FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 25224

FusionGeneSummary for NUP214_CACNA1B

check button Fusion gene summary
Fusion gene informationFusion gene name: NUP214_CACNA1B
Fusion gene ID: 25224
HgeneTgene
Gene symbol

NUP214

CACNA1B

Gene ID

8021

774

Gene namenucleoporin 214calcium voltage-gated channel subunit alpha1 B
SynonymsCAIN|CANBIII|CACNL1A5|CACNN|Cav2.2|DYT23
Cytomap

9q34.13

9q34.3

Type of geneprotein-codingprotein-coding
Descriptionnuclear pore complex protein Nup214CAN protein, putative oncogenenucleoporin 214kDavoltage-dependent N-type calcium channel subunit alpha-1BCav2.2 voltage-gated Ca2+ channelbrain calcium channel IIIcalcium channel alpha12.2 subunitcalcium channel, L type, alpha-1 polypeptidecalcium channel, voltage-dependent, L type, alpha 1B subun
Modification date2018052320180523
UniProtAcc

P35658

Q00975

Ensembl transtripts involved in fusion geneENST00000359428, ENST00000411637, 
ENST00000451030, ENST00000483497, 
ENST00000465486, 
ENST00000277551, 
ENST00000371372, ENST00000277549, 
ENST00000371363, ENST00000371355, 
ENST00000371357, ENST00000277550, 
ENST00000371367, ENST00000545473, 
ENST00000371365, 
Fusion gene scores* DoF score11 X 11 X 4=4845 X 6 X 3=90
# samples 115
** MAII scorelog2(11/484*10)=-2.13750352374993
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/90*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NUP214 [Title/Abstract] AND CACNA1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-24-1849-01ANUP214chr9

134039531

+CACNA1Bchr9

141006850

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000359428ENST00000277551NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000359428ENST00000371372NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000359428ENST00000277549NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000359428ENST00000371363NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000359428ENST00000371355NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000359428ENST00000371357NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-intronENST00000359428ENST00000277550NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-intronENST00000359428ENST00000371367NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-intronENST00000359428ENST00000545473NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-3UTRENST00000359428ENST00000371365NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000411637ENST00000277551NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000411637ENST00000371372NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000411637ENST00000277549NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000411637ENST00000371363NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000411637ENST00000371355NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000411637ENST00000371357NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-intronENST00000411637ENST00000277550NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-intronENST00000411637ENST00000371367NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-intronENST00000411637ENST00000545473NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-3UTRENST00000411637ENST00000371365NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000451030ENST00000277551NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000451030ENST00000371372NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000451030ENST00000277549NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000451030ENST00000371363NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000451030ENST00000371355NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
In-frameENST00000451030ENST00000371357NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-intronENST00000451030ENST00000277550NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-intronENST00000451030ENST00000371367NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-intronENST00000451030ENST00000545473NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
5CDS-3UTRENST00000451030ENST00000371365NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000483497ENST00000277551NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000483497ENST00000371372NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000483497ENST00000277549NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000483497ENST00000371363NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000483497ENST00000371355NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000483497ENST00000371357NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-intronENST00000483497ENST00000277550NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-intronENST00000483497ENST00000371367NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-intronENST00000483497ENST00000545473NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3UTRENST00000483497ENST00000371365NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000465486ENST00000277551NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000465486ENST00000371372NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000465486ENST00000277549NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000465486ENST00000371363NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000465486ENST00000371355NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3CDSENST00000465486ENST00000371357NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-intronENST00000465486ENST00000277550NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-intronENST00000465486ENST00000371367NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-intronENST00000465486ENST00000545473NUP214chr9

134039531

+CACNA1Bchr9

141006850

+
intron-3UTRENST00000465486ENST00000371365NUP214chr9

134039531

+CACNA1Bchr9

141006850

+

Top

FusionProtFeatures for NUP214_CACNA1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NUP214

P35658

CACNA1B

Q00975

May serve as a docking site in the receptor-mediatedimport of substrates across the nuclear pore complex.{ECO:0000303|PubMed:8108440}. Voltage-sensitive calcium channels (VSCC) mediate theentry of calcium ions into excitable cells and are also involvedin a variety of calcium-dependent processes, including musclecontraction, hormone or neurotransmitter release, gene expression,cell motility, cell division and cell death. The isoform alpha-1Bgives rise to N-type calcium currents. N-type calcium channelsbelong to the 'high-voltage activated' (HVA) group and arespecifically blocked by omega-conotoxin-GVIA (AC P01522) (ACP01522) (By similarity). They are however insensitive todihydropyridines (DHP). Calcium channels containing alpha-1Bsubunit may play a role in directed migration of immature neurons.{ECO:0000250|UniProtKB:Q02294}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+213641_4049642091RegionNote=Seven-bladed beta propeller
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+2136740_7689642091RegionNote=Leucine-zipper 1
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+2136861_8829642091RegionNote=Leucine-zipper 2
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+213641_4049542081RegionNote=Seven-bladed beta propeller
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+2136740_7689542081RegionNote=Leucine-zipper 1
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+2136861_8829542081RegionNote=Leucine-zipper 2
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+213641_4049652092RegionNote=Seven-bladed beta propeller
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+2136740_7689652092RegionNote=Leucine-zipper 1
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+2136861_8829652092RegionNote=Leucine-zipper 2
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+2136151_1939642091RepeatNote=Blade 3
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+2136194_2399642091RepeatNote=Blade 4
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+2136240_3039642091RepeatNote=Blade 5
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+2136304_3599642091RepeatNote=Blade 6
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+2136360_4049642091RepeatNote=Blade 7
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+213641_939642091RepeatNote=Blade 1
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+213694_1509642091RepeatNote=Blade 2
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+2136151_1939542081RepeatNote=Blade 3
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+2136194_2399542081RepeatNote=Blade 4
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+2136240_3039542081RepeatNote=Blade 5
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+2136304_3599542081RepeatNote=Blade 6
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+2136360_4049542081RepeatNote=Blade 7
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+213641_939542081RepeatNote=Blade 1
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+213694_1509542081RepeatNote=Blade 2
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+2136151_1939652092RepeatNote=Blade 3
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+2136194_2399652092RepeatNote=Blade 4
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+2136240_3039652092RepeatNote=Blade 5
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+2136304_3599652092RepeatNote=Blade 6
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+2136360_4049652092RepeatNote=Blade 7
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+213641_939652092RepeatNote=Blade 1
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+213694_1509652092RepeatNote=Blade 2
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38472050_205418092340Compositional biasNote=Poly-His
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38472118_212218092340Compositional biasNote=Poly-Ser

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+2136680_12099642091Coiled coilOntology_term=ECO:0000269
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+2136680_12099542081Coiled coilOntology_term=ECO:0000269
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+2136680_12099652092Coiled coilOntology_term=ECO:0000269
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+21361213_20909642091Compositional biasNote=Pro/Ser/Thr-rich
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+21361213_20909542081Compositional biasNote=Pro/Ser/Thr-rich
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+21361213_20909652092Compositional biasNote=Pro/Ser/Thr-rich
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+21361409_20849642091RegionNote=18 X 4 AA approximate repeats
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+21361427_20859642091RegionNote=11 X 3 AA approximate repeats
HgeneNUP214chr9:134039531chr9:141006850ENST00000359428+2136481_20769642091RegionNote=11 X 5 AA approximate repeats
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+21361409_20849542081RegionNote=18 X 4 AA approximate repeats
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+21361427_20859542081RegionNote=11 X 3 AA approximate repeats
HgeneNUP214chr9:134039531chr9:141006850ENST00000411637+2136481_20769542081RegionNote=11 X 5 AA approximate repeats
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+21361409_20849652092RegionNote=18 X 4 AA approximate repeats
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+21361427_20859652092RegionNote=11 X 3 AA approximate repeats
HgeneNUP214chr9:134039531chr9:141006850ENST00000451030+2136481_20769652092RegionNote=11 X 5 AA approximate repeats
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471737_174818092340Calcium bindingOntology_term=ECO:0000255
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471724_175918092340DomainEF-hand
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847451_45818092340Nucleotide bindingATP
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847379_39618092340RegionBinding to the beta subunit
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471137_141918092340RepeatNote=III
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471456_171118092340RepeatNote=IV
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847468_71218092340RepeatNote=II
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+384782_35918092340RepeatNote=I
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847115_13218092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471170_118518092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471206_121718092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471237_124618092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471266_128418092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471305_139118092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471417_147118092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471491_150518092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471526_153318092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847153_16318092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471553_156318092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471583_160118092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471622_168318092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471709_233918092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847184_18718092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471_9518092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847207_22518092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847246_33118092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847357_48218092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847502_51618092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847537_54418092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847563_57318092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847593_61118092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847632_68418092340Topological domainExtracellular
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847710_115118092340Topological domainCytoplasmic
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471152_116918092340TransmembraneHelical%3B Name%3DS1 of repeat III
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471186_120518092340TransmembraneHelical%3B Name%3DS2 of repeat III
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471218_123618092340TransmembraneHelical%3B Name%3DS3 of repeat III
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471247_126518092340TransmembraneHelical%3B Name%3DS4 of repeat III
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471285_130418092340TransmembraneHelical%3B Name%3DS5 of repeat III
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847133_15218092340TransmembraneHelical%3B Name%3DS2 of repeat I
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471392_141618092340TransmembraneHelical%3B Name%3DS6 of repeat III
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471472_149018092340TransmembraneHelical%3B Name%3DS1 of repeat IV
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471506_152518092340TransmembraneHelical%3B Name%3DS2 of repeat IV
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471534_155218092340TransmembraneHelical%3B Name%3DS3 of repeat IV
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471564_158218092340TransmembraneHelical%3B Name%3DS4 of repeat IV
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471602_162118092340TransmembraneHelical%3B Name%3DS5 of repeat IV
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847164_18318092340TransmembraneHelical%3B Name%3DS3 of repeat I
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+38471684_170818092340TransmembraneHelical%3B Name%3DS6 of repeat IV
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847188_20618092340TransmembraneHelical%3B Name%3DS4 of repeat I
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847226_24518092340TransmembraneHelical%3B Name%3DS5 of repeat I
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847332_35618092340TransmembraneHelical%3B Name%3DS6 of repeat I
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847483_50118092340TransmembraneHelical%3B Name%3DS1 of repeat II
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847517_53618092340TransmembraneHelical%3B Name%3DS2 of repeat II
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847545_56218092340TransmembraneHelical%3B Name%3DS3 of repeat II
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847574_59218092340TransmembraneHelical%3B Name%3DS4 of repeat II
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847612_63118092340TransmembraneHelical%3B Name%3DS5 of repeat II
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+3847685_70918092340TransmembraneHelical%3B Name%3DS6 of repeat II
TgeneCACNA1Bchr9:134039531chr9:141006850ENST00000371372+384796_11418092340TransmembraneHelical%3B Name%3DS1 of repeat I


Top

FusionGeneSequence for NUP214_CACNA1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000277551_chr9_141006850_+_1393aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQK
TLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGA
IQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDA
SPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERR
QERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQAGSAVGFPNTTPCCRETPSASPWPLALELALT

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371372_chr9_141006850_+_1495aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQK
TLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGA
IQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDA
SPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERR
QERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPL
TPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVA

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000277549_chr9_141006850_+_1495aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQK
TLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGA
IQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDA
SPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERR
QERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPL
TPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVA

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371363_chr9_141006850_+_1495aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQK
TLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGA
IQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDA
SPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERR
QERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPL
TPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVA

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371355_chr9_141006850_+_1495aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQK
TLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGA
IQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDA
SPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERR
QERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPL
TPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVA

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371357_chr9_141006850_+_1495aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQ
LQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQK
TLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGA
IQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDA
SPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERR
QERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPL
TPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVA

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000277551_chr9_141006850_+_1383aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQKTLDLLVPPHK
PDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKE
SVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDASPMKRSISTL
AQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERRQERGRSQERR
QPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQAGSAVGFPNTTPCCRETPSASPWPLALELALTLTWGSVWTVR

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371372_chr9_141006850_+_1485aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQKTLDLLVPPHK
PDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKE
SVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDASPMKRSISTL
AQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERRQERGRSQERR
QPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSITYKT
ANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVATNSGRSSRTS

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000277549_chr9_141006850_+_1485aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQKTLDLLVPPHK
PDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKE
SVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDASPMKRSISTL
AQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERRQERGRSQERR
QPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSITYKT
ANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVATNSGRSSRTS

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371363_chr9_141006850_+_1485aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQKTLDLLVPPHK
PDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKE
SVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDASPMKRSISTL
AQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERRQERGRSQERR
QPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSITYKT
ANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVATNSGRSSRTS

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371355_chr9_141006850_+_1485aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQKTLDLLVPPHK
PDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKE
SVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDASPMKRSISTL
AQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERRQERGRSQERR
QPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSITYKT
ANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVATNSGRSSRTS

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371357_chr9_141006850_+_1485aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKS
SVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQ
VGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQT
VKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFD
SDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQKTLDLLVPPHK
PDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKE
SVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTDASPMKRSISTL
AQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERERRQERGRSQERR
QPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSITYKT
ANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVATNSGRSSRTS

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000277551_chr9_141006850_+_1394aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQ
KTLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGG
AIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTD
ASPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERER
RQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQAGSAVGFPNTTPCCRETPSASPWPLALELAL

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371372_chr9_141006850_+_1496aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQ
KTLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGG
AIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTD
ASPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERER
RQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTP
LTPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAV

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000277549_chr9_141006850_+_1496aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQ
KTLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGG
AIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTD
ASPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERER
RQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTP
LTPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAV

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371363_chr9_141006850_+_1496aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQ
KTLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGG
AIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTD
ASPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERER
RQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTP
LTPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAV

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371355_chr9_141006850_+_1496aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQ
KTLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGG
AIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTD
ASPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERER
RQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTP
LTPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAV

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371357_chr9_141006850_+_1496aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVP
MKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPD
VVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDAS
AAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPL
SAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEE
LKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEA
QLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSA
VPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPAGTKQHQCDAELRKEISVVWANLPQ
KTLDLLVPPHKPDEMTVGKVTAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGG
AIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQPVTD
ASPMKRSISTLAQRPRGTHLCSTTPDRPPPSQASSHHHHHRCHRRRDRKQRSLEKGPSLSADMDGAPSSAVGPGLPPGEGPTGCRRERER
RQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTP
LTPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000277551_chr9_141006850_+_4179nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAG
ACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAG
CAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCC
ACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCC
ATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTG
GAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCT
GATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCC
AGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGC
CAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCC
GATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGG
CAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGC
CGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGCCGGC
TCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACC
CTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACT

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371372_chr9_141006850_+_4485nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAG
ACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAG
CAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCC
ACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCC
ATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTG
GAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCT
GATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCC
AGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGC
CAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCC
GATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGG
CAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGC
CGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGT
GGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTG
ACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCA
GGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGC
TCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCC
ACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCAC

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000277549_chr9_141006850_+_4485nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAG
ACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAG
CAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCC
ACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCC
ATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTG
GAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCT
GATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCC
AGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGC
CAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCC
GATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGG
CAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGC
CGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGT
GGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTG
ACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCA
GGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGC
TCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCC
ACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCAC

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371363_chr9_141006850_+_4485nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAG
ACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAG
CAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCC
ACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCC
ATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTG
GAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCT
GATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCC
AGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGC
CAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCC
GATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGG
CAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGC
CGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGT
GGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTG
ACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCA
GGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGC
TCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCC
ACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCAC

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371355_chr9_141006850_+_4485nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAG
ACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAG
CAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCC
ACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCC
ATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTG
GAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCT
GATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCC
AGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGC
CAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCC
GATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGG
CAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGC
CGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGT
GGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTG
ACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCA
GGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGC
TCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCC
ACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCAC

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371357_chr9_141006850_+_4485nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCC
TCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAA
AAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTA
AAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTT
CTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAG
GAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAG
CTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTG
GAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAA
CAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTT
CCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAA
TCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGA
TCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAG
ACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAG
CAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCC
ACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCC
ATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTG
GAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCT
GATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCC
AGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGC
CAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCC
GATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGG
CAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGC
CGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGT
GGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTG
ACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCA
GGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGC
TCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCC
ACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCAC

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000277551_chr9_141006850_+_4149nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCAT
CAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAG
CCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAG
CAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTC
CGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAG
TCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTG
GGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGC
CAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTG
GCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGC
TGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTG
GGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGG
CAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTC
AGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCC
TGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGG
CCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGT

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371372_chr9_141006850_+_4455nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCAT
CAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAG
CCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAG
CAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTC
CGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAG
TCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTG
GGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGC
CAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTG
GCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGC
TGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTG
GGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGG
CAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTC
AGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCA
ACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACG
GCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACAC
AACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGAC
AGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCC
TACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGA

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000277549_chr9_141006850_+_4455nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCAT
CAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAG
CCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAG
CAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTC
CGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAG
TCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTG
GGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGC
CAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTG
GCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGC
TGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTG
GGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGG
CAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTC
AGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCA
ACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACG
GCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACAC
AACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGAC
AGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCC
TACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGA

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371363_chr9_141006850_+_4455nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCAT
CAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAG
CCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAG
CAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTC
CGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAG
TCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTG
GGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGC
CAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTG
GCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGC
TGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTG
GGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGG
CAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTC
AGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCA
ACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACG
GCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACAC
AACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGAC
AGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCC
TACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGA

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371355_chr9_141006850_+_4455nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCAT
CAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAG
CCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAG
CAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTC
CGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAG
TCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTG
GGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGC
CAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTG
GCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGC
TGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTG
GGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGG
CAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTC
AGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCA
ACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACG
GCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACAC
AACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGAC
AGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCC
TACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGA

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371357_chr9_141006850_+_4455nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCA
TTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCC
TCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCAT
CAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAG
CCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAG
CAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTC
CGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAG
TCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTG
GGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGC
CAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTG
GCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGC
TGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTG
GGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGG
CAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTC
AGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCA
ACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACG
GCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACAC
AACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGAC
AGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCC
TACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGA

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000277551_chr9_141006850_+_4182nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAG
AAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTAC
AAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAG
GCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGG
GCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCC
CTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGC
CCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGAT
GCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCT
AGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCT
GCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGC
CGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGG
GGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGCC
GGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTG
ACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCA

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371372_chr9_141006850_+_4488nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAG
AAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTAC
AAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAG
GCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGG
GCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCC
CTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGC
CCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGAT
GCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCT
AGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCT
GCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGC
CGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGG
GGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGC
AGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCC
CTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCC
CCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATT
GGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTG
GCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTAC

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000277549_chr9_141006850_+_4488nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAG
AAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTAC
AAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAG
GCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGG
GCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCC
CTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGC
CCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGAT
GCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCT
AGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCT
GCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGC
CGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGG
GGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGC
AGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCC
CTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCC
CCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATT
GGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTG
GCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTAC

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371363_chr9_141006850_+_4488nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAG
AAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTAC
AAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAG
GCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGG
GCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCC
CTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGC
CCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGAT
GCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCT
AGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCT
GCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGC
CGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGG
GGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGC
AGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCC
CTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCC
CCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATT
GGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTG
GCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTAC

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371355_chr9_141006850_+_4488nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAG
AAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTAC
AAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAG
GCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGG
GCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCC
CTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGC
CCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGAT
GCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCT
AGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCT
GCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGC
CGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGG
GGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGC
AGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCC
CTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCC
CCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATT
GGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTG
GCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTAC

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371357_chr9_141006850_+_4488nt
ATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCC
CCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAG
ATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCT
ATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATT
GCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGC
ATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACG
GAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGA
AAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCT
GTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGAT
GTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAG
AGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCT
CGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCC
TTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATG
TTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTT
TCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCT
GCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACT
GTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAA
GCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCT
CCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATA
GCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTT
AGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTC
TCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTG
CCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCA
GAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAG
TTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACC
TTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTT
GAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCT
CAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCAT
CTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAAC
CAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCT
GTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACC
AAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTG
AGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAG
AAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTAC
AAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAG
GCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGG
GCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCC
CTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGC
CCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGAT
GCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCT
AGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCT
GCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGC
CGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGG
GGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGC
AGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCC
CTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCC
CCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATT
GGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTG
GCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000277551_chr9_141006850_+_4622nt
CGTCACCAAAGCGCGCCGGAAATGCGAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGT
GGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGG
GAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTT
GCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAA
CCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGT
GATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCT
AAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCC
TCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACG
GTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACT
TTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTAC
GTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAG
CACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAA
TGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTA
CTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAA
GTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTAT
ATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGA
AGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCA
CCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCT
GCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTT
GTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGT
TTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCT
GTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTC
TCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCA
GTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCA
GCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTA
ATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGC
ACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCAT
GGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCT
GGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAA
TTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCA
GAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTT
CAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGAC
CTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATG
AAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGT
GACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGAT
GAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCT
CCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGA
GCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTC
TCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGG
TCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGT
CGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAG
CGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCAC
CGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCG
GGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCC
TCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGC
CACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGC
AGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTG
TCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCC
TGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCT
ACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGT
TTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCT

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371372_chr9_141006850_+_7254nt
CGTCACCAAAGCGCGCCGGAAATGCGAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGT
GGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGG
GAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTT
GCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAA
CCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGT
GATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCT
AAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCC
TCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACG
GTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACT
TTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTAC
GTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAG
CACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAA
TGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTA
CTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAA
GTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTAT
ATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGA
AGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCA
CCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCT
GCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTT
GTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGT
TTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCT
GTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTC
TCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCA
GTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCA
GCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTA
ATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGC
ACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCAT
GGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCT
GGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAA
TTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCA
GAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTT
CAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGAC
CTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATG
AAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGT
GACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGAT
GAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCT
CCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGA
GCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTC
TCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGG
TCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGT
CGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAG
CGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCAC
CGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCG
GGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCC
TCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGC
CACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCT
GGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAAC
TCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCC
CTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAG
GCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTG
TCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGG
CACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTG
GATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTC
CTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCG
TACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCC
AGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCA
CCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTC
ACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTG
CAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTT
AAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCG
GTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGT
GGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGA
GAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAG
CTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCC
ACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGG
AAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGT
CCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGT
CCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTG
AAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTG
TGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAG
ACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTT
ACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGAT
CACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTG
GGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCC
TAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGAC
TTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACC
CAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATA
CAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAG
GTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAAT
TCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAG

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000277549_chr9_141006850_+_7254nt
CGTCACCAAAGCGCGCCGGAAATGCGAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGT
GGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGG
GAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTT
GCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAA
CCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGT
GATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCT
AAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCC
TCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACG
GTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACT
TTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTAC
GTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAG
CACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAA
TGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTA
CTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAA
GTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTAT
ATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGA
AGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCA
CCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCT
GCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTT
GTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGT
TTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCT
GTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTC
TCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCA
GTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCA
GCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTA
ATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGC
ACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCAT
GGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCT
GGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAA
TTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCA
GAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTT
CAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGAC
CTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATG
AAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGT
GACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGAT
GAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCT
CCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGA
GCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTC
TCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGG
TCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGT
CGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAG
CGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCAC
CGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCG
GGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCC
TCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGC
CACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCT
GGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAAC
TCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCC
CTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAG
GCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTG
TCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGG
CACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTG
GATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTC
CTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCG
TACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCC
AGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCA
CCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTC
ACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTG
CAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTT
AAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCG
GTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGT
GGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGA
GAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAG
CTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCC
ACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGG
AAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGT
CCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGT
CCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTG
AAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTG
TGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAG
ACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTT
ACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGAT
CACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTG
GGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCC
TAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGAC
TTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACC
CAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATA
CAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAG
GTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAAT
TCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAG

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371363_chr9_141006850_+_7254nt
CGTCACCAAAGCGCGCCGGAAATGCGAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGT
GGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGG
GAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTT
GCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAA
CCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGT
GATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCT
AAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCC
TCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACG
GTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACT
TTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTAC
GTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAG
CACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAA
TGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTA
CTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAA
GTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTAT
ATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGA
AGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCA
CCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCT
GCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTT
GTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGT
TTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCT
GTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTC
TCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCA
GTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCA
GCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTA
ATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGC
ACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCAT
GGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCT
GGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAA
TTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCA
GAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTT
CAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGAC
CTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATG
AAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGT
GACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGAT
GAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCT
CCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGA
GCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTC
TCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGG
TCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGT
CGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAG
CGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCAC
CGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCG
GGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCC
TCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGC
CACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCT
GGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAAC
TCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCC
CTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAG
GCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTG
TCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGG
CACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTG
GATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTC
CTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCG
TACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCC
AGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCA
CCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTC
ACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTG
CAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTT
AAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCG
GTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGT
GGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGA
GAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAG
CTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCC
ACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGG
AAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGT
CCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGT
CCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTG
AAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTG
TGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAG
ACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTT
ACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGAT
CACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTG
GGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCC
TAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGAC
TTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACC
CAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATA
CAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAG
GTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAAT
TCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAG

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371355_chr9_141006850_+_7254nt
CGTCACCAAAGCGCGCCGGAAATGCGAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGT
GGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGG
GAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTT
GCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAA
CCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGT
GATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCT
AAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCC
TCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACG
GTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACT
TTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTAC
GTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAG
CACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAA
TGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTA
CTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAA
GTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTAT
ATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGA
AGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCA
CCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCT
GCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTT
GTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGT
TTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCT
GTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTC
TCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCA
GTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCA
GCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTA
ATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGC
ACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCAT
GGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCT
GGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAA
TTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCA
GAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTT
CAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGAC
CTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATG
AAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGT
GACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGAT
GAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCT
CCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGA
GCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTC
TCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGG
TCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGT
CGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAG
CGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCAC
CGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCG
GGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCC
TCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGC
CACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCT
GGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAAC
TCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCC
CTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAG
GCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTG
TCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGG
CACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTG
GATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTC
CTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCG
TACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCC
AGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCA
CCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTC
ACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTG
CAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTT
AAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCG
GTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGT
GGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGA
GAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAG
CTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCC
ACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGG
AAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGT
CCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGT
CCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTG
AAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTG
TGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAG
ACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTT
ACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGAT
CACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTG
GGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCC
TAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGAC
TTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACC
CAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATA
CAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAG
GTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAAT
TCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAG

>In-frame_NUP214_ENST00000359428_chr9_134039531_+_CACNA1B_ENST00000371357_chr9_141006850_+_7254nt
CGTCACCAAAGCGCGCCGGAAATGCGAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGT
GGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGG
GAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTT
GCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAA
CCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGT
GATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCT
AAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCC
TCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACG
GTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACT
TTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTAC
GTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAG
CACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAA
TGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTA
CTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAA
GTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTAT
ATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGA
AGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCA
CCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCT
GCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTT
GTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGT
TTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCT
GTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTC
TCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCA
GTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCA
GCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTA
ATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGC
ACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCAT
GGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCT
GGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAA
TTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCA
GAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTT
CAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGAC
CTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATG
AAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGT
GACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGAT
GAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCT
CCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGA
GCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTC
TCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGG
TCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGT
CGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAG
CGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCAC
CGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCG
GGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCC
TCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGC
CACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCT
GGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAAC
TCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCC
CTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAG
GCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTG
TCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGG
CACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTG
GATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTC
CTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCG
TACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCC
AGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCA
CCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTC
ACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTG
CAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTT
AAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCG
GTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGT
GGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGA
GAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAG
CTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCC
ACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGG
AAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGT
CCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGT
CCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTG
AAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTG
TGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAG
ACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTT
ACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGAT
CACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTG
GGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCC
TAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGAC
TTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACC
CAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATA
CAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAG
GTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAAT
TCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAG

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000277551_chr9_141006850_+_4567nt
GAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTT
GGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAG
CGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGG
TCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAG
TTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCA
TGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCT
ATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTG
ATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGA
GCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTT
GTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTG
CAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTA
TGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTG
CGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAAT
TGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAA
AGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTA
AGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCT
CTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTT
CTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTT
CATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAG
CCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACAC
CAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATA
GCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCT
CAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAA
AGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAA
AAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTC
TTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGG
AAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGC
TTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGG
AACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAAC
AGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTC
CTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAAT
CCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGAT
CCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGA
CTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGC
AGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCA
CCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCA
TACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGG
AGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTG
ATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCA
GCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCC
AGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCG
ATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGC
AGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCC
GTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGCCGGCT
CAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCTCTGACCC
TTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCACCAACTC
GGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACTGCACCCT
GGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCTCAGACGC
CTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCACCTTGGTG

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371372_chr9_141006850_+_7199nt
GAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTT
GGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAG
CGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGG
TCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAG
TTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCA
TGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCT
ATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTG
ATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGA
GCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTT
GTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTG
CAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTA
TGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTG
CGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAAT
TGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAA
AGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTA
AGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCT
CTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTT
CTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTT
CATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAG
CCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACAC
CAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATA
GCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCT
CAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAA
AGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAA
AAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTC
TTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGG
AAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGC
TTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGG
AACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAAC
AGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTC
CTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAAT
CCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGAT
CCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGA
CTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGC
AGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCA
CCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCA
TACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGG
AGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTG
ATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCA
GCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCC
AGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCG
ATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGC
AGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCC
GTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTG
GTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGA
CTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAG
GCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCT
CTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCA
CCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACT
GCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCT
CAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCAC
CTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTC
TCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCA
GGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCT
TCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCG
TGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTG
GGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAAC
CAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGG
CTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGAC
CGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCG
CGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCAC
GAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGG
GCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGG
GGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCT
GCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCA
CGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTT
AGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAA
AGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGT
GGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGC
ATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAAT
AGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGT
CTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTT
GGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAG
CGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAAT
CTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATG
TGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATT
TGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAAC
CATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATT

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000277549_chr9_141006850_+_7199nt
GAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTT
GGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAG
CGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGG
TCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAG
TTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCA
TGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCT
ATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTG
ATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGA
GCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTT
GTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTG
CAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTA
TGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTG
CGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAAT
TGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAA
AGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTA
AGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCT
CTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTT
CTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTT
CATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAG
CCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACAC
CAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATA
GCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCT
CAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAA
AGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAA
AAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTC
TTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGG
AAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGC
TTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGG
AACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAAC
AGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTC
CTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAAT
CCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGAT
CCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGA
CTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGC
AGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCA
CCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCA
TACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGG
AGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTG
ATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCA
GCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCC
AGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCG
ATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGC
AGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCC
GTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTG
GTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGA
CTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAG
GCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCT
CTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCA
CCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACT
GCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCT
CAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCAC
CTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTC
TCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCA
GGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCT
TCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCG
TGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTG
GGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAAC
CAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGG
CTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGAC
CGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCG
CGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCAC
GAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGG
GCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGG
GGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCT
GCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCA
CGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTT
AGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAA
AGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGT
GGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGC
ATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAAT
AGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGT
CTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTT
GGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAG
CGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAAT
CTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATG
TGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATT
TGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAAC
CATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATT

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371363_chr9_141006850_+_7199nt
GAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTT
GGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAG
CGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGG
TCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAG
TTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCA
TGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCT
ATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTG
ATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGA
GCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTT
GTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTG
CAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTA
TGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTG
CGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAAT
TGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAA
AGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTA
AGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCT
CTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTT
CTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTT
CATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAG
CCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACAC
CAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATA
GCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCT
CAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAA
AGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAA
AAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTC
TTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGG
AAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGC
TTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGG
AACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAAC
AGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTC
CTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAAT
CCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGAT
CCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGA
CTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGC
AGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCA
CCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCA
TACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGG
AGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTG
ATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCA
GCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCC
AGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCG
ATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGC
AGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCC
GTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTG
GTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGA
CTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAG
GCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCT
CTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCA
CCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACT
GCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCT
CAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCAC
CTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTC
TCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCA
GGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCT
TCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCG
TGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTG
GGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAAC
CAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGG
CTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGAC
CGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCG
CGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCAC
GAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGG
GCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGG
GGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCT
GCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCA
CGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTT
AGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAA
AGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGT
GGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGC
ATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAAT
AGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGT
CTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTT
GGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAG
CGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAAT
CTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATG
TGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATT
TGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAAC
CATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATT

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371355_chr9_141006850_+_7199nt
GAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTT
GGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAG
CGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGG
TCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAG
TTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCA
TGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCT
ATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTG
ATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGA
GCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTT
GTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTG
CAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTA
TGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTG
CGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAAT
TGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAA
AGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTA
AGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCT
CTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTT
CTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTT
CATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAG
CCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACAC
CAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATA
GCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCT
CAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAA
AGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAA
AAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTC
TTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGG
AAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGC
TTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGG
AACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAAC
AGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTC
CTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAAT
CCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGAT
CCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGA
CTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGC
AGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCA
CCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCA
TACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGG
AGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTG
ATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCA
GCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCC
AGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCG
ATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGC
AGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCC
GTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTG
GTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGA
CTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAG
GCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCT
CTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCA
CCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACT
GCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCT
CAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCAC
CTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTC
TCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCA
GGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCT
TCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCG
TGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTG
GGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAAC
CAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGG
CTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGAC
CGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCG
CGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCAC
GAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGG
GCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGG
GGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCT
GCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCA
CGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTT
AGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAA
AGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGT
GGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGC
ATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAAT
AGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGT
CTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTT
GGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAG
CGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAAT
CTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATG
TGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATT
TGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAAC
CATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATT

>In-frame_NUP214_ENST00000411637_chr9_134039531_+_CACNA1B_ENST00000371357_chr9_141006850_+_7199nt
GAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTT
GGCTGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAG
CGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGG
TCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAG
TTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCA
TGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCT
ATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTG
ATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGA
GCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTT
GTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTG
CAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTA
TGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTG
CGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAAT
TGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAA
AGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTA
AGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCT
CTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTT
CTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTT
CATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAG
CCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACAC
CAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATA
GCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCT
CAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAA
AGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAA
AAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTC
TTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGG
AAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGC
TTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGG
AACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAAC
AGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTC
CTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAAT
CCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGAT
CCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTTGTGTGGGCCAATCTGCCCCAGAAGA
CTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCTCTGATGATATTCGACTTCTACAAGC
AGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTGTCCCTGTTCCACCCTCTGAAGGCCA
CCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCCACCTCCCTCAGCAATGGCGGGGCCA
TACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCACCCCATGAGGCCAGGCCACCCCTGG
AGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATGCAGAGCATAACCCGGAGGGGCCCTG
ATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCCGAGACTCAGCCCGTCACAGATGCCA
GCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACCACCCCGGACCGCCCACCCCCTAGCC
AGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTGGAGAAGGGGCCCAGCCTGTCTGCCG
ATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGCTGCCGGCGGGAACGAGAGCGCCGGC
AGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTCTACTCCTGCGACCGCTTTGGGGGCC
GTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAGCCGGGACCCCACCCACAGGGCAGTG
GTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGGAGGCAGCTCCCCCAGACGCCCCTGA
CTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAGACCAGCCTCCCTGCCTTCTCCCCAG
GCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCCCTGGCTCTCGAATTGGCT
CTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTTTCGAGGAGGCTGTGGCCA
CCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCGTGCCCAACGGTTACCACT
GCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCACTGGTGCTAGCTGCACCGTGACCGCT
CAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTCGGGGGAGGCCTTGCCCAC
CTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTGTTAGAGGATGCGGCTCTC
TCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCTGCTGTGTGTGGCTGAGAAGGACCCA
GGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAGCTCTGCGTCCTGTGGGGAGCACCCT
TCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGAGGGGATGGGGAGGGGGACACAGTCG
TGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACACCGTCAGCCCCACAGGAACCGAGCTG
GGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATATACGTGATGTAGAAAAAATGGAAAAC
CAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTCAGCTTTTTGCCACGTGTCTTTGTGG
CTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTCTGCTGCTCTTGACCAAGTGCCTGAC
CGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCACCGCAGGATGCTGTGAAAAGTACTCG
CGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGGCAGCCATTTGCTGTCCTCCTCCCAC
GAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCAGTCTGTTCTGCATATGATTCTCAGG
GCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGTAGGAAGGAGGAAGACATTGGCTGGG
GGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAAGTGACCGAGGGAGGACACGGCTCCT
GCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTCAAGTGAGGTCTGACCCCCATGGCCA
CGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCTTGTTTGGTGAAGAAAGGGAGCATTT
AGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTGGCTTCTACCCCATGATTCTCCTCAA
AGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGTGCCTGTACAGGTGTGTTCAGTGTGT
GGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGACCGCTGCCTGGTCTCGGGGTTCAGC
ATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAAAGATAACAGAGTATTTTATTCCAAT
AGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGATGTGTATTTTGACACTGACGTTTTGT
CTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAACCACAGCCATTTCCCCAGGCAGTGTT
GGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCATTGGAATTGATGAAAACTACAGGGAG
CGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTCCGGCTATCATATATGTCCCCTGAAT
CTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCAGTGGCTGTAGTTTGAACAAGTTATG
TGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCGTACTTTTTGATACAATGTATTCATT
TGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGTGTTAAAAAAAAAAAAAAGTCCCAAC
CATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTCATATTTATCAGCCAAACTTTGGATT

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000277551_chr9_141006850_+_4592nt
CTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTT
CGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAG
AAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCT
GGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAA
GTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCC
AGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAG
CTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGT
ATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAA
GGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCG
TTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGG
ACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCC
TGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCA
ACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTG
ACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTT
CCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTC
ATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCC
CCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTT
CCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCC
AGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACC
CCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCA
AGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCT
GCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCA
CTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCT
CAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAG
TCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACAC
TTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACA
GAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTA
CTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCA
CTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTA
GACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCC
AACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCC
CTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAA
ACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCC
AAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTT
GTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCT
CTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTG
TCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCC
ACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCA
CCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATG
CAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCC
GAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACC
ACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTG
GAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGC
TGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTC
TACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAG
CCGGGACCCCACCCACAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCCCTGGCCC
CTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACTCTCACTT
TCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTCCGCCGCG
TGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCACTGGTGCT
AGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCCGGCCCTC
GGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAAAGCCCTG

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371372_chr9_141006850_+_7224nt
CTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTT
CGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAG
AAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCT
GGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAA
GTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCC
AGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAG
CTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGT
ATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAA
GGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCG
TTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGG
ACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCC
TGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCA
ACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTG
ACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTT
CCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTC
ATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCC
CCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTT
CCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCC
AGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACC
CCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCA
AGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCT
GCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCA
CTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCT
CAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAG
TCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACAC
TTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACA
GAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTA
CTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCA
CTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTA
GACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCC
AACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCC
CTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAA
ACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCC
AAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTT
GTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCT
CTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTG
TCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCC
ACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCA
CCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATG
CAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCC
GAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACC
ACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTG
GAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGC
TGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTC
TACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAG
CCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGG
AGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAG
ACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCC
CTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACT
CTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTC
CGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCAC
TGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCC
GGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAA
AGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCT
GCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAG
CTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGA
GGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACAC
CGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATAT
ACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTC
AGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTC
TGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCAC
CGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGG
CAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCA
GTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGT
AGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAA
GTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTC
AAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCT
TGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTG
GCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGT
GCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGA
CCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAA
AGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGAT
GTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAAC
CACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCAT
TGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTC
CGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCA
GTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCG
TACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGT
GTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTC
ATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAGCAAAGTCCTTGAATTAAAATAAAAACTTAG

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000277549_chr9_141006850_+_7224nt
CTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTT
CGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAG
AAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCT
GGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAA
GTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCC
AGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAG
CTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGT
ATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAA
GGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCG
TTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGG
ACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCC
TGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCA
ACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTG
ACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTT
CCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTC
ATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCC
CCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTT
CCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCC
AGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACC
CCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCA
AGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCT
GCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCA
CTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCT
CAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAG
TCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACAC
TTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACA
GAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTA
CTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCA
CTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTA
GACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCC
AACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCC
CTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAA
ACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCC
AAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTT
GTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCT
CTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTG
TCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCC
ACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCA
CCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATG
CAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCC
GAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACC
ACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTG
GAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGC
TGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTC
TACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAG
CCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGG
AGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAG
ACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCC
CTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACT
CTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTC
CGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCAC
TGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCC
GGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAA
AGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCT
GCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAG
CTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGA
GGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACAC
CGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATAT
ACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTC
AGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTC
TGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCAC
CGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGG
CAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCA
GTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGT
AGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAA
GTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTC
AAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCT
TGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTG
GCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGT
GCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGA
CCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAA
AGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGAT
GTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAAC
CACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCAT
TGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTC
CGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCA
GTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCG
TACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGT
GTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTC
ATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAGCAAAGTCCTTGAATTAAAATAAAAACTTAG

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371363_chr9_141006850_+_7224nt
CTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTT
CGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAG
AAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCT
GGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAA
GTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCC
AGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAG
CTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGT
ATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAA
GGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCG
TTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGG
ACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCC
TGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCA
ACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTG
ACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTT
CCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTC
ATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCC
CCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTT
CCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCC
AGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACC
CCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCA
AGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCT
GCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCA
CTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCT
CAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAG
TCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACAC
TTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACA
GAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTA
CTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCA
CTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTA
GACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCC
AACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCC
CTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAA
ACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCC
AAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTT
GTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCT
CTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTG
TCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCC
ACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCA
CCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATG
CAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCC
GAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACC
ACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTG
GAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGC
TGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTC
TACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAG
CCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGG
AGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAG
ACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCC
CTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACT
CTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTC
CGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCAC
TGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCC
GGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAA
AGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCT
GCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAG
CTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGA
GGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACAC
CGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATAT
ACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTC
AGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTC
TGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCAC
CGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGG
CAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCA
GTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGT
AGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAA
GTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTC
AAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCT
TGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTG
GCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGT
GCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGA
CCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAA
AGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGAT
GTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAAC
CACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCAT
TGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTC
CGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCA
GTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCG
TACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGT
GTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTC
ATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAGCAAAGTCCTTGAATTAAAATAAAAACTTAG

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371355_chr9_141006850_+_7224nt
CTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTT
CGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAG
AAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCT
GGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAA
GTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCC
AGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAG
CTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGT
ATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAA
GGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCG
TTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGG
ACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCC
TGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCA
ACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTG
ACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTT
CCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTC
ATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCC
CCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTT
CCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCC
AGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACC
CCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCA
AGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCT
GCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCA
CTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCT
CAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAG
TCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACAC
TTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACA
GAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTA
CTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCA
CTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTA
GACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCC
AACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCC
CTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAA
ACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCC
AAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTT
GTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCT
CTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTG
TCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCC
ACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCA
CCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATG
CAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCC
GAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACC
ACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTG
GAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGC
TGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTC
TACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAG
CCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGG
AGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAG
ACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCC
CTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACT
CTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTC
CGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCAC
TGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCC
GGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAA
AGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCT
GCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAG
CTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGA
GGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACAC
CGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATAT
ACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTC
AGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTC
TGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCAC
CGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGG
CAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCA
GTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGT
AGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAA
GTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTC
AAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCT
TGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTG
GCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGT
GCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGA
CCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAA
AGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGAT
GTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAAC
CACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCAT
TGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTC
CGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCA
GTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCG
TACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGT
GTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTC
ATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAGCAAAGTCCTTGAATTAAAATAAAAACTTAG

>In-frame_NUP214_ENST00000451030_chr9_134039531_+_CACNA1B_ENST00000371357_chr9_141006850_+_7224nt
CTGCGCGCCGCTGGCGCTGAGGGGAGGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTTGGCTGCTT
CGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGCGGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAG
AAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCT
GGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAA
GTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCC
AGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAG
CTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGT
ATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAA
GGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCG
TTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGG
ACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCC
TGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCA
ACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTG
ACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTT
CCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTC
ATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCC
CCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTT
CCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCC
AGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACC
CCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCA
AGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCT
GCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCA
CTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCT
CAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAG
TCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACAC
TTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACA
GAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTA
CTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCA
CTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTA
GACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCC
AACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCC
CTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAA
ACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCC
AAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCTGGGACAAAGCAGCATCAGTGTGACGCGGAGTTGAGGAAGGAGATTTCCGTT
GTGTGGGCCAATCTGCCCCAGAAGACTTTGGACTTGCTGGTACCACCCCATAAGCCTGATGAGATGACAGTGGGGAAGGTTTATGCAGCT
CTGATGATATTCGACTTCTACAAGCAGAACAAAACCACCAGAGACCAGATGCAGCAGGCTCCTGGAGGCCTCTCCCAGATGGGTCCTGTG
TCCCTGTTCCACCCTCTGAAGGCCACCCTGGAGCAGACACAGCCGGCTGTGCTCCGAGGAGCCCGGGTTTTCCTTCGACAGAAGAGTTCC
ACCTCCCTCAGCAATGGCGGGGCCATACAAAACCAAGAGAGTGGCATCAAAGAGTCTGTCTCCTGGGGCACTCAAAGGACCCAGGATGCA
CCCCATGAGGCCAGGCCACCCCTGGAGCGTGGCCACTCCACAGAGATCCCTGTGGGGCGGTCAGGAGCACTGGCTGTGGACGTTCAGATG
CAGAGCATAACCCGGAGGGGCCCTGATGGGGAGCCCCAGCCTGGGCTGGAGAGCCAGGGTCGAGCGGCCTCCATGCCCCGCCTTGCGGCC
GAGACTCAGCCCGTCACAGATGCCAGCCCCATGAAGCGCTCCATCTCCACGCTGGCCCAGCGGCCCCGTGGGACTCATCTTTGCAGCACC
ACCCCGGACCGCCCACCCCCTAGCCAGGCGTCGTCGCACCACCACCACCACCGCTGCCACCGCCGCAGGGACAGGAAGCAGAGGTCCCTG
GAGAAGGGGCCCAGCCTGTCTGCCGATATGGATGGCGCACCAAGCAGTGCTGTGGGGCCGGGGCTGCCCCCGGGAGAGGGGCCTACAGGC
TGCCGGCGGGAACGAGAGCGCCGGCAGGAGCGGGGCCGGTCCCAGGAGCGGAGGCAGCCCTCATCCTCCTCCTCGGAGAAGCAGCGCTTC
TACTCCTGCGACCGCTTTGGGGGCCGTGAGCCCCCGAAGCCCAAGCCCTCCCTCAGCAGCCACCCAACGTCGCCAACAGCTGGCCAGGAG
CCGGGACCCCACCCACAGGGCAGTGGTTCCGTGAATGGGAGCCCCTTGCTGTCAACATCTGGTGCTAGCACCCCCGGCCGCGGTGGGCGG
AGGCAGCTCCCCCAGACGCCCCTGACTCCCCGCCCCAGCATCACCTACAAGACGGCCAACTCCTCACCCATCCACTTCGCCGGGGCTCAG
ACCAGCCTCCCTGCCTTCTCCCCAGGCCGGCTCAGCCGTGGGCTTTCCGAACACAACGCCCTGCTGCAGAGAGACCCCCTCAGCCAGCCC
CTGGCCCCTGGCTCTCGAATTGGCTCTGACCCTTACCTGGGGCAGCGTCTGGACAGTGAGGCCTCTGTCCACGCCCTGCCTGAGGACACT
CTCACTTTCGAGGAGGCTGTGGCCACCAACTCGGGCCGCTCCTCCAGGACTTCCTACGTGTCCTCCCTGACCTCCCAGTCTCACCCTCTC
CGCCGCGTGCCCAACGGTTACCACTGCACCCTGGGACTCAGCTCGGGTGGCCGAGCACGGCACAGCTACCACCACCCTGACCAAGACCAC
TGGTGCTAGCTGCACCGTGACCGCTCAGACGCCTGCATGCAGCAGGCGTGTGTTCCAGTGGATGAGTTTTATCATCCACACGGGGCAGCC
GGCCCTCGGGGGAGGCCTTGCCCACCTTGGTGAGGCTCCTGTGGCCCCTCCCTCCCCCTCCTCCCCTCTTTTACTCTAGACGACGAATAA
AGCCCTGTTAGAGGATGCGGCTCTCTCTGTCCCCTTCCTGTCCTGCCTTCCTGGGTCTCGTACCACACACCAGACCCTAAACCGCAGGCT
GCTGTGTGTGGCTGAGAAGGACCCAGGAGTCCAAATCCCGTGTCCTGGGACTCAGCATCCAGCATGGGTGCTTGGAGCCGTTGTGAGGAG
CTCTGCGTCCTGTGGGGAGCACCCTTCACGTGGCCGTGCGGCACAGAGAAGCAGGGCCCACCTGAAAGTGCGCCGAGACCTCGGGACGGA
GGGGATGGGGAGGGGGACACAGTCGTGGCTTGTGCAGCCCGCCAGTGTCAGCGAATGCTCACTCAGGCAAGCTCTGTCCTCCCTGGACAC
CGTCAGCCCCACAGGAACCGAGCTGGGAAGTGTTCTTGCTGTGGTTGTGATTTTTAATTGCAACACCTCTCATTCTTGTCACTTCTATAT
ACGTGATGTAGAAAAAATGGAAAACCAGAAAAATGGGGAAGGAAATGTTCACATAACTTTAAAAAATCAAACCTGTGAAAGAAAGATGTC
AGCTTTTTGCCACGTGTCTTTGTGGCTTATGCGAGGAGACTCCCTGTGCAGCCCTGTCCGGTCCAGGTGGACGTAGACGGCCCCTGGCTC
TGCTGCTCTTGACCAAGTGCCTGACCGCCAGGCCCTCACACCCAGGCTCCTGGGCACTGTGGTGTGAGGCGAGGCCTCGGGATCCATCAC
CGCAGGATGCTGTGAAAAGTACTCGCGATGGCAGCCAGGTAGCAAGCCCTTGCCAGTGGAGAGCACTGGATGTCATGGTGGCAAACAAGG
CAGCCATTTGCTGTCCTCCTCCCACGAGTGGAAGGGGTTTCCAAGGAAGCCACAGGGCAGCTGACCACGTGCTTGTGTGAGGCATTTTCA
GTCTGTTCTGCATATGATTCTCAGGGCACACTCTGTGGTATGTGAAATAGGTTTCCTTCCACATACAGCAGAAGAGAGGCAAAGGCTGGT
AGGAAGGAGGAAGACATTGGCTGGGGGCTTGGATGTGGGGCCGTCAGGGCAGGAGGGAGGAAGCCCCAGCTGGAATGAAACTCAGAGCAA
GTGACCGAGGGAGGACACGGCTCCTGCCACTGAGGCCGGGCACCTGATGCCCAGCACTGTCCTGGCGCCAGACACAGGGAGCAGGCAGTC
AAGTGAGGTCTGACCCCCATGGCCACGCTCAGGAGAGAAAGACCATGCTCAGGACACTGTCCAAGGTGCACAAGATGCTGGGAGGTCCCT
TGTTTGGTGAAGAAAGGGAGCATTTAGAGCAGTTGATGGTGGTGTGTCCTCCGTGTTCTGAAATTCCAGATGATCTGTGTTGGATTCTTG
GCTTCTACCCCATGATTCTCCTCAAAGAAATTGTGTGTGATGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTGTGTCACAGGAGATGCAGT
GCCTGTACAGGTGTGTTCAGTGTGTGGATGTCATTAACCCATAGGGCTATGCAACAAAAGACACATTTAATAGAAGTAAAACACACAAGA
CCGCTGCCTGGTCTCGGGGTTCAGCATGATTGTGACCAAACCTTTTTATAGAATTTCCTTACCTGAAGGCACAACACTCTGAAACTTTAA
AGATAACAGAGTATTTTATTCCAATAGAATAAACCAGGAATCTCGGACTGTGCATGTGATCACTGTGCTCCTGTTGCAAAGTAGAAGGAT
GTGTATTTTGACACTGACGTTTTGTCTCTTGTTCCCCAGCCCCCAGCCCATGTTATCTTGGGTGTCGAATGTGTCCATTCCATGCAGAAC
CACAGCCATTTCCCCAGGCAGTGTTGGGTCGAGAATCCACTTTTCTAAACCCACACAGCCTAGCTGGCTTGTCTAGACTCTTCTAGGCAT
TGGAATTGATGAAAACTACAGGGAGCGGGGAAAGGAGACATTATGTCTTGTTTTCCTGACTTTGGGTTTTGTTTCTCACTGTGTCTTCTC
CGGCTATCATATATGTCCCCTGAATCTCATAGTGAGCTGCCAAATTTGAAGTGCATCACCCAGTTGTCTGCATCTGGAACCAGTCAAGCA
GTGGCTGTAGTTTGAACAAGTTATGTGTGCATGTAACATATATACATATATACATATATACAAGTATGTGCATGATAATGTATATCTTCG
TACTTTTTGATACAATGTATTCATTTGTTAATTTTTAATTATATTTGATATAAATCAAAGGTTTGTTGCAAAACTTTATATTTAAGAAGT
GTTAAAAAAAAAAAAAAGTCCCAACCATGCAACACAACTGGGACCTACTTAAAAAGAAATTCTGTGATTGACTAGTTTGCTGCCTGAGTC
ATATTTATCAGCCAAACTTTGGATTCTGCTGTTGTTTCTACAATGACATTTTGTATGAAGCAAAGTCCTTGAATTAAAATAAAAACTTAG


Top

FusionGenePPI for NUP214_CACNA1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NUP214ZFP36, XPO1, NUP107, NXF2, NXF1, XPO5, IPO5, G3BP1, G3BP2, RAE1, APC, HDAC4, HDAC5, HDAC9, NUP88, SMAD1, CLEC4G, SMAD2, SMAD3, SMAD4, SIRT7, RANBP2, CUL3, CUL2, NUPL2, NUP214, ACOT13, PNPT1, HSPA1L, VPS4B, S100A6, EEF1A1, STRIP1, RPL19, NDUFA7, ITGA4, SOX2, LMNA, FBXO6, CUL7, OBSL1, NUP62, CLEC11A, DDX19A, KCMF1, CFL1, CSRP1, DYNC1LI1, TRIM28, TXNDC9, NTRK1, IFI16, NUP85, NUP35, KPNB1, UBE2I, NUPL1, NUP153, SEH1L, C11orf30, CDH1, RAN, FXR2, EMILIN1, SERPINB2, BRCA1CACNA1BPDLIM5, GNAO1, GNB2, RXRB, MAP1LC3B, UBE2L3, MAP1B, MTNR1A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NUP214_CACNA1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneCACNA1BQ00975DB00381AmlodipineVoltage-dependent N-type calcium channel subunit alpha-1Bsmall moleculeapproved
TgeneCACNA1BQ00975DB00661VerapamilVoltage-dependent N-type calcium channel subunit alpha-1Bsmall moleculeapproved
TgeneCACNA1BQ00975DB00996GabapentinVoltage-dependent N-type calcium channel subunit alpha-1Bsmall moleculeapproved|investigational
TgeneCACNA1BQ00975DB01202LevetiracetamVoltage-dependent N-type calcium channel subunit alpha-1Bsmall moleculeapproved|investigational
TgeneCACNA1BQ00975DB09231BenidipineVoltage-dependent N-type calcium channel subunit alpha-1Bsmall moleculeapproved|investigational
TgeneCACNA1BQ00975DB09232CilnidipineVoltage-dependent N-type calcium channel subunit alpha-1Bsmall moleculeapproved|investigational

Top

RelatedDiseases for NUP214_CACNA1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCACNA1BC0036341Schizophrenia2PSYGENET
TgeneCACNA1BC0005586Bipolar Disorder1PSYGENET
TgeneCACNA1BC0031117Peripheral Neuropathy1CTD_human
TgeneCACNA1BC3538999DYSTONIA 231UNIPROT