FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24990

FusionGeneSummary for NT5E_ASCC3

check button Fusion gene summary
Fusion gene informationFusion gene name: NT5E_ASCC3
Fusion gene ID: 24990
HgeneTgene
Gene symbol

NT5E

ASCC3

Gene ID

4907

10973

Gene name5'-nucleotidase ectoactivating signal cointegrator 1 complex subunit 3
SynonymsCALJA|CD73|E5NT|NT|NT5|NTE|eN|eNTASC1p200|HELIC1|RNAH
Cytomap

6q14.3

6q16.3

Type of geneprotein-codingprotein-coding
Description5'-nucleotidase5'-NTPurine 5-Prime-Nucleotidaseecto-5'-nucleotidaseactivating signal cointegrator 1 complex subunit 3ASC-1 complex subunit P200RNA helicase familyhelicase, ATP binding 1trip4 complex subunit p200
Modification date2018052020180523
UniProtAcc

P21589

Q8N3C0

Ensembl transtripts involved in fusion geneENST00000369646, ENST00000257770, 
ENST00000369651, 
ENST00000369162, 
ENST00000522650, ENST00000369143, 
Fusion gene scores* DoF score2 X 1 X 2=410 X 7 X 9=630
# samples 211
** MAII scorelog2(2/4*10)=2.32192809488736log2(11/630*10)=-2.51784830486262
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NT5E [Title/Abstract] AND ASCC3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNT5E

GO:0007159

leukocyte cell-cell adhesion

7595232

TgeneASCC3

GO:0006307

DNA dealkylation involved in DNA repair

22055184

TgeneASCC3

GO:0032508

DNA duplex unwinding

22055184


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLIHCTCGA-CC-A8HV-01ANT5Echr6

86160196

+ASCC3chr6

101054964

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000369646ENST00000369162NT5Echr6

86160196

+ASCC3chr6

101054964

-
5CDS-intronENST00000369646ENST00000522650NT5Echr6

86160196

+ASCC3chr6

101054964

-
5CDS-intronENST00000369646ENST00000369143NT5Echr6

86160196

+ASCC3chr6

101054964

-
In-frameENST00000257770ENST00000369162NT5Echr6

86160196

+ASCC3chr6

101054964

-
5CDS-intronENST00000257770ENST00000522650NT5Echr6

86160196

+ASCC3chr6

101054964

-
5CDS-intronENST00000257770ENST00000369143NT5Echr6

86160196

+ASCC3chr6

101054964

-
In-frameENST00000369651ENST00000369162NT5Echr6

86160196

+ASCC3chr6

101054964

-
5CDS-intronENST00000369651ENST00000522650NT5Echr6

86160196

+ASCC3chr6

101054964

-
5CDS-intronENST00000369651ENST00000369143NT5Echr6

86160196

+ASCC3chr6

101054964

-

Top

FusionProtFeatures for NT5E_ASCC3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NT5E

P21589

ASCC3

Q8N3C0

Hydrolyzes extracellular nucleotides into membranepermeable nucleosides. Exhibits AMP-, NAD-, and NMN-nucleosidaseactivities. {ECO:0000269|PubMed:21933152}. 3'-5' DNA helicase involved in repair of alkylated DNA.Promotes DNA unwinding to generate single-stranded substrateneeded for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.{ECO:0000269|PubMed:22055184}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-0418_79-98112Coiled coilOntology_term=ECO:0000255
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-04328_356-98112Coiled coilOntology_term=ECO:0000255
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-01318_79-115732Coiled coilOntology_term=ECO:0000255
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-013328_356-115732Coiled coilOntology_term=ECO:0000255
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-041336_1511-98112DomainHelicase ATP-binding 2
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-041544_1739-98112DomainHelicase C-terminal 2
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-041812_2176-98112DomainNote=SEC63 2
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-04486_669-98112DomainHelicase ATP-binding 1
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-04728_914-98112DomainHelicase C-terminal 1
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-04978_1287-98112DomainNote=SEC63 1
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-29421812_217615952203DomainNote=SEC63 2
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-0131336_1511-115732DomainHelicase ATP-binding 2
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-0131544_1739-115732DomainHelicase C-terminal 2
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-0131812_2176-115732DomainNote=SEC63 2
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-013486_669-115732DomainHelicase ATP-binding 1
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-013728_914-115732DomainHelicase C-terminal 1
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-013978_1287-115732DomainNote=SEC63 1
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-041453_1456-98112MotifNote=DEIH box
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-04611_614-98112MotifNote=DEVH box
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-0131453_1456-115732MotifNote=DEIH box
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-013611_614-115732MotifNote=DEVH box
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-041349_1356-98112Nucleotide bindingATP
TgeneASCC3chr6:86160196chr6:101054964ENST00000369143-04499_506-98112Nucleotide bindingATP
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-0131349_1356-115732Nucleotide bindingATP
TgeneASCC3chr6:86160196chr6:101054964ENST00000522650-013499_506-115732Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNT5Echr6:86160196chr6:101054964ENST00000257770+19500_506113575RegionNote=Substrate binding
HgeneNT5Echr6:86160196chr6:101054964ENST00000369651+18500_506113525RegionNote=Substrate binding
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-294218_7915952203Coiled coilOntology_term=ECO:0000255
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-2942328_35615952203Coiled coilOntology_term=ECO:0000255
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-29421336_151115952203DomainHelicase ATP-binding 2
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-29421544_173915952203DomainHelicase C-terminal 2
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-2942486_66915952203DomainHelicase ATP-binding 1
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-2942728_91415952203DomainHelicase C-terminal 1
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-2942978_128715952203DomainNote=SEC63 1
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-29421453_145615952203MotifNote=DEIH box
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-2942611_61415952203MotifNote=DEVH box
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-29421349_135615952203Nucleotide bindingATP
TgeneASCC3chr6:86160196chr6:101054964ENST00000369162-2942499_50615952203Nucleotide bindingATP


Top

FusionGeneSequence for NT5E_ASCC3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NT5E_ENST00000369646_chr6_86160196_+_ASCC3_ENST00000369162_chr6_101054964_-_721aa
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGT
IWFTVYKGAEVAHFMNALRYDAMMENIIATVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVII
KGTEYTDGKTRRTVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFTKKFLTEPFPVESSLLGVLSDHLNAEIAGGTITSKQDALD
TITWTYFFRRLIMNPSTYNLGDVSHDSVNKFLSHLIEKSLIELELSYCIEIGEDNRSIEPLTTGRIASTYTLKHQTVKMFKDRLKPECST
EELLSILSDAEETTDLPVRHNEDHMNSELAKCLPIESNPHSFDSPHTKAHLLLQAHLSRAMLPCPDTDTDTKTVLDQALRVCQAMLDVAA
NQGWLVTVLNITNLIQMVIQGRWLKDSSLLTLPNIENHHLHLFKKWKPIMKGPHARGRTSIESLPELIHACGGKDHVFSSMVESELHAAK
TKQAWNFLSHLPVINVGISVKGSWDDLVEGHNELSVSTLTADKRDDNKWIKLHADQETVLQVSLQRVHFGFHKGKPESCAVTPRFPKSKD
EGWFLILGEVDKRELIALKRVGTIRNHHVASLSFTTPEIPGRTIYTLTFMSDCYLGLDQQTDITLNVTQASLSAQVNTKVSDSLTDLALK

>In-frame_NT5E_ENST00000257770_chr6_86160196_+_ASCC3_ENST00000369162_chr6_101054964_-_721aa
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGT
IWFTVYKGAEVAHFMNALRYDAMMENIIATVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVII
KGTEYTDGKTRRTVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFTKKFLTEPFPVESSLLGVLSDHLNAEIAGGTITSKQDALD
TITWTYFFRRLIMNPSTYNLGDVSHDSVNKFLSHLIEKSLIELELSYCIEIGEDNRSIEPLTTGRIASTYTLKHQTVKMFKDRLKPECST
EELLSILSDAEETTDLPVRHNEDHMNSELAKCLPIESNPHSFDSPHTKAHLLLQAHLSRAMLPCPDTDTDTKTVLDQALRVCQAMLDVAA
NQGWLVTVLNITNLIQMVIQGRWLKDSSLLTLPNIENHHLHLFKKWKPIMKGPHARGRTSIESLPELIHACGGKDHVFSSMVESELHAAK
TKQAWNFLSHLPVINVGISVKGSWDDLVEGHNELSVSTLTADKRDDNKWIKLHADQETVLQVSLQRVHFGFHKGKPESCAVTPRFPKSKD
EGWFLILGEVDKRELIALKRVGTIRNHHVASLSFTTPEIPGRTIYTLTFMSDCYLGLDQQTDITLNVTQASLSAQVNTKVSDSLTDLALK

>In-frame_NT5E_ENST00000369651_chr6_86160196_+_ASCC3_ENST00000369162_chr6_101054964_-_721aa
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGT
IWFTVYKGAEVAHFMNALRYDAMMENIIATVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVII
KGTEYTDGKTRRTVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFTKKFLTEPFPVESSLLGVLSDHLNAEIAGGTITSKQDALD
TITWTYFFRRLIMNPSTYNLGDVSHDSVNKFLSHLIEKSLIELELSYCIEIGEDNRSIEPLTTGRIASTYTLKHQTVKMFKDRLKPECST
EELLSILSDAEETTDLPVRHNEDHMNSELAKCLPIESNPHSFDSPHTKAHLLLQAHLSRAMLPCPDTDTDTKTVLDQALRVCQAMLDVAA
NQGWLVTVLNITNLIQMVIQGRWLKDSSLLTLPNIENHHLHLFKKWKPIMKGPHARGRTSIESLPELIHACGGKDHVFSSMVESELHAAK
TKQAWNFLSHLPVINVGISVKGSWDDLVEGHNELSVSTLTADKRDDNKWIKLHADQETVLQVSLQRVHFGFHKGKPESCAVTPRFPKSKD
EGWFLILGEVDKRELIALKRVGTIRNHHVASLSFTTPEIPGRTIYTLTFMSDCYLGLDQQTDITLNVTQASLSAQVNTKVSDSLTDLALK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NT5E_ENST00000369646_chr6_86160196_+_ASCC3_ENST00000369162_chr6_101054964_-_2163nt
ATGTGTCCCCGAGCCGCGCGGGCGCCCGCGACGCTACTCCTCGCCCTGGGCGCGGTGCTGTGGCCTGCGGCTGGCGCCTGGGAGCTTACG
ATTTTGCACACCAACGACGTGCACAGCCGGCTGGAGCAGACCAGCGAGGACTCCAGCAAGTGCGTCAACGCCAGCCGCTGCATGGGTGGC
GTGGCTCGGCTCTTCACCAAGGTTCAGCAGATCCGCCGCGCCGAACCCAACGTGCTGCTGCTGGACGCCGGCGACCAGTACCAGGGCACT
ATCTGGTTCACCGTGTACAAGGGCGCCGAGGTGGCGCACTTCATGAACGCCCTGCGCTACGATGCCATGATGGAGAACATCATTGCAACA
GTAAGAGATTCCAACCTCAAGCTGACCCTTGCTTTCGGGATAGGAATGCATCATGCTGGACTACATGAGAGGGACCGAAAAACAGTAGAG
GAACTATTTGTAAACTGTAAAGTTCAGGTTCTTATTGCTACAAGCACATTAGCCTGGGGTGTAAACTTTCCAGCTCATTTAGTAATTATT
AAGGGAACAGAATACTATGATGGAAAAACAAGACGTTATGTGGATTTTCCCATTACAGATGTCCTCCAGATGATGGGGCGTGCTGGGAGG
CCGCAGTTCGATGACCAAGGCAAAGCTGTAATTCTAGTTCATGACATAAAGAAAGACTTTTATAAAAAATTTCTTTATGAACCTTTCCCA
GTAGAATCAAGTTTATTAGGAGTGCTCTCTGACCACTTAAATGCAGAGATTGCTGGTGGTACAATTACATCTAAGCAAGATGCATTGGAT
TATATCACCTGGACTTACTTTTTCCGACGTCTTATCATGAATCCCAGCTATTACAATTTGGGTGATGTGAGCCATGATTCTGTGAACAAG
TTTCTGTCCCATCTGATTGAGAAGTCCCTGATTGAATTGGAACTTTCCTACTGTATTGAAATTGGAGAGGATAATCGCAGCATTGAACCT
CTAACTTATGGCCGAATTGCCTCCTATTACTATTTGAAGCATCAAACAGTTAAAATGTTCAAGGACCGCTTGAAGCCTGAATGCAGTACT
GAAGAACTGCTTTCAATTCTAAGTGATGCAGAAGAATATACAGATTTGCCAGTGAGACACAATGAAGATCATATGAATAGTGAACTGGCA
AAATGTCTTCCCATTGAATCAAATCCTCATTCATTTGACAGCCCTCACACCAAAGCACATCTCCTGCTACAGGCACATCTCAGCCGAGCC
ATGCTACCCTGCCCAGATTATGACACTGATACCAAAACAGTCTTGGACCAAGCTCTCAGAGTATGTCAGGCAATGCTGGACGTGGCTGCA
AACCAGGGCTGGCTGGTGACTGTCCTGAATATCACCAACCTGATTCAGATGGTGATCCAGGGTCGGTGGTTAAAGGACTCTTCTCTTCTT
ACACTACCAAACATAGAAAACCATCATCTTCACCTTTTCAAGAAATGGAAGCCGATTATGAAGGGCCCACATGCTAGGGGTCGGACCTCC
ATCGAGTCCCTTCCTGAACTGATCCATGCCTGTGGAGGGAAAGACCATGTATTTAGCTCCATGGTAGAAAGTGAGCTACATGCTGCAAAA
ACGAAACAGGCATGGAATTTCTTATCTCACTTGCCAGTGATAAATGTTGGCATAAGTGTTAAAGGCTCGTGGGATGACTTAGTTGAAGGA
CATAATGAACTCTCTGTCTCAACTCTGACTGCAGACAAACGAGATGACAACAAATGGATCAAATTGCATGCTGACCAAGAGTATGTGCTT
CAAGTGAGCTTGCAGAGAGTCCACTTTGGGTTCCACAAGGGAAAGCCAGAGAGCTGTGCAGTTACTCCTCGATTTCCCAAATCAAAAGAC
GAAGGATGGTTTTTGATATTAGGAGAAGTGGATAAGAGAGAACTTATTGCTTTGAAAAGAGTAGGATATATTCGAAATCATCATGTTGCT
TCCCTTTCTTTTTATACCCCTGAAATACCTGGAAGGTATATCTACACATTATATTTCATGAGTGACTGCTACCTTGGCCTGGACCAGCAG
TATGACATCTATCTCAACGTTACACAAGCGAGTCTTTCTGCACAGGTCAACACCAAGGTCTCTGATTCCCTGACTGACCTGGCATTAAAG

>In-frame_NT5E_ENST00000257770_chr6_86160196_+_ASCC3_ENST00000369162_chr6_101054964_-_2163nt
ATGTGTCCCCGAGCCGCGCGGGCGCCCGCGACGCTACTCCTCGCCCTGGGCGCGGTGCTGTGGCCTGCGGCTGGCGCCTGGGAGCTTACG
ATTTTGCACACCAACGACGTGCACAGCCGGCTGGAGCAGACCAGCGAGGACTCCAGCAAGTGCGTCAACGCCAGCCGCTGCATGGGTGGC
GTGGCTCGGCTCTTCACCAAGGTTCAGCAGATCCGCCGCGCCGAACCCAACGTGCTGCTGCTGGACGCCGGCGACCAGTACCAGGGCACT
ATCTGGTTCACCGTGTACAAGGGCGCCGAGGTGGCGCACTTCATGAACGCCCTGCGCTACGATGCCATGATGGAGAACATCATTGCAACA
GTAAGAGATTCCAACCTCAAGCTGACCCTTGCTTTCGGGATAGGAATGCATCATGCTGGACTACATGAGAGGGACCGAAAAACAGTAGAG
GAACTATTTGTAAACTGTAAAGTTCAGGTTCTTATTGCTACAAGCACATTAGCCTGGGGTGTAAACTTTCCAGCTCATTTAGTAATTATT
AAGGGAACAGAATACTATGATGGAAAAACAAGACGTTATGTGGATTTTCCCATTACAGATGTCCTCCAGATGATGGGGCGTGCTGGGAGG
CCGCAGTTCGATGACCAAGGCAAAGCTGTAATTCTAGTTCATGACATAAAGAAAGACTTTTATAAAAAATTTCTTTATGAACCTTTCCCA
GTAGAATCAAGTTTATTAGGAGTGCTCTCTGACCACTTAAATGCAGAGATTGCTGGTGGTACAATTACATCTAAGCAAGATGCATTGGAT
TATATCACCTGGACTTACTTTTTCCGACGTCTTATCATGAATCCCAGCTATTACAATTTGGGTGATGTGAGCCATGATTCTGTGAACAAG
TTTCTGTCCCATCTGATTGAGAAGTCCCTGATTGAATTGGAACTTTCCTACTGTATTGAAATTGGAGAGGATAATCGCAGCATTGAACCT
CTAACTTATGGCCGAATTGCCTCCTATTACTATTTGAAGCATCAAACAGTTAAAATGTTCAAGGACCGCTTGAAGCCTGAATGCAGTACT
GAAGAACTGCTTTCAATTCTAAGTGATGCAGAAGAATATACAGATTTGCCAGTGAGACACAATGAAGATCATATGAATAGTGAACTGGCA
AAATGTCTTCCCATTGAATCAAATCCTCATTCATTTGACAGCCCTCACACCAAAGCACATCTCCTGCTACAGGCACATCTCAGCCGAGCC
ATGCTACCCTGCCCAGATTATGACACTGATACCAAAACAGTCTTGGACCAAGCTCTCAGAGTATGTCAGGCAATGCTGGACGTGGCTGCA
AACCAGGGCTGGCTGGTGACTGTCCTGAATATCACCAACCTGATTCAGATGGTGATCCAGGGTCGGTGGTTAAAGGACTCTTCTCTTCTT
ACACTACCAAACATAGAAAACCATCATCTTCACCTTTTCAAGAAATGGAAGCCGATTATGAAGGGCCCACATGCTAGGGGTCGGACCTCC
ATCGAGTCCCTTCCTGAACTGATCCATGCCTGTGGAGGGAAAGACCATGTATTTAGCTCCATGGTAGAAAGTGAGCTACATGCTGCAAAA
ACGAAACAGGCATGGAATTTCTTATCTCACTTGCCAGTGATAAATGTTGGCATAAGTGTTAAAGGCTCGTGGGATGACTTAGTTGAAGGA
CATAATGAACTCTCTGTCTCAACTCTGACTGCAGACAAACGAGATGACAACAAATGGATCAAATTGCATGCTGACCAAGAGTATGTGCTT
CAAGTGAGCTTGCAGAGAGTCCACTTTGGGTTCCACAAGGGAAAGCCAGAGAGCTGTGCAGTTACTCCTCGATTTCCCAAATCAAAAGAC
GAAGGATGGTTTTTGATATTAGGAGAAGTGGATAAGAGAGAACTTATTGCTTTGAAAAGAGTAGGATATATTCGAAATCATCATGTTGCT
TCCCTTTCTTTTTATACCCCTGAAATACCTGGAAGGTATATCTACACATTATATTTCATGAGTGACTGCTACCTTGGCCTGGACCAGCAG
TATGACATCTATCTCAACGTTACACAAGCGAGTCTTTCTGCACAGGTCAACACCAAGGTCTCTGATTCCCTGACTGACCTGGCATTAAAG

>In-frame_NT5E_ENST00000369651_chr6_86160196_+_ASCC3_ENST00000369162_chr6_101054964_-_2163nt
ATGTGTCCCCGAGCCGCGCGGGCGCCCGCGACGCTACTCCTCGCCCTGGGCGCGGTGCTGTGGCCTGCGGCTGGCGCCTGGGAGCTTACG
ATTTTGCACACCAACGACGTGCACAGCCGGCTGGAGCAGACCAGCGAGGACTCCAGCAAGTGCGTCAACGCCAGCCGCTGCATGGGTGGC
GTGGCTCGGCTCTTCACCAAGGTTCAGCAGATCCGCCGCGCCGAACCCAACGTGCTGCTGCTGGACGCCGGCGACCAGTACCAGGGCACT
ATCTGGTTCACCGTGTACAAGGGCGCCGAGGTGGCGCACTTCATGAACGCCCTGCGCTACGATGCCATGATGGAGAACATCATTGCAACA
GTAAGAGATTCCAACCTCAAGCTGACCCTTGCTTTCGGGATAGGAATGCATCATGCTGGACTACATGAGAGGGACCGAAAAACAGTAGAG
GAACTATTTGTAAACTGTAAAGTTCAGGTTCTTATTGCTACAAGCACATTAGCCTGGGGTGTAAACTTTCCAGCTCATTTAGTAATTATT
AAGGGAACAGAATACTATGATGGAAAAACAAGACGTTATGTGGATTTTCCCATTACAGATGTCCTCCAGATGATGGGGCGTGCTGGGAGG
CCGCAGTTCGATGACCAAGGCAAAGCTGTAATTCTAGTTCATGACATAAAGAAAGACTTTTATAAAAAATTTCTTTATGAACCTTTCCCA
GTAGAATCAAGTTTATTAGGAGTGCTCTCTGACCACTTAAATGCAGAGATTGCTGGTGGTACAATTACATCTAAGCAAGATGCATTGGAT
TATATCACCTGGACTTACTTTTTCCGACGTCTTATCATGAATCCCAGCTATTACAATTTGGGTGATGTGAGCCATGATTCTGTGAACAAG
TTTCTGTCCCATCTGATTGAGAAGTCCCTGATTGAATTGGAACTTTCCTACTGTATTGAAATTGGAGAGGATAATCGCAGCATTGAACCT
CTAACTTATGGCCGAATTGCCTCCTATTACTATTTGAAGCATCAAACAGTTAAAATGTTCAAGGACCGCTTGAAGCCTGAATGCAGTACT
GAAGAACTGCTTTCAATTCTAAGTGATGCAGAAGAATATACAGATTTGCCAGTGAGACACAATGAAGATCATATGAATAGTGAACTGGCA
AAATGTCTTCCCATTGAATCAAATCCTCATTCATTTGACAGCCCTCACACCAAAGCACATCTCCTGCTACAGGCACATCTCAGCCGAGCC
ATGCTACCCTGCCCAGATTATGACACTGATACCAAAACAGTCTTGGACCAAGCTCTCAGAGTATGTCAGGCAATGCTGGACGTGGCTGCA
AACCAGGGCTGGCTGGTGACTGTCCTGAATATCACCAACCTGATTCAGATGGTGATCCAGGGTCGGTGGTTAAAGGACTCTTCTCTTCTT
ACACTACCAAACATAGAAAACCATCATCTTCACCTTTTCAAGAAATGGAAGCCGATTATGAAGGGCCCACATGCTAGGGGTCGGACCTCC
ATCGAGTCCCTTCCTGAACTGATCCATGCCTGTGGAGGGAAAGACCATGTATTTAGCTCCATGGTAGAAAGTGAGCTACATGCTGCAAAA
ACGAAACAGGCATGGAATTTCTTATCTCACTTGCCAGTGATAAATGTTGGCATAAGTGTTAAAGGCTCGTGGGATGACTTAGTTGAAGGA
CATAATGAACTCTCTGTCTCAACTCTGACTGCAGACAAACGAGATGACAACAAATGGATCAAATTGCATGCTGACCAAGAGTATGTGCTT
CAAGTGAGCTTGCAGAGAGTCCACTTTGGGTTCCACAAGGGAAAGCCAGAGAGCTGTGCAGTTACTCCTCGATTTCCCAAATCAAAAGAC
GAAGGATGGTTTTTGATATTAGGAGAAGTGGATAAGAGAGAACTTATTGCTTTGAAAAGAGTAGGATATATTCGAAATCATCATGTTGCT
TCCCTTTCTTTTTATACCCCTGAAATACCTGGAAGGTATATCTACACATTATATTTCATGAGTGACTGCTACCTTGGCCTGGACCAGCAG
TATGACATCTATCTCAACGTTACACAAGCGAGTCTTTCTGCACAGGTCAACACCAAGGTCTCTGATTCCCTGACTGACCTGGCATTAAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_NT5E_ENST00000369646_chr6_86160196_+_ASCC3_ENST00000369162_chr6_101054964_-_3404nt
GCACTCGCCCGGCTCGCCCGCTTTCGCACCCAGTTCACGCGCCACAGCTATGTGTCCCCGAGCCGCGCGGGCGCCCGCGACGCTACTCCT
CGCCCTGGGCGCGGTGCTGTGGCCTGCGGCTGGCGCCTGGGAGCTTACGATTTTGCACACCAACGACGTGCACAGCCGGCTGGAGCAGAC
CAGCGAGGACTCCAGCAAGTGCGTCAACGCCAGCCGCTGCATGGGTGGCGTGGCTCGGCTCTTCACCAAGGTTCAGCAGATCCGCCGCGC
CGAACCCAACGTGCTGCTGCTGGACGCCGGCGACCAGTACCAGGGCACTATCTGGTTCACCGTGTACAAGGGCGCCGAGGTGGCGCACTT
CATGAACGCCCTGCGCTACGATGCCATGATGGAGAACATCATTGCAACAGTAAGAGATTCCAACCTCAAGCTGACCCTTGCTTTCGGGAT
AGGAATGCATCATGCTGGACTACATGAGAGGGACCGAAAAACAGTAGAGGAACTATTTGTAAACTGTAAAGTTCAGGTTCTTATTGCTAC
AAGCACATTAGCCTGGGGTGTAAACTTTCCAGCTCATTTAGTAATTATTAAGGGAACAGAATACTATGATGGAAAAACAAGACGTTATGT
GGATTTTCCCATTACAGATGTCCTCCAGATGATGGGGCGTGCTGGGAGGCCGCAGTTCGATGACCAAGGCAAAGCTGTAATTCTAGTTCA
TGACATAAAGAAAGACTTTTATAAAAAATTTCTTTATGAACCTTTCCCAGTAGAATCAAGTTTATTAGGAGTGCTCTCTGACCACTTAAA
TGCAGAGATTGCTGGTGGTACAATTACATCTAAGCAAGATGCATTGGATTATATCACCTGGACTTACTTTTTCCGACGTCTTATCATGAA
TCCCAGCTATTACAATTTGGGTGATGTGAGCCATGATTCTGTGAACAAGTTTCTGTCCCATCTGATTGAGAAGTCCCTGATTGAATTGGA
ACTTTCCTACTGTATTGAAATTGGAGAGGATAATCGCAGCATTGAACCTCTAACTTATGGCCGAATTGCCTCCTATTACTATTTGAAGCA
TCAAACAGTTAAAATGTTCAAGGACCGCTTGAAGCCTGAATGCAGTACTGAAGAACTGCTTTCAATTCTAAGTGATGCAGAAGAATATAC
AGATTTGCCAGTGAGACACAATGAAGATCATATGAATAGTGAACTGGCAAAATGTCTTCCCATTGAATCAAATCCTCATTCATTTGACAG
CCCTCACACCAAAGCACATCTCCTGCTACAGGCACATCTCAGCCGAGCCATGCTACCCTGCCCAGATTATGACACTGATACCAAAACAGT
CTTGGACCAAGCTCTCAGAGTATGTCAGGCAATGCTGGACGTGGCTGCAAACCAGGGCTGGCTGGTGACTGTCCTGAATATCACCAACCT
GATTCAGATGGTGATCCAGGGTCGGTGGTTAAAGGACTCTTCTCTTCTTACACTACCAAACATAGAAAACCATCATCTTCACCTTTTCAA
GAAATGGAAGCCGATTATGAAGGGCCCACATGCTAGGGGTCGGACCTCCATCGAGTCCCTTCCTGAACTGATCCATGCCTGTGGAGGGAA
AGACCATGTATTTAGCTCCATGGTAGAAAGTGAGCTACATGCTGCAAAAACGAAACAGGCATGGAATTTCTTATCTCACTTGCCAGTGAT
AAATGTTGGCATAAGTGTTAAAGGCTCGTGGGATGACTTAGTTGAAGGACATAATGAACTCTCTGTCTCAACTCTGACTGCAGACAAACG
AGATGACAACAAATGGATCAAATTGCATGCTGACCAAGAGTATGTGCTTCAAGTGAGCTTGCAGAGAGTCCACTTTGGGTTCCACAAGGG
AAAGCCAGAGAGCTGTGCAGTTACTCCTCGATTTCCCAAATCAAAAGACGAAGGATGGTTTTTGATATTAGGAGAAGTGGATAAGAGAGA
ACTTATTGCTTTGAAAAGAGTAGGATATATTCGAAATCATCATGTTGCTTCCCTTTCTTTTTATACCCCTGAAATACCTGGAAGGTATAT
CTACACATTATATTTCATGAGTGACTGCTACCTTGGCCTGGACCAGCAGTATGACATCTATCTCAACGTTACACAAGCGAGTCTTTCTGC
ACAGGTCAACACCAAGGTCTCTGATTCCCTGACTGACCTGGCATTAAAGTAACTTGACCTGAACAATCCATTTGAAAGGAGTGGCTAAGA
ATTCTCTCTGTTCAGTCATCTAGACAAATCGAATTACTTGATGTTTGCCTTGAAAGAATCAACTTCTAACCTCAACCATCCAGGAAATTG
ACAGTGGCTGCAGTATTGACTCCAGTGACATAAAGTTAACCACAGTGGCCTTTTAACAAATGTTGCCTTTTATAATGTTATCTTTATGAG
TTTCTTGATATGTAAGATGAAAAAGCATTTAGAATAATCTTTTAATTTGTGTATATTTGGGATGATATTTAGGAGCTATCAATCAAATTT
TACATCTCACAATGTACTGTTTACATGGATATTGGCTGCTTTTTTTAAGGAAAACCACATTGAGATGTGACAAGTGTTAGGACTTGTCAC
AGATTTCTAACTCTGCCGCATAAACTATAAATCTGTAAGGTGGTACACAGCGTGTCTTGTTAGCAAAATTTATACTTTGATATGATCACA
TGTAGAAGTAGCTTCAAGAATTTCTTGTAGTCATAAATGTTTAATAATATATGATGTAAAATTATATTATGGAGCCTAATGATGATAACA
AAGAAAACAATATACTGATCTTAGAAAATGTAGACATGGTTAACTGGGAAATAAAATATAGAGTGGCACTTCAAGACAAGCTGACTCAAT
GTTTTCTTCTGCTTCCTTTAAATAATATCCCCTTACTCATCTGTTCTTCTTTTCTTTCCCTTCTACTTCAAGGCTTTATTTCTATTATCT
TTCTGACATATTTATTTACAGAAGTAGAGAAGTATAATCTAATTCATGTTGTAGCACTTACAGATCATATAGTACAATTATTTGTCTTTA
TGCTCTCCAGGAAAAATCTGAGACAGAAAATTTTTCACCCCTATGGATAGGTTTTCACCTGTAATAAAGAAAATTTCTCTATGTCCAAAC
AAATTCCTTCTTGAAAAATACTTTTTCAAACTAAAAACTTGTTAAAATTCAATGTTCATATAATATGCATTCTAGTGGAATGAAATTCTA
CCTTTGTGAAATAATTTCAGTTTTCTTAGCCCTAAAATGAATTATTTTAAAACATTTTCCAATGTCATTGTTACAAATACTAGAATTTAA

>In-frame_NT5E_ENST00000257770_chr6_86160196_+_ASCC3_ENST00000369162_chr6_101054964_-_3404nt
GCACTCGCCCGGCTCGCCCGCTTTCGCACCCAGTTCACGCGCCACAGCTATGTGTCCCCGAGCCGCGCGGGCGCCCGCGACGCTACTCCT
CGCCCTGGGCGCGGTGCTGTGGCCTGCGGCTGGCGCCTGGGAGCTTACGATTTTGCACACCAACGACGTGCACAGCCGGCTGGAGCAGAC
CAGCGAGGACTCCAGCAAGTGCGTCAACGCCAGCCGCTGCATGGGTGGCGTGGCTCGGCTCTTCACCAAGGTTCAGCAGATCCGCCGCGC
CGAACCCAACGTGCTGCTGCTGGACGCCGGCGACCAGTACCAGGGCACTATCTGGTTCACCGTGTACAAGGGCGCCGAGGTGGCGCACTT
CATGAACGCCCTGCGCTACGATGCCATGATGGAGAACATCATTGCAACAGTAAGAGATTCCAACCTCAAGCTGACCCTTGCTTTCGGGAT
AGGAATGCATCATGCTGGACTACATGAGAGGGACCGAAAAACAGTAGAGGAACTATTTGTAAACTGTAAAGTTCAGGTTCTTATTGCTAC
AAGCACATTAGCCTGGGGTGTAAACTTTCCAGCTCATTTAGTAATTATTAAGGGAACAGAATACTATGATGGAAAAACAAGACGTTATGT
GGATTTTCCCATTACAGATGTCCTCCAGATGATGGGGCGTGCTGGGAGGCCGCAGTTCGATGACCAAGGCAAAGCTGTAATTCTAGTTCA
TGACATAAAGAAAGACTTTTATAAAAAATTTCTTTATGAACCTTTCCCAGTAGAATCAAGTTTATTAGGAGTGCTCTCTGACCACTTAAA
TGCAGAGATTGCTGGTGGTACAATTACATCTAAGCAAGATGCATTGGATTATATCACCTGGACTTACTTTTTCCGACGTCTTATCATGAA
TCCCAGCTATTACAATTTGGGTGATGTGAGCCATGATTCTGTGAACAAGTTTCTGTCCCATCTGATTGAGAAGTCCCTGATTGAATTGGA
ACTTTCCTACTGTATTGAAATTGGAGAGGATAATCGCAGCATTGAACCTCTAACTTATGGCCGAATTGCCTCCTATTACTATTTGAAGCA
TCAAACAGTTAAAATGTTCAAGGACCGCTTGAAGCCTGAATGCAGTACTGAAGAACTGCTTTCAATTCTAAGTGATGCAGAAGAATATAC
AGATTTGCCAGTGAGACACAATGAAGATCATATGAATAGTGAACTGGCAAAATGTCTTCCCATTGAATCAAATCCTCATTCATTTGACAG
CCCTCACACCAAAGCACATCTCCTGCTACAGGCACATCTCAGCCGAGCCATGCTACCCTGCCCAGATTATGACACTGATACCAAAACAGT
CTTGGACCAAGCTCTCAGAGTATGTCAGGCAATGCTGGACGTGGCTGCAAACCAGGGCTGGCTGGTGACTGTCCTGAATATCACCAACCT
GATTCAGATGGTGATCCAGGGTCGGTGGTTAAAGGACTCTTCTCTTCTTACACTACCAAACATAGAAAACCATCATCTTCACCTTTTCAA
GAAATGGAAGCCGATTATGAAGGGCCCACATGCTAGGGGTCGGACCTCCATCGAGTCCCTTCCTGAACTGATCCATGCCTGTGGAGGGAA
AGACCATGTATTTAGCTCCATGGTAGAAAGTGAGCTACATGCTGCAAAAACGAAACAGGCATGGAATTTCTTATCTCACTTGCCAGTGAT
AAATGTTGGCATAAGTGTTAAAGGCTCGTGGGATGACTTAGTTGAAGGACATAATGAACTCTCTGTCTCAACTCTGACTGCAGACAAACG
AGATGACAACAAATGGATCAAATTGCATGCTGACCAAGAGTATGTGCTTCAAGTGAGCTTGCAGAGAGTCCACTTTGGGTTCCACAAGGG
AAAGCCAGAGAGCTGTGCAGTTACTCCTCGATTTCCCAAATCAAAAGACGAAGGATGGTTTTTGATATTAGGAGAAGTGGATAAGAGAGA
ACTTATTGCTTTGAAAAGAGTAGGATATATTCGAAATCATCATGTTGCTTCCCTTTCTTTTTATACCCCTGAAATACCTGGAAGGTATAT
CTACACATTATATTTCATGAGTGACTGCTACCTTGGCCTGGACCAGCAGTATGACATCTATCTCAACGTTACACAAGCGAGTCTTTCTGC
ACAGGTCAACACCAAGGTCTCTGATTCCCTGACTGACCTGGCATTAAAGTAACTTGACCTGAACAATCCATTTGAAAGGAGTGGCTAAGA
ATTCTCTCTGTTCAGTCATCTAGACAAATCGAATTACTTGATGTTTGCCTTGAAAGAATCAACTTCTAACCTCAACCATCCAGGAAATTG
ACAGTGGCTGCAGTATTGACTCCAGTGACATAAAGTTAACCACAGTGGCCTTTTAACAAATGTTGCCTTTTATAATGTTATCTTTATGAG
TTTCTTGATATGTAAGATGAAAAAGCATTTAGAATAATCTTTTAATTTGTGTATATTTGGGATGATATTTAGGAGCTATCAATCAAATTT
TACATCTCACAATGTACTGTTTACATGGATATTGGCTGCTTTTTTTAAGGAAAACCACATTGAGATGTGACAAGTGTTAGGACTTGTCAC
AGATTTCTAACTCTGCCGCATAAACTATAAATCTGTAAGGTGGTACACAGCGTGTCTTGTTAGCAAAATTTATACTTTGATATGATCACA
TGTAGAAGTAGCTTCAAGAATTTCTTGTAGTCATAAATGTTTAATAATATATGATGTAAAATTATATTATGGAGCCTAATGATGATAACA
AAGAAAACAATATACTGATCTTAGAAAATGTAGACATGGTTAACTGGGAAATAAAATATAGAGTGGCACTTCAAGACAAGCTGACTCAAT
GTTTTCTTCTGCTTCCTTTAAATAATATCCCCTTACTCATCTGTTCTTCTTTTCTTTCCCTTCTACTTCAAGGCTTTATTTCTATTATCT
TTCTGACATATTTATTTACAGAAGTAGAGAAGTATAATCTAATTCATGTTGTAGCACTTACAGATCATATAGTACAATTATTTGTCTTTA
TGCTCTCCAGGAAAAATCTGAGACAGAAAATTTTTCACCCCTATGGATAGGTTTTCACCTGTAATAAAGAAAATTTCTCTATGTCCAAAC
AAATTCCTTCTTGAAAAATACTTTTTCAAACTAAAAACTTGTTAAAATTCAATGTTCATATAATATGCATTCTAGTGGAATGAAATTCTA
CCTTTGTGAAATAATTTCAGTTTTCTTAGCCCTAAAATGAATTATTTTAAAACATTTTCCAATGTCATTGTTACAAATACTAGAATTTAA

>In-frame_NT5E_ENST00000369651_chr6_86160196_+_ASCC3_ENST00000369162_chr6_101054964_-_3386nt
CGCTTTCGCACCCAGTTCACGCGCCACAGCTATGTGTCCCCGAGCCGCGCGGGCGCCCGCGACGCTACTCCTCGCCCTGGGCGCGGTGCT
GTGGCCTGCGGCTGGCGCCTGGGAGCTTACGATTTTGCACACCAACGACGTGCACAGCCGGCTGGAGCAGACCAGCGAGGACTCCAGCAA
GTGCGTCAACGCCAGCCGCTGCATGGGTGGCGTGGCTCGGCTCTTCACCAAGGTTCAGCAGATCCGCCGCGCCGAACCCAACGTGCTGCT
GCTGGACGCCGGCGACCAGTACCAGGGCACTATCTGGTTCACCGTGTACAAGGGCGCCGAGGTGGCGCACTTCATGAACGCCCTGCGCTA
CGATGCCATGATGGAGAACATCATTGCAACAGTAAGAGATTCCAACCTCAAGCTGACCCTTGCTTTCGGGATAGGAATGCATCATGCTGG
ACTACATGAGAGGGACCGAAAAACAGTAGAGGAACTATTTGTAAACTGTAAAGTTCAGGTTCTTATTGCTACAAGCACATTAGCCTGGGG
TGTAAACTTTCCAGCTCATTTAGTAATTATTAAGGGAACAGAATACTATGATGGAAAAACAAGACGTTATGTGGATTTTCCCATTACAGA
TGTCCTCCAGATGATGGGGCGTGCTGGGAGGCCGCAGTTCGATGACCAAGGCAAAGCTGTAATTCTAGTTCATGACATAAAGAAAGACTT
TTATAAAAAATTTCTTTATGAACCTTTCCCAGTAGAATCAAGTTTATTAGGAGTGCTCTCTGACCACTTAAATGCAGAGATTGCTGGTGG
TACAATTACATCTAAGCAAGATGCATTGGATTATATCACCTGGACTTACTTTTTCCGACGTCTTATCATGAATCCCAGCTATTACAATTT
GGGTGATGTGAGCCATGATTCTGTGAACAAGTTTCTGTCCCATCTGATTGAGAAGTCCCTGATTGAATTGGAACTTTCCTACTGTATTGA
AATTGGAGAGGATAATCGCAGCATTGAACCTCTAACTTATGGCCGAATTGCCTCCTATTACTATTTGAAGCATCAAACAGTTAAAATGTT
CAAGGACCGCTTGAAGCCTGAATGCAGTACTGAAGAACTGCTTTCAATTCTAAGTGATGCAGAAGAATATACAGATTTGCCAGTGAGACA
CAATGAAGATCATATGAATAGTGAACTGGCAAAATGTCTTCCCATTGAATCAAATCCTCATTCATTTGACAGCCCTCACACCAAAGCACA
TCTCCTGCTACAGGCACATCTCAGCCGAGCCATGCTACCCTGCCCAGATTATGACACTGATACCAAAACAGTCTTGGACCAAGCTCTCAG
AGTATGTCAGGCAATGCTGGACGTGGCTGCAAACCAGGGCTGGCTGGTGACTGTCCTGAATATCACCAACCTGATTCAGATGGTGATCCA
GGGTCGGTGGTTAAAGGACTCTTCTCTTCTTACACTACCAAACATAGAAAACCATCATCTTCACCTTTTCAAGAAATGGAAGCCGATTAT
GAAGGGCCCACATGCTAGGGGTCGGACCTCCATCGAGTCCCTTCCTGAACTGATCCATGCCTGTGGAGGGAAAGACCATGTATTTAGCTC
CATGGTAGAAAGTGAGCTACATGCTGCAAAAACGAAACAGGCATGGAATTTCTTATCTCACTTGCCAGTGATAAATGTTGGCATAAGTGT
TAAAGGCTCGTGGGATGACTTAGTTGAAGGACATAATGAACTCTCTGTCTCAACTCTGACTGCAGACAAACGAGATGACAACAAATGGAT
CAAATTGCATGCTGACCAAGAGTATGTGCTTCAAGTGAGCTTGCAGAGAGTCCACTTTGGGTTCCACAAGGGAAAGCCAGAGAGCTGTGC
AGTTACTCCTCGATTTCCCAAATCAAAAGACGAAGGATGGTTTTTGATATTAGGAGAAGTGGATAAGAGAGAACTTATTGCTTTGAAAAG
AGTAGGATATATTCGAAATCATCATGTTGCTTCCCTTTCTTTTTATACCCCTGAAATACCTGGAAGGTATATCTACACATTATATTTCAT
GAGTGACTGCTACCTTGGCCTGGACCAGCAGTATGACATCTATCTCAACGTTACACAAGCGAGTCTTTCTGCACAGGTCAACACCAAGGT
CTCTGATTCCCTGACTGACCTGGCATTAAAGTAACTTGACCTGAACAATCCATTTGAAAGGAGTGGCTAAGAATTCTCTCTGTTCAGTCA
TCTAGACAAATCGAATTACTTGATGTTTGCCTTGAAAGAATCAACTTCTAACCTCAACCATCCAGGAAATTGACAGTGGCTGCAGTATTG
ACTCCAGTGACATAAAGTTAACCACAGTGGCCTTTTAACAAATGTTGCCTTTTATAATGTTATCTTTATGAGTTTCTTGATATGTAAGAT
GAAAAAGCATTTAGAATAATCTTTTAATTTGTGTATATTTGGGATGATATTTAGGAGCTATCAATCAAATTTTACATCTCACAATGTACT
GTTTACATGGATATTGGCTGCTTTTTTTAAGGAAAACCACATTGAGATGTGACAAGTGTTAGGACTTGTCACAGATTTCTAACTCTGCCG
CATAAACTATAAATCTGTAAGGTGGTACACAGCGTGTCTTGTTAGCAAAATTTATACTTTGATATGATCACATGTAGAAGTAGCTTCAAG
AATTTCTTGTAGTCATAAATGTTTAATAATATATGATGTAAAATTATATTATGGAGCCTAATGATGATAACAAAGAAAACAATATACTGA
TCTTAGAAAATGTAGACATGGTTAACTGGGAAATAAAATATAGAGTGGCACTTCAAGACAAGCTGACTCAATGTTTTCTTCTGCTTCCTT
TAAATAATATCCCCTTACTCATCTGTTCTTCTTTTCTTTCCCTTCTACTTCAAGGCTTTATTTCTATTATCTTTCTGACATATTTATTTA
CAGAAGTAGAGAAGTATAATCTAATTCATGTTGTAGCACTTACAGATCATATAGTACAATTATTTGTCTTTATGCTCTCCAGGAAAAATC
TGAGACAGAAAATTTTTCACCCCTATGGATAGGTTTTCACCTGTAATAAAGAAAATTTCTCTATGTCCAAACAAATTCCTTCTTGAAAAA
TACTTTTTCAAACTAAAAACTTGTTAAAATTCAATGTTCATATAATATGCATTCTAGTGGAATGAAATTCTACCTTTGTGAAATAATTTC
AGTTTTCTTAGCCCTAAAATGAATTATTTTAAAACATTTTCCAATGTCATTGTTACAAATACTAGAATTTAAGTGTTTCTGAAATTGGAA


Top

FusionGenePPI for NT5E_ASCC3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NT5EAFF1, SLC30A5, NDUFA2, SYNJ2BP, PCDH7, TMEM177, XPO7, CHD1L, FLVCR1, ATR, RPTOR, GLMN, RDH13, SCAMP1, USP22, HSDL1, RFC2, RAB9A, DNAAF5, MTOR, GHITM, PDS5A, RHOG, TNPO2, PLAA, SLC7A2, ARL2, STEAP3, SLC41A1, ADIPOR1, SLC47A1, ARF5, DEGS1, SAR1B, USP36, GJA1, SLC44A1, GNL3L, SLC16A2, SLC26A6, ARL8A, SLC6A8, VANGL2, NR2F2, CYP2S1, USP3, CXCR4, TMEM192ASCC3EIF3F, OTUD6B, G3BP1, G3BP2, SIRT7, CAND1, NOTCH1, SKIL, SOX2, HECW2, LGR4, ENO1, MOV10, NXF1, CCDC8, ALKBH3, RPS2, ASCC1, THBS3, ASCC2, NTRK1, IFI16, CC2D2A, CEP170, CEP128, CDK1, IQGAP1, HCCS, ZNF263, UBC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NT5E_ASCC3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneNT5EP21589DB00806Pentoxifylline5'-nucleotidasesmall moleculeapproved|investigational

Top

RelatedDiseases for NT5E_ASCC3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNT5EC0023893Liver Cirrhosis, Experimental1CTD_human
HgeneNT5EC0038356Stomach Neoplasms1CTD_human
HgeneNT5EC1859372Calcification of Joints and Arteries1CTD_human;ORPHANET;UNIPROT
TgeneASCC3C3714756Intellectual Disability1CTD_human