCCCACCCTGGGCCCCCGCAGACACGCATCTCTAACTCAGTTGGGCCCAGCCTTCTGG
ATGGCTTGGGGTAGGCCATGGGCCCACCTGGGGCCAGGCCAGCCCCTGGGGCAGCTCTGGAAGAGCAGTGTGGAGGAGCACTTGCTTGCA
GCCTGGCTTCAGCCTCTGGCACTGCTGGAGTGGTCCCTGGGAGCTTCTGCACTGTCGGCTTTGGGGACGTCTCACCCACTTGGGTTACAG
TAGGCCTTCCCCACCCAGAGAGAAGTGTTTCCACCCCAGAGACATTGTCTGTCAGCCCCTGAAGTGCTCGCCTCCCCCAGTGCCCGTCAC
CAGCCCTTCCTATCTGTGGGGTCCAAGTCAGGCTTCCCCTGCGGCCACCAGCCATAGGGAGCAGCCATCAGCCCCCGAGTCAGAACTGCT
TCTGTCTGTCCATACCTCCAGGCTCTCCCGGAGAGGGGGACGGATATTTATTTCCTAAAGTTTGCACTTAATTGTGAGGATTCTCAGGAT
TGTTGGGGGCTACTGAAAAGAGGAATGTGTTGAATGTCGCGTTTGCTGTCCACTCGTCCTAGAAGTTTAGTGTTTTTGTCACTGTCATGT
GTTTCTGTGGGCAGAGCTGGTTCTGGAGGGTGGGTCAGTGCACCCGAGGCTCAGAGCATCCATCCACCCCACTGGCCCTCCTTCCAGATA

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000379504_chr17_17810845_-_4458nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCT
GCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAAT
TTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTAT
GAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCT
GTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCT
TTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACA
AGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAG
CCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCA
GTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAG
ACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGC
CTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCA
GGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGAC
TCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCA
GAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCT
GTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCT
CCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCA
GCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTG
TTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACC
ACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTC
AGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCC
TCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCT
TTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGC
TTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAG
ACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACA
GTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATT
ATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCCTTTCGAAGCAGTCCT
GATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATA
CACACACCACAGCGGAGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTAT
TCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCC
AGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCA
TCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAG
GAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGA
TCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGC
CCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTC
AGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTA
ACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCA
TCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAA
TTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCT
GGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTC
GCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGT
CTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTCTTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCC
TCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCGGGCAGAGTGGCCCAGCCCCAGGCAGTGCTTCCTGAGCAGACCACC
CGGACTGTCTTTCCTCCACCCGCCCATGGAGAAAGAGCACGCCCGGCCCCGCCCTGTGCTCACCTCTGCCTGGCTCAGCGACCTTCTCAG
GCATTCTGCCCTCCTGGGCCCCTCTCTCCCTGAAGGGGCTTTGTGGCATCTCTGGAAGAGCAGGGTGTGCTGCACTCATGGGCCTGGTCT
CACTCCTTGGACTTGTCACCTTGTGACATTTGGCTTATCAGCATTTGAGAAGGCTCTGCTGGGTCTCCATGGTGGGGGTCTCTCACCTTC
TTGACCCTCTCTCCATCATTCAGCTGCCAGCCCAGGCTTCACACCCAAGCTGGCTCAGCAGCCGAGCCTGGCACCGAGGGTCCCTGCAGG
CTCCCTGGGCAGGGAGAGGGCCAAGGACAATTGGGAGGGCAGCAGGCAGCCCGCAGATGGTGGCCATGTGGCACGCTGCTGAGACGACAC

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000318094_chr17_17810845_-_4299nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCT
GCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAAT
TTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTAT
GAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCT
GTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCT
TTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACA
AGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAG
CCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCA
GTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAG
ACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGC
CTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCA
GGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGAC
TCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCA
GAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCT
GTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCT
CCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCA
GCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTG
TTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACC
ACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTC
AGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCC
TCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCT
TTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGC
TTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAG
ACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACA
GTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATT
ATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTGGATCCAGCTGCGACC
ATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCT
CTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTC
ATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCC
ATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAAC
GTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAA
GACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAG
CTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTT
GCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTA
GACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAG
GGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTC
CCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTG
TGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCT
CCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTC
TTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCG
GGCAGAGTGGCCCAGCCCCAGGCAGTGCTTCCTGAGCAGACCACCCGGACTGTCTTTCCTCCACCCGCCCATGGAGAAAGAGCACGCCCG
GCCCCGCCCTGTGCTCACCTCTGCCTGGCTCAGCGACCTTCTCAGGCATTCTGCCCTCCTGGGCCCCTCTCTCCCTGAAGGGGCTTTGTG
GCATCTCTGGAAGAGCAGGGTGTGCTGCACTCATGGGCCTGGTCTCACTCCTTGGACTTGTCACCTTGTGACATTTGGCTTATCAGCATT
TGAGAAGGCTCTGCTGGGTCTCCATGGTGGGGGTCTCTCACCTTCTTGACCCTCTCTCCATCATTCAGCTGCCAGCCCAGGCTTCACACC
CAAGCTGGCTCAGCAGCCGAGCCTGGCACCGAGGGTCCCTGCAGGCTCCCTGGGCAGGGAGAGGGCCAAGGACAATTGGGAGGGCAGCAG

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000395739_chr17_17810845_-_3799nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCT
GCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAAT
TTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTAT
GAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCT
GTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCT
TTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACA
AGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAG
CCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCA
GTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAG
ACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGC
CTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCA
GGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGAC
TCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCA
GAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCT
GTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCT
CCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCA
GCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTG
TTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACC
ACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTC
AGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCC
TCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCT
TTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGC
TTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAG
ACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACA
GTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATT
ATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGAGTGTCCCTGAAGTGGATCCAGCTGCGACC
ATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGTTCCTATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCT
CTGAGTGTGACTGGCCCCATCACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTC
ATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCC
ATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAAC
GTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAA
GACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAG
CTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTT
GCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTA
GACAATCGAAAACAGAGTTCAGAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAG
GGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTC
CCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTG
TGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCT
CCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCACCGTGTCTGCTCCCAGGCCTCCCACTAGTCAGGACCAGCTTCAGCCACTTC
TTTTCTCTGAGTGGTGGGACAACTGCAGCCAGAGACTCTCTCCCCTCCCACCATGGGCCCCTCTGCCCATGTTTCCTCCCAGGAAGAGCG

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000535933_chr17_17810845_-_3765nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCT
GCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAAT
TTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTAT
GAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCT
GTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCT
TTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACA
AGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAG
CCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCA
GTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAG
ACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGC
CTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCA
GGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGAC
TCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCA
GAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCT
GTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCT
CCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCA
GCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTG
TTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACC
ACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTC
AGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCC
TCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCT
TTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGC
TTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAG
ACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACA
GTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATT
ATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGGCATGGGCTGATGCCTTTCGAAGCAGTCCT
GATCTCACCGGCGTTGTGCACATATATGAGGAGCTGAAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATA
CACACACCACAGCGGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATG
GTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTC
ATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTC
GAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCA
GGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACA
GAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTG
GCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAA
GGGACTTTTCTGTCCTCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGAATG
ATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACA
AGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCC
CCAGCCTCAAACCCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCA
GATGGCGGGTCCCCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCC

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000540946_chr17_17810845_-_3460nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCT
GCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAAT
TTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTAT
GAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCT
GTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCT
TTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACA
AGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAG
CCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCA
GTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAG
ACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGC
CTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCA
GGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGAC
TCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCA
GAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCT
GTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCT
CCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCA
GCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTG
TTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACC
ACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTC
AGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCC
TCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCT
TTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGC
TTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAG
ACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACA
GTGCTGGAGACATGTGTGAAGAACTGTGGCCACCGCTTCCACATCCTTGTGGCCAACCGAGATTTCATCGACAGTGTTCTGGTCAAAATT
ATATCTCCCAAGAACAACCCTCCCACCATTGTACAGGACAAAGTGCTTGCTCTGATCCAGATTGCCAGGCTGCGGAGTGAACTGGACGTC
GTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAG
CTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGGTCACCGAGGAGCTGCTGCAT
GTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGA
GTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCC
CCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCAATGTAATCCC
CGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAGACGGTAACCTATGAGGATCCTCAGGCTGTC
GGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTT
GATAAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAAC
CCTTCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCC
CCGCTCGCACCCCGTGGACACCGGGCACTGGCCACTCCTACATCCCCAGCTCCACACGGCCTGCACACCTGTGTTTCCATGGAAATGCCA

>In-frame_NUP214_ENST00000483497_chr9_134072803_+_TOM1L2_ENST00000542206_chr17_17810845_-_3357nt
GTCTTGTCGGCTCCTGTGTGTAGGAGGGATTTCGGCCTGAGAGCGGGCCGAGGAGATTGGCGACGGTGTCGCCCGTGTTTTCGTTGGCGG
GTGCCTGGGCTGGTGGGAACAGCCGCCCGAAGGAAGCACCATGATTTCGGCCGCGCAGTTGTTGGATGAGTTAATGGGCCGGGACCGAAA
CCTAGCCCCGGACGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCT
GCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAAT
TTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTAT
GAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCT
GTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCT
TTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACA
AGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAG
CCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCA
GTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAG
ACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGC
CTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCA
GGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGAC
TCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCA
GAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCT
GTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCT
CCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCA
GCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTG
TTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACC
ACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTC
AGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCC
TCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCT
TTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGC
TTTTGCCAAGCTTCAGAAAAGGCAACAGATGGCTCCCTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAG
ACGGAGGAAGGGCCAAAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCATTAACA
ATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGTCATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAG
GATTCATCTGATCTGGAGTTGCTGCAGGAGCTCAACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCC
AATGAGGAGGTCACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACGATACAGGTCT
GGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTAATAGACCTGGGGCCAGGGTCTCCAGCCGTG
GTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCCTCTCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGC
ACCCTCAGTTCACTCCAGCAATGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAG
ACGGTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTTCAGAAGGGACTTTTCTGTCC
TCGGCCCAGAAGAGAGGTAGAGGTGGGGAGTCTGACCTGGAGCCCATAGACAGCTGGCTTATAACCCAAGGAATGATCCCCGTTGCGCAG
CCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAAGGGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGAT
AAATTCCTTGAAGAAAGAGCCAAAGCTGCTGAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCT
TCTGGCCGGAAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGAGCAGCTCTGTGGTTTGCCTCCCCAGATGGCGGGTCCCCG


Top

FusionGenePPI for NUP214_TOM1L2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NUP214ZFP36, XPO1, NUP107, NXF2, NXF1, XPO5, IPO5, G3BP1, G3BP2, RAE1, APC, HDAC4, HDAC5, HDAC9, NUP88, SMAD1, CLEC4G, SMAD2, SMAD3, SMAD4, SIRT7, RANBP2, CUL3, CUL2, NUPL2, NUP214, ACOT13, PNPT1, HSPA1L, VPS4B, S100A6, EEF1A1, STRIP1, RPL19, NDUFA7, ITGA4, SOX2, LMNA, FBXO6, CUL7, OBSL1, NUP62, CLEC11A, DDX19A, KCMF1, CFL1, CSRP1, DYNC1LI1, TRIM28, TXNDC9, NTRK1, IFI16, NUP85, NUP35, KPNB1, UBE2I, NUPL1, NUP153, SEH1L, C11orf30, CDH1, RAN, FXR2, EMILIN1, SERPINB2, BRCA1TOM1L2TOLLIP, NEDD4, CLTC, APP, AHCYL1, LAGE3, IGBP1, SULT1A1, RCN1, SIN3A, S100A4, DSTN, DFFA, UBA2, S100A6, SRXN1, SERPINH1, UBC, LAPTM5, RNF11, MYO6, BAG3, MAP3K1, AGL, XPO1, SMURF1, CUEDC1, SZRD1, NDUFA6, WBP2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NUP214_TOM1L2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NUP214_TOM1L2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource