FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24908

FusionGeneSummary for NSD1_NUP98

check button Fusion gene summary
Fusion gene informationFusion gene name: NSD1_NUP98
Fusion gene ID: 24908
HgeneTgene
Gene symbol

NSD1

NUP98

Gene ID

64324

4928

Gene namenuclear receptor binding SET domain protein 1nucleoporin 98
SynonymsARA267|KMT3B|SOTOS|SOTOS1|STOADIR2|NUP196|NUP96
Cytomap

5q35.3

11p15.4

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specificH3-K36-HMTaseH4-K20-HMTaseNR-binding SET domain-containing proteinandrogen receptor coactivator 267 kDa proteinandrogen receptor-associated coregulator 267androgen receptor-asnuclear pore complex protein Nup98-Nup96nuclear pore complex protein Nup98GLFG-repeat containing nucleoporinNUP98/PHF23 fusion 2 proteinNup98-Nup96nucleoporin 98kDnucleoporin 98kDa
Modification date2018051920180523
UniProtAcc

Q96L73

P52948

Ensembl transtripts involved in fusion geneENST00000354179, ENST00000439151, 
ENST00000347982, ENST00000361032, 
ENST00000511258, 
ENST00000324932, 
ENST00000359171, ENST00000355260, 
ENST00000397004, ENST00000397007, 
ENST00000488828, 
Fusion gene scores* DoF score17 X 10 X 13=22109 X 9 X 5=405
# samples 2011
** MAII scorelog2(20/2210*10)=-3.46597446450407
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/405*10)=-1.88041838424733
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NSD1 [Title/Abstract] AND NUP98 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNSD1

GO:0045893

positive regulation of transcription, DNA-templated

11509567


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLAMLTCGA-AB-2856-03ANSD1chr5

176639196

+NUP98chr11

3756554

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000354179ENST00000324932NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000354179ENST00000359171NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000354179ENST00000355260NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000354179ENST00000397004NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000354179ENST00000397007NSD1chr5

176639196

+NUP98chr11

3756554

-
5CDS-intronENST00000354179ENST00000488828NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000439151ENST00000324932NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000439151ENST00000359171NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000439151ENST00000355260NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000439151ENST00000397004NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000439151ENST00000397007NSD1chr5

176639196

+NUP98chr11

3756554

-
5CDS-intronENST00000439151ENST00000488828NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000347982ENST00000324932NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000347982ENST00000359171NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000347982ENST00000355260NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000347982ENST00000397004NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000347982ENST00000397007NSD1chr5

176639196

+NUP98chr11

3756554

-
5CDS-intronENST00000347982ENST00000488828NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000361032ENST00000324932NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000361032ENST00000359171NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000361032ENST00000355260NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000361032ENST00000397004NSD1chr5

176639196

+NUP98chr11

3756554

-
In-frameENST00000361032ENST00000397007NSD1chr5

176639196

+NUP98chr11

3756554

-
5CDS-intronENST00000361032ENST00000488828NSD1chr5

176639196

+NUP98chr11

3756554

-
intron-3CDSENST00000511258ENST00000324932NSD1chr5

176639196

+NUP98chr11

3756554

-
intron-3CDSENST00000511258ENST00000359171NSD1chr5

176639196

+NUP98chr11

3756554

-
intron-3CDSENST00000511258ENST00000355260NSD1chr5

176639196

+NUP98chr11

3756554

-
intron-3CDSENST00000511258ENST00000397004NSD1chr5

176639196

+NUP98chr11

3756554

-
intron-3CDSENST00000511258ENST00000397007NSD1chr5

176639196

+NUP98chr11

3756554

-
intron-intronENST00000511258ENST00000488828NSD1chr5

176639196

+NUP98chr11

3756554

-

Top

FusionProtFeatures for NSD1_NUP98


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NSD1

Q96L73

NUP98

P52948

Histone methyltransferase. Preferentially methylates'Lys-36' of histone H3 and 'Lys-20' of histone H4 (in vitro).Transcriptional intermediary factor capable of both negatively orpositively influencing transcription, depending on the cellularcontext. {ECO:0000269|PubMed:21196496}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+624323_3889962428DomainPWWP 1
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+624323_3889962428DomainPWWP 1
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+220323_38811622594DomainPWWP 1
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+523323_38812652697DomainPWWP 1
TgeneNUP98chr5:176639196chr11:3756554ENST00000324932-1133890_8944691801Compositional biasNote=Poly-Glu
TgeneNUP98chr5:176639196chr11:3756554ENST00000355260-1132890_8944691727Compositional biasNote=Poly-Glu
TgeneNUP98chr5:176639196chr11:3756554ENST00000397004-1120890_894469921Compositional biasNote=Poly-Glu
TgeneNUP98chr5:176639196chr11:3756554ENST00000397007-1120890_894486938Compositional biasNote=Poly-Glu
TgeneNUP98chr5:176639196chr11:3756554ENST00000324932-1133738_8804691801DomainPeptidase S59
TgeneNUP98chr5:176639196chr11:3756554ENST00000355260-1132738_8804691727DomainPeptidase S59
TgeneNUP98chr5:176639196chr11:3756554ENST00000397004-1120738_880469921DomainPeptidase S59
TgeneNUP98chr5:176639196chr11:3756554ENST00000397007-1120738_880486938DomainPeptidase S59

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6242207_24219962428Compositional biasNote=Pro-rich
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6242207_24219962428Compositional biasNote=Pro-rich
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2202207_242111622594Compositional biasNote=Pro-rich
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5232207_242112652697Compositional biasNote=Pro-rich
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6241756_18189962428DomainPWWP 2
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6241890_19409962428DomainAWS
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6241942_20599962428DomainSET
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6242066_20829962428DomainPost-SET
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6241756_18189962428DomainPWWP 2
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6241890_19409962428DomainAWS
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6241942_20599962428DomainSET
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6242066_20829962428DomainPost-SET
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2201756_181811622594DomainPWWP 2
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2201890_194011622594DomainAWS
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2201942_205911622594DomainSET
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2202066_208211622594DomainPost-SET
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5231756_181812652697DomainPWWP 2
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5231890_194012652697DomainAWS
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5231942_205912652697DomainSET
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5232066_208212652697DomainPost-SET
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6241952_19549962428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6241994_19979962428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6242020_20219962428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6242060_20669962428RegionNote=Inhibits enzyme activity in the absence of bound histone
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6241952_19549962428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6241994_19979962428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6242020_20219962428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6242060_20669962428RegionNote=Inhibits enzyme activity in the absence of bound histone
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2201952_195411622594RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2201994_199711622594RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2202020_202111622594RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2202060_206611622594RegionNote=Inhibits enzyme activity in the absence of bound histone
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5231952_195412652697RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5231994_199712652697RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5232020_202112652697RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5232060_206612652697RegionNote=Inhibits enzyme activity in the absence of bound histone
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6241543_15899962428Zinc fingerPHD-type 1
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6241590_16469962428Zinc fingerPHD-type 2
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6241707_17519962428Zinc fingerPHD-type 3
HgeneNSD1chr5:176639196chr11:3756554ENST00000347982+6242118_21659962428Zinc fingerPHD-type 4%3B atypical
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6241543_15899962428Zinc fingerPHD-type 1
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6241590_16469962428Zinc fingerPHD-type 2
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6241707_17519962428Zinc fingerPHD-type 3
HgeneNSD1chr5:176639196chr11:3756554ENST00000354179+6242118_21659962428Zinc fingerPHD-type 4%3B atypical
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2201543_158911622594Zinc fingerPHD-type 1
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2201590_164611622594Zinc fingerPHD-type 2
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2201707_175111622594Zinc fingerPHD-type 3
HgeneNSD1chr5:176639196chr11:3756554ENST00000361032+2202118_216511622594Zinc fingerPHD-type 4%3B atypical
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5231543_158912652697Zinc fingerPHD-type 1
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5231590_164612652697Zinc fingerPHD-type 2
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5231707_175112652697Zinc fingerPHD-type 3
HgeneNSD1chr5:176639196chr11:3756554ENST00000439151+5232118_216512652697Zinc fingerPHD-type 4%3B atypical
TgeneNUP98chr5:176639196chr11:3756554ENST00000324932-11337_4804691801Compositional biasNote=Gly/Thr-rich
TgeneNUP98chr5:176639196chr11:3756554ENST00000355260-11327_4804691727Compositional biasNote=Gly/Thr-rich
TgeneNUP98chr5:176639196chr11:3756554ENST00000397004-11207_480469921Compositional biasNote=Gly/Thr-rich
TgeneNUP98chr5:176639196chr11:3756554ENST00000397007-11207_480486938Compositional biasNote=Gly/Thr-rich
TgeneNUP98chr5:176639196chr11:3756554ENST00000324932-11331_1564691801RegionNote=FG repeats 1
TgeneNUP98chr5:176639196chr11:3756554ENST00000324932-1133214_4804691801RegionNote=FG repeats 2
TgeneNUP98chr5:176639196chr11:3756554ENST00000355260-11321_1564691727RegionNote=FG repeats 1
TgeneNUP98chr5:176639196chr11:3756554ENST00000355260-1132214_4804691727RegionNote=FG repeats 2
TgeneNUP98chr5:176639196chr11:3756554ENST00000397004-11201_156469921RegionNote=FG repeats 1
TgeneNUP98chr5:176639196chr11:3756554ENST00000397004-1120214_480469921RegionNote=FG repeats 2
TgeneNUP98chr5:176639196chr11:3756554ENST00000397007-11201_156486938RegionNote=FG repeats 1
TgeneNUP98chr5:176639196chr11:3756554ENST00000397007-1120214_480486938RegionNote=FG repeats 2


Top

FusionGeneSequence for NSD1_NUP98


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_2328aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP
QSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
DTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVG
TRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQL
NEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLV
DWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSY
LEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEG
LWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLI
IRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKD

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_2166aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP
QSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
DTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVG
TRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQL
NEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLV
DWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSY
LEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDSIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEA
LCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQIALFCVEWIAQVMTWS

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_2254aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP
QSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
DTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVG
TRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQL
NEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLV
DWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSY
LEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDSIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEA
LCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVT
SLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAV

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_1448aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_1448aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_2597aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLD
SEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISG
DISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEE
KRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAE
PGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEEC
SLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGE
LSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRG
GAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKP
RKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQA
ELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTA
KSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTN
PIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLA
KITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPD
RLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQ
SQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKAD
TSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGT
RRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKL
SLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLN
EPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVD
WHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYL
EGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGL
WEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLII
RHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDR

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_2435aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLD
SEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISG
DISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEE
KRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAE
PGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEEC
SLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGE
LSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRG
GAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKP
RKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQA
ELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTA
KSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTN
PIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLA
KITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPD
RLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQ
SQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKAD
TSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGT
RRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKL
SLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLN
EPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVD
WHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYL
EGSGCVIAEEQNSQTPLRDVCFHLLKLYSDSIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEAL
CLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQIALFCVEWIAQVMTWSS

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_2523aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLD
SEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISG
DISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEE
KRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAE
PGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEEC
SLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGE
LSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRG
GAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKP
RKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQA
ELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTA
KSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTN
PIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLA
KITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPD
RLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQ
SQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKAD
TSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGT
RRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKL
SLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLN
EPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVD
WHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYL
EGSGCVIAEEQNSQTPLRDVCFHLLKLYSDSIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEAL
CLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTS
LCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVG

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_1717aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLD
SEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISG
DISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEE
KRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAE
PGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEEC
SLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGE
LSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRG
GAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKP
RKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQA
ELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTA
KSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTN
PIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLA
KITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPD
RLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQ

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_1717aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLD
SEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISG
DISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEE
KRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAE
PGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEEC
SLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGE
LSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRG
GAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKP
RKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQA
ELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTA
KSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTN
PIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLA
KITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPD
RLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQ

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_2328aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP
QSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
DTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVG
TRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQL
NEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLV
DWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSY
LEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEG
LWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLI
IRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKD

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_2166aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP
QSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
DTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVG
TRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQL
NEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLV
DWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSY
LEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDSIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEA
LCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQIALFCVEWIAQVMTWS

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_2254aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP
QSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
DTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVG
TRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQL
NEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLV
DWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSY
LEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDSIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEA
LCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVT
SLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAV

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_1448aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_1448aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRR
PYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKL
DSEEDMPFEDCTNDPESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFIS
GDISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDE
EKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSA
EPGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEE
CSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI
PIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSG
ELSASLPGLLSDKRDLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLR
GGAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTK
PRKRMNRFKEKENSECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGT
AKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPP

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_2494aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLDSEEDMPFEDCTND
PESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISGDISDTQASNELSR
IANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSD
DGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDL
KASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSP
LASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDYKFSTLLMM
LKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGELSASLPGLLSDKR
DLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRGGAEDPSKEDPLQI
MGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENS
ECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQAELPEPALTDPNAS
AAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEP
SLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESA
GNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSD
FTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEA
VSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVV
ELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPIS
ASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSV
TYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKLSLRQRKPDEDMKL
YQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRR
AFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDE
RLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNS
QTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDN
SGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENY
DYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANL

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_2332aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLDSEEDMPFEDCTND
PESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISGDISDTQASNELSR
IANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSD
DGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDL
KASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSP
LASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDYKFSTLLMM
LKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGELSASLPGLLSDKR
DLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRGGAEDPSKEDPLQI
MGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENS
ECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQAELPEPALTDPNAS
AAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEP
SLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESA
GNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSD
FTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEA
VSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVV
ELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPIS
ASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSV
TYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKLSLRQRKPDEDMKL
YQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRR
AFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDE
RLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNS
QTPLRDVCFHLLKLYSDSIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHK

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_2420aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLDSEEDMPFEDCTND
PESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISGDISDTQASNELSR
IANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSD
DGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDL
KASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSP
LASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDYKFSTLLMM
LKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGELSASLPGLLSDKR
DLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRGGAEDPSKEDPLQI
MGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENS
ECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQAELPEPALTDPNAS
AAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEP
SLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESA
GNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSD
FTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEA
VSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVV
ELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPIS
ASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSV
TYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKLSLRQRKPDEDMKL
YQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRR
AFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDE
RLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNS
QTPLRDVCFHLLKLYSDSIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHK
LIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSA

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_1614aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLDSEEDMPFEDCTND
PESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISGDISDTQASNELSR
IANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSD
DGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDL
KASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSP
LASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDYKFSTLLMM
LKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGELSASLPGLLSDKR
DLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRGGAEDPSKEDPLQI
MGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENS
ECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQAELPEPALTDPNAS
AAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEP
SLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESA
GNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSD
FTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEA

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_1614aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFVPQKILSKWEASVGLAEQYDVPKGSKNRKCIPGSIKLDSEEDMPFEDCTND
PESEHDLLLNGCLKSLAFDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISGDISDTQASNELSR
IANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALISKCSREKNKPQRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSD
DGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDL
KASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSP
LASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDYKFSTLLMM
LKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGSTHNSEKKGDGTQNSANPSPSGGDSALSGELSASLPGLLSDKR
DLPASGKSRSDCVTRRNCGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRGGAEDPSKEDPLQI
MGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENS
ECAFRVLLPSDPVQEGRDEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQAELPEPALTDPNAS
AAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEP
SLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESA
GNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSD
FTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_6984nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT
CAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGAT
ACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTC
TTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCA
GATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAA
TCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCA
TCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGT
ACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGA
CGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAG
ATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAA
CTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTG
GATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTA
CCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTA
AATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAG
GAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCC
CAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTG
GACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTC
TCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCC
TCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTAT
CTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGT
GACAGACATTATGATCTCAACCAGCTGCTGGAGCCTCGAAGCATAACAGCAGATCCTTTGGACTACCGCCTAAGCTGGCACTTGTGGGAA
GTGCTGAGGGCTCTTAACTACACCCATCTCTCAGCGCAGTGTGAAGGTGTGCTACAGGCCAGTTACGCTGGCCAGCTTGAAAGTGAGGGG
CTCTGGGAGTGGGCCATCTTTGTCCTCCTGCACATTGACAACTCAGGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGC
CAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAA
GCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATC
ATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGC
AGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGAT
TGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGAT
CGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGAC
TCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAA

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_6498nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT
CAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGAT
ACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTC
TTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCA
GATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAA
TCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCA
TCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGT
ACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGA
CGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAG
ATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAA
CTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTG
GATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTA
CCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTA
AATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAG
GAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCC
CAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTG
GACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTC
TCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCC
TCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTAT
CTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGT
GACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTC
CTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCC
CTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTAT
GACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTG
GACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGATAGCACTGTTTTGTGTAGAGTGGATTGCTCAGGTAATGACCTGGAGC

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_6762nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT
CAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGAT
ACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTC
TTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCA
GATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAA
TCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCA
TCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGT
ACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGA
CGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAG
ATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAA
CTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTG
GATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTA
CCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTA
AATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAG
GAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCC
CAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTG
GACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTC
TCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCC
TCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTAT
CTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGT
GACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTC
CTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCC
CTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTAT
GACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTG
GACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACT
TCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTG
CTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCT
CCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTT

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_4344nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_4344nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_7791nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAA
TTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCC
TATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACAT
CAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAA
TGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGAC
AGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCT
TTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGT
GTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGG
GATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTT
TCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCA
AAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAA
AAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAAC
AGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCT
GCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAG
CCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCT
CTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCG
AAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGC
AGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAAC
AATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGA
TCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCT
ATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCT
CAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGC
TCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAG
TTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAAC
TGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACC
GAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGT
GGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTC
GATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTA
ATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCT
CGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGG
GATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCT
GGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCT
GAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCA
CCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAG
AAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCC
AAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTT
TTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGA
GAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAAC
CCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTA
AACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAA
ATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCT
AAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTG
AATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTG
GGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGAT
CGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGT
TCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACA
AAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAG
AGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACC
ATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTA
CAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGAT
ACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCA
AAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCC
ACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACA
CGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGC
TCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATT
GCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTC
AGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGAT
GAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCA
GAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAAT
GAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAA
GTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAG
CAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGAC
TGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCA
GAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCC
ATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTG
GAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGAC
AGACATTATGATCTCAACCAGCTGCTGGAGCCTCGAAGCATAACAGCAGATCCTTTGGACTACCGCCTAAGCTGGCACTTGTGGGAAGTG
CTGAGGGCTCTTAACTACACCCATCTCTCAGCGCAGTGTGAAGGTGTGCTACAGGCCAGTTACGCTGGCCAGCTTGAAAGTGAGGGGCTC
TGGGAGTGGGCCATCTTTGTCCTCCTGCACATTGACAACTCAGGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAG
CTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCT
GTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATC
CGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGC
CTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGATTGC
TCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGC
CTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCA
ACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTG

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_7305nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAA
TTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCC
TATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACAT
CAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAA
TGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGAC
AGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCT
TTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGT
GTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGG
GATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTT
TCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCA
AAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAA
AAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAAC
AGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCT
GCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAG
CCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCT
CTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCG
AAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGC
AGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAAC
AATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGA
TCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCT
ATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCT
CAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGC
TCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAG
TTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAAC
TGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACC
GAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGT
GGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTC
GATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTA
ATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCT
CGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGG
GATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCT
GGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCT
GAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCA
CCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAG
AAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCC
AAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTT
TTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGA
GAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAAC
CCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTA
AACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAA
ATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCT
AAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTG
AATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTG
GGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGAT
CGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGT
TCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACA
AAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAG
AGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACC
ATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTA
CAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGAT
ACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCA
AAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCC
ACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACA
CGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGC
TCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATT
GCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTC
AGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGAT
GAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCA
GAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAAT
GAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAA
GTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAG
CAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGAC
TGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCA
GAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCC
ATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTG
GAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGAC
AGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTT
ACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTT
TGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGAC
TACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGAC
TATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGATAGCACTGTTTTGTGTAGAGTGGATTGCTCAGGTAATGACCTGGAGCAGT

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_7569nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAA
TTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCC
TATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACAT
CAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAA
TGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGAC
AGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCT
TTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGT
GTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGG
GATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTT
TCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCA
AAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAA
AAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAAC
AGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCT
GCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAG
CCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCT
CTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCG
AAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGC
AGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAAC
AATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGA
TCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCT
ATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCT
CAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGC
TCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAG
TTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAAC
TGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACC
GAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGT
GGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTC
GATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTA
ATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCT
CGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGG
GATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCT
GGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCT
GAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCA
CCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAG
AAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCC
AAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTT
TTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGA
GAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAAC
CCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTA
AACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAA
ATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCT
AAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTG
AATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTG
GGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGAT
CGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGT
TCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACA
AAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAG
AGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACC
ATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTA
CAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGAT
ACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCA
AAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCC
ACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACA
CGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGC
TCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATT
GCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTC
AGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGAT
GAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCA
GAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAAT
GAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAA
GTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAG
CAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGAC
TGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCA
GAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCC
ATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTG
GAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGAC
AGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTT
ACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTT
TGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGAC
TACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGAC
TATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCA
CTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTG
CGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCC
CACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTTGGG

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_5151nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAA
TTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCC
TATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACAT
CAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAA
TGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGAC
AGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCT
TTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGT
GTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGG
GATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTT
TCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCA
AAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAA
AAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAAC
AGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCT
GCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAG
CCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCT
CTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCG
AAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGC
AGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAAC
AATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGA
TCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCT
ATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCT
CAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGC
TCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAG
TTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAAC
TGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACC
GAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGT
GGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTC
GATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTA
ATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCT
CGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGG
GATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCT
GGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCT
GAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCA
CCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAG
AAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCC
AAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTT
TTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGA
GAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAAC
CCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTA
AACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAA
ATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCT
AAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTG
AATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTG
GGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGAT
CGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGT
TCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACA
AAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAG

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_5151nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAA
TTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCC
TATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACAT
CAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAA
TGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGAC
AGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCT
TTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGT
GTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGG
GATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTT
TCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCA
AAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAA
AAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAAC
AGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCT
GCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAG
CCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCT
CTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCG
AAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGC
AGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAAC
AATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGA
TCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCT
ATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCT
CAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGC
TCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAG
TTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAAC
TGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACC
GAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGT
GGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTC
GATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTA
ATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCT
CGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGG
GATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCT
GGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCT
GAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCA
CCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAG
AAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCC
AAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTT
TTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGA
GAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAAC
CCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTA
AACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAA
ATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCT
AAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTG
AATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTG
GGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGAT
CGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGT
TCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACA
AAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAG

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_6984nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT
CAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGAT
ACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTC
TTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCA
GATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAA
TCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCA
TCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGT
ACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGA
CGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAG
ATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAA
CTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTG
GATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTA
CCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTA
AATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAG
GAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCC
CAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTG
GACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTC
TCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCC
TCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTAT
CTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGT
GACAGACATTATGATCTCAACCAGCTGCTGGAGCCTCGAAGCATAACAGCAGATCCTTTGGACTACCGCCTAAGCTGGCACTTGTGGGAA
GTGCTGAGGGCTCTTAACTACACCCATCTCTCAGCGCAGTGTGAAGGTGTGCTACAGGCCAGTTACGCTGGCCAGCTTGAAAGTGAGGGG
CTCTGGGAGTGGGCCATCTTTGTCCTCCTGCACATTGACAACTCAGGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGC
CAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAA
GCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATC
ATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGC
AGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGAT
TGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGAT
CGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGAC
TCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAA

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_6498nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT
CAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGAT
ACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTC
TTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCA
GATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAA
TCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCA
TCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGT
ACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGA
CGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAG
ATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAA
CTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTG
GATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTA
CCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTA
AATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAG
GAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCC
CAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTG
GACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTC
TCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCC
TCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTAT
CTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGT
GACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTC
CTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCC
CTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTAT
GACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTG
GACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGATAGCACTGTTTTGTGTAGAGTGGATTGCTCAGGTAATGACCTGGAGC

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_6762nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT
CAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGAT
ACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTC
TTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCA
GATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAA
TCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCA
TCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGT
ACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGA
CGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAG
ATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAA
CTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTG
GATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTA
CCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTA
AATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAG
GAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCC
CAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTG
GACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTC
TCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCC
TCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTAT
CTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGT
GACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTC
CTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCC
CTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTAT
GACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTG
GACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACT
TCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTG
CTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCT
CCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTT

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_4344nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_4344nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCA
AAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGG
CCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGA
CATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGT
AAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTG
GACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTG
GCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACT
AGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCT
GGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTG
TTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATC
TCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAG
GAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGAT
AACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTT
GCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCA
GAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGAT
GCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACAT
TCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAG
TGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTG
AACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTAC
AGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATA
CCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACT
GCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGA
GGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGC
GAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGC
AACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAG
ACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGA
GGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCAT
TTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCT
GTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAA
CCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGG
CGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCA
GCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAG
GCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATAC
TCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCC
CAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACA
GCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTG
GTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAAT
GGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACT
AACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCA
TTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAA
GAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTT
GCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGAT
GTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCT
GTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCA
GATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACT
GGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGT
ACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCT

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_7482nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG
ACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTG
GAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTG
TCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGAT
GTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCA
GCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCT
GTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTG
TTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTC
ACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCT
AATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTA
GCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTA
TATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCT
GTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACA
CTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGA
GCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTA
TTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAG
TTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAG
AGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGG
AAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAG
AATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCA
CAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGACATTATGATCTCAACCAGCTGCTGGAGCCTCGAAGC
ATAACAGCAGATCCTTTGGACTACCGCCTAAGCTGGCACTTGTGGGAAGTGCTGAGGGCTCTTAACTACACCCATCTCTCAGCGCAGTGT
GAAGGTGTGCTACAGGCCAGTTACGCTGGCCAGCTTGAAAGTGAGGGGCTCTGGGAGTGGGCCATCTTTGTCCTCCTGCACATTGACAAC
TCAGGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTC
CTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCC
CTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTAT
GACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTG
GACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACT
TCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTG
CTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCT
CCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTT

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_6996nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG
ACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTG
GAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTG
TCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGAT
GTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCA
GCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCT
GTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTG
TTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTC
ACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCT
AATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTA
GCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTA
TATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCT
GTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACA
CTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGA
GCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTA
TTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAG
TTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAG
AGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGG
AAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAG
AATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCA
CAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGG
CACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAG
GCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAG
CTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAG
CGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAG

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_7260nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG
ACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTG
GAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTG
TCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGAT
GTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCA
GCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCT
GTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTG
TTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTC
ACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCT
AATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTA
GCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTA
TATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCT
GTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACA
CTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGA
GCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTA
TTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAG
TTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAG
AGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGG
AAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAG
AATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCA
CAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGG
CACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAG
GCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAG
CTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAG
CGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAG
GTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCT
AAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACC
TCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATG

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_4842nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_4842nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_8293nt
GGCCGGGTAGGGGGTTCGCCTGCGGCCGCGTCTGCTCGGGGCCTGAGGCCTCGAAGACCCCAGCCCAAGCCCCCAGGTTGATGCCGGCCC
AGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGAC
AGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGA
ATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATG
GTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGT
GGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACC
TGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGG
ACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCC
ATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTC
TGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACAT
ACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCA
GGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAA
CACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAA
GAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCAT
TAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCC
AGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGT
AAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTC
TCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAA
CCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAA
GTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTC
TTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAAC
CAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGT
CAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAA
ATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTA
CCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGA
GAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACC
TGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCC
TTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACT
GAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAG
TAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCA
ATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGA
TGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAG
ATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCA
TAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGT
TTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGC
TTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCC
TCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACC
TACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGA
TGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAA
TAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCT
AAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTAT
TCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTT
GCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTA
CCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAA
AGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAA
TTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAG
GAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAA
CTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGT
CTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGC
TCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGT
GGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCAT
GCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATC
ATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTG
TTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGC
TTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGT
CCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCT
AGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTG
GGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTT
TGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAA
GCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCAT
TGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAA
GCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACAT
TCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAA
AAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCG
TCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGC
AGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAA
CGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAG
CATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGT
GATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGACATTATGATCTCAA
CCAGCTGCTGGAGCCTCGAAGCATAACAGCAGATCCTTTGGACTACCGCCTAAGCTGGCACTTGTGGGAAGTGCTGAGGGCTCTTAACTA
CACCCATCTCTCAGCGCAGTGTGAAGGTGTGCTACAGGCCAGTTACGCTGGCCAGCTTGAAAGTGAGGGGCTCTGGGAGTGGGCCATCTT
TGTCCTCCTGCACATTGACAACTCAGGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGA
ATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGA
ATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGA
TGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGA
AACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGA
GCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACAT
GGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCG
AGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTC
CTATCTGCGAGAACTGGCTGTTGGGAGCCTGTGAGCCCCAGGCACTTTGCATCACAGTCACATGCCCATTCACACCACACAGAGGTTCCC
TGCCTTGTTTGGATTGGCACTGTTTGCCATTCTCTGGGTTGGCTGTGGCATCTACCCTCCCTCCCTGCTGCCAGAAGCAGCATCCTCCAC
TTGTTCAGGGCTTTTCTTAATACTGAACGTAGCATAAGGGCTTCTGGAACCCAGAAGAGGAGACAGTTTACCATCCTCAAGATCATTCAG
TGTTTTTCCTTTAAAAAAATGGTCAATAAAGCTCCTTTGGCAGAATCCCCCAAAGAACCAGGGTATTCTTTTTCCATCCCTAGCCATTCT
GGATCTTGTGACCCTCCATGCCAACCAGCTTCCCTACTCCTACCCTGGCCCTTTTATACTAGGACTCCTTAGGAGGAGTGAGACAGGTGA
TAATGGATCCTTAACAGATGAACTATCCACAGAAGGAAGAGGGATCCGTCTCTTAAGTAATTGGTTAGTTAACACTGAATTTTGGAGGCA
AAGGAGGGTTGGCCTGAGTTAGGAAACAAAATGGGATCTTTCTGACACACTTAGGGCAGAAGTGAATGCCTGTCACGGAGGGATTGATCT
TCAGGGCTGTTTTTGTTCCTGCCTTTAGAGTTCCATGAACACCATACCTTTGCTACTACTATGTGCAGGAACCCTTGGTCACATGTGACA
TGTCTGTGGGAAGCTCCCAGAGTTTGGTTTGGTCCCTGGTTTTCAGTCTTGCTGAGACTCTGTCTGGATTTGCCTGCAGAGTTTGGATAA
AAAATGGCAGGTTGGGTAACCCTCCCTGTTCATCCCATGTTAGCTCCAAAGCATTTCCCACCCTCCATCTACCCCTTCCAGAAGCAAAAA
CAAACCATGACTGAGGCAGGCATGGAGTTGGGCGTTAGGGGCAGGCAGAGGGCCTTTGCTACACTGCTGACAGCTATAGGGAGCCCCAGG
TAATGGCATGAGATAGCTGGTGTTAGGGCTATCTCAGGCAATATGGCCACACCTGGGTCTTTATGCATGAAGATAATGTAAAGGTTTTTA
TTAAAAAATATATATATGTATAAATAAATGATCTAGATATTTTCCTCTTTTTCTGAAGCTACTTTCTTAAAAAATAAATAAAATGTTTAT

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_8090nt
GGCCGGGTAGGGGGTTCGCCTGCGGCCGCGTCTGCTCGGGGCCTGAGGCCTCGAAGACCCCAGCCCAAGCCCCCAGGTTGATGCCGGCCC
AGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGAC
AGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGA
ATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATG
GTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGT
GGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACC
TGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGG
ACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCC
ATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTC
TGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACAT
ACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCA
GGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAA
CACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAA
GAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCAT
TAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCC
AGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGT
AAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTC
TCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAA
CCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAA
GTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTC
TTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAAC
CAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGT
CAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAA
ATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTA
CCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGA
GAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACC
TGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCC
TTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACT
GAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAG
TAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCA
ATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGA
TGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAG
ATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCA
TAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGT
TTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGC
TTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCC
TCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACC
TACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGA
TGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAA
TAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCT
AAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTAT
TCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTT
GCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTA
CCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAA
AGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAA
TTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAG
GAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAA
CTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGT
CTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGC
TCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGT
GGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCAT
GCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATC
ATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTG
TTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGC
TTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGT
CCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCT
AGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTG
GGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTT
TGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAA
GCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCAT
TGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAA
GCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACAT
TCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAA
AAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCG
TCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGC
AGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAA
CGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAG
CATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGT
GATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGCATACGTGAGAAGGC
TGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGT
ACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGA
GCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTT
GGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGA
AATGCTCCGCCATATACAGCAGATAGCACTGTTTTGTGTAGAGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACT
TCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTG
CTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCT
CCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTT
GGGAGCCTGTGAGCCCCAGGCACTTTGCATCACAGTCACATGCCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGGCACTG
TTTGCCATTCTCTGGGTTGGCTGTGGCATCTACCCTCCCTCCCTGCTGCCAGAAGCAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATA
CTGAACGTAGCATAAGGGCTTCTGGAACCCAGAAGAGGAGACAGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAAAATGG
TCAATAAAGCTCCTTTGGCAGAATCCCCCAAAGAACCAGGGTATTCTTTTTCCATCCCTAGCCATTCTGGATCTTGTGACCCTCCATGCC
AACCAGCTTCCCTACTCCTACCCTGGCCCTTTTATACTAGGACTCCTTAGGAGGAGTGAGACAGGTGATAATGGATCCTTAACAGATGAA
CTATCCACAGAAGGAAGAGGGATCCGTCTCTTAAGTAATTGGTTAGTTAACACTGAATTTTGGAGGCAAAGGAGGGTTGGCCTGAGTTAG
GAAACAAAATGGGATCTTTCTGACACACTTAGGGCAGAAGTGAATGCCTGTCACGGAGGGATTGATCTTCAGGGCTGTTTTTGTTCCTGC
CTTTAGAGTTCCATGAACACCATACCTTTGCTACTACTATGTGCAGGAACCCTTGGTCACATGTGACATGTCTGTGGGAAGCTCCCAGAG
TTTGGTTTGGTCCCTGGTTTTCAGTCTTGCTGAGACTCTGTCTGGATTTGCCTGCAGAGTTTGGATAAAAAATGGCAGGTTGGGTAACCC
TCCCTGTTCATCCCATGTTAGCTCCAAAGCATTTCCCACCCTCCATCTACCCCTTCCAGAAGCAAAAACAAACCATGACTGAGGCAGGCA
TGGAGTTGGGCGTTAGGGGCAGGCAGAGGGCCTTTGCTACACTGCTGACAGCTATAGGGAGCCCCAGGTAATGGCATGAGATAGCTGGTG
TTAGGGCTATCTCAGGCAATATGGCCACACCTGGGTCTTTATGCATGAAGATAATGTAAAGGTTTTTATTAAAAAATATATATATGTATA

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_7282nt
GGCCGGGTAGGGGGTTCGCCTGCGGCCGCGTCTGCTCGGGGCCTGAGGCCTCGAAGACCCCAGCCCAAGCCCCCAGGTTGATGCCGGCCC
AGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGAC
AGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGA
ATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATG
GTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGT
GGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACC
TGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGG
ACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCC
ATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTC
TGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACAT
ACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCA
GGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAA
CACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAA
GAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCAT
TAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCC
AGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGT
AAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTC
TCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAA
CCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAA
GTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTC
TTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAAC
CAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGT
CAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAA
ATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTA
CCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGA
GAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACC
TGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCC
TTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACT
GAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAG
TAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCA
ATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGA
TGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAG
ATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCA
TAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGT
TTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGC
TTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCC
TCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACC
TACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGA
TGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAA
TAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCT
AAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTAT
TCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTT
GCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTA
CCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAA
AGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAA
TTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAG
GAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAA
CTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGT
CTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGC
TCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGT
GGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCAT
GCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATC
ATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTG
TTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGC
TTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGT
CCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCT
AGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTG
GGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTT
TGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAA
GCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCAT
TGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAA
GCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACAT
TCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAA
AAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCG
TCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGC
AGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAA
CGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAG
CATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGT
GATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGCATACGTGAGAAGGC
TGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGT
ACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGA
GCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTT
GGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGA
AATGCTCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGA
GCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCT
GCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCC
CATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTTGGGAGCCTGTGAGCCCCAGG
CACTTTGCATCACAGTCACATGCCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGGCACTGTTTGCCATTCTCTGGGTTGG
CTGTGGCATCTACCCTCCCTCCCTGCTGCCAGAAGCAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATACTGAACGTAGCATAAGGGCT
TCTGGAACCCAGAAGAGGAGACAGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAAAATGGTCAATAAAGCTCCTTTGGCA

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_5494nt
GGCCGGGTAGGGGGTTCGCCTGCGGCCGCGTCTGCTCGGGGCCTGAGGCCTCGAAGACCCCAGCCCAAGCCCCCAGGTTGATGCCGGCCC
AGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGAC
AGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGA
ATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATG
GTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGT
GGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACC
TGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGG
ACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCC
ATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTC
TGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACAT
ACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCA
GGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAA
CACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAA
GAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCAT
TAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCC
AGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGT
AAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTC
TCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAA
CCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAA
GTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTC
TTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAAC
CAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGT
CAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAA
ATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTA
CCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGA
GAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACC
TGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCC
TTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACT
GAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAG
TAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCA
ATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGA
TGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAG
ATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCA
TAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGT
TTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGC
TTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCC
TCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACC
TACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGA
TGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAA
TAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCT
AAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTAT
TCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTT
GCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTA
CCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAA
AGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAA
TTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAG
GAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAA
CTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGT
CTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGC
TCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGGTAGAGAAAAAAGGACA
GTGAATTTGAATGGAATCCGTGATACCGAAGTTGAAAGCAAGTCATTCAGCTAATACAAAGCTGTTTTATGACCCTTGGAACTTTGAAGA
GTACAAACATTGGCAATCACGTTGAAACAAGTGCAAGGGAGGGCGTGAGGTCTTGCAGGCATCTGTCTTTTTACTGGAGAGATTTAAAGA
ATTCTCTTGCTGTTTGGATTATTCCTCTACAGATTGTCATTTTTAAACCCTTTGTTCTCTCTCATTTGGACTTGCTGAATTCTCTGCTCA
GTGATTAACTTAAGATTTGCTCATGTGGGTTCATGCACAGTAAATTCTGCCTTTATTGACTACCTGATGTGCAGTTTAATCTTTTTCTTT
ACCTCCATGGTTTTTTAAAAGTTAAATTAGCTTTCTGAAAGGGTTTTTAATCTCCATTTTTTTAAAGTTGTTTGCTTATACTTCGGGTAA
CCTTGATATTTGTATTTTAATAGTACATAATCTTTATGAAAAATAGTTTGGGAATGTAAATGAATTATTATTTGGCTTGGGGAGATTAGG
GCCTACATTGTTTATCGCAATTACTTGTATCATTGATACGGGATTTCTTTGTAAAGCATCCTCTACCTCTCAGCTGCTGAAAGCTAGACC
TTTGGTATTTTCCATGCTATAATTCTTATGGCTGCTGAAATGTGTGGTTTTTATGATTTATTAAATAATCTCTTAGGAGGCATTTCTGGA
GAATGTGTGTATATACATGTTTGCGCGTACAGGGGAGGGGAGGGTATGATAAATGTGGGAAACTGGAAATATATTGACTTTTATGTTTAT
AATCTTGGTAGCATTTAGAATGCCCCTAAGAAATCTCCATTGACAAATGAAATGCTATAGACTTGGTTTTCCAGTTATCCATATTCATTT
TGTCTGTCATATGCTTTGTATCATCTCCTTCTTTCCTAATTTTTTATAACCTTATATATATATTTATTATAAATATATGTATTTCTGAGG

>In-frame_NSD1_ENST00000354179_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_5212nt
GGCCGGGTAGGGGGTTCGCCTGCGGCCGCGTCTGCTCGGGGCCTGAGGCCTCGAAGACCCCAGCCCAAGCCCCCAGGTTGATGCCGGCCC
AGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGAC
AGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGA
ATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATG
GTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGT
GGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACC
TGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGG
ACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCC
ATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTC
TGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACAT
ACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCA
GGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAA
CACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAA
GAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCAT
TAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCC
AGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGT
AAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTC
TCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAA
CCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAA
GTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTC
TTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAAC
CAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGT
CAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAA
ATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTA
CCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGA
GAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACC
TGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCC
TTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACT
GAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAG
TAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCA
ATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGA
TGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAG
ATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCA
TAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGT
TTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGC
TTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCC
TCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACC
TACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGA
TGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAA
TAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCT
AAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTAT
TCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTT
GCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTA
CCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAA
AGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAA
TTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAG
GAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAA
CTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGT
CTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGC
TCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGGTAGAGAAAAAAGGACA
GTGAATTTGAATGGAATCCGTGATACCGAAGTTGAAAGCAAGTCATTCAGCTAATACAAAGCTGTTTTATGACCCTTGGAACTTTGAAGA
GTACAAACATTGGCAATCACGTTGAAACAAGTGCAAGGGAGGGCGTGAGGTCTTGCAGGCATCTGTCTTTTTACTGGAGAGATTTAAAGA
ATTCTCTTGCTGTTTGGATTATTCCTCTACAGATTGTCATTTTTAAACCCTTTGTTCTCTCTCATTTGGACTTGCTGAATTCTCTGCTCA
GTGATTAACTTAAGATTTGCTCATGTGGGTTCATGCACAGTAAATTCTGCCTTTATTGACTACCTGATGTGCAGTTTAATCTTTTTCTTT
ACCTCCATGGTTTTTTAAAAGTTAAATTAGCTTTCTGAAAGGGTTTTTAATCTCCATTTTTTTAAAGTTGTTTGCTTATACTTCGGGTAA
CCTTGATATTTGTATTTTAATAGTACATAATCTTTATGAAAAATAGTTTGGGAATGTAAATGAATTATTATTTGGCTTGGGGAGATTAGG
GCCTACATTGTTTATCGCAATTACTTGTATCATTGATACGGGATTTCTTTGTAAAGCATCCTCTACCTCTCAGCTGCTGAAAGCTAGACC

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_8985nt
GCTGGCCCGGGAGGGGGCGCGGGGCACGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCC
TTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGG
TGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCTTATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTA
CAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCTGCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCA
AGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGTCCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCC
CCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTTCTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGAT
TCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATAGAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTAT
GAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAACAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCA
TTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAAAGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCA
GCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAATTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGT
ACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAG
TCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCG
TTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGA
GCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAA
GAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAG
GGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAG
TCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCT
AAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGG
AGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCA
AATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCA
AATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGT
GGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGA
AGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATG
TTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGT
AACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCA
TCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAAC
TCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAA
GAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCC
AGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCA
GTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCA
AAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAA
GATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCT
ACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCC
GCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTC
CCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCA
GCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGAT
GCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGC
CACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAA
GGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTG
CCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGT
GCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAG
GAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGT
GACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCC
CAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCT
AAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCT
GCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTA
GCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGT
GATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAG
CAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAAT
AAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAA
GAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTC
ACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACT
ATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGG
AAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTT
TGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCA
AGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAG
GATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACG
CCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTG
GACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCC
TCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGAT
ATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCC
CACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAA
GAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACA
ATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTAT
GGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGT
GGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTT
AAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAG
ACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATT
CATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGT
GAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTC
TCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGC
TACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTG
GGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTG
CGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGC
TCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACC
TCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACA
CCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGACATTATGATCTCAACCAGCTGCTGGAGCCTCGAAGCATAACA
GCAGATCCTTTGGACTACCGCCTAAGCTGGCACTTGTGGGAAGTGCTGAGGGCTCTTAACTACACCCATCTCTCAGCGCAGTGTGAAGGT
GTGCTACAGGCCAGTTACGCTGGCCAGCTTGAAAGTGAGGGGCTCTGGGAGTGGGCCATCTTTGTCCTCCTGCACATTGACAACTCAGGC
ATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACC
CAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGC
TTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTAC
CTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTAT
ATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTG
TGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGC
GTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCAC
ATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTTGGGAGC
CTGTGAGCCCCAGGCACTTTGCATCACAGTCACATGCCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGGCACTGTTTGCC
ATTCTCTGGGTTGGCTGTGGCATCTACCCTCCCTCCCTGCTGCCAGAAGCAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATACTGAAC
GTAGCATAAGGGCTTCTGGAACCCAGAAGAGGAGACAGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAAAATGGTCAATA
AAGCTCCTTTGGCAGAATCCCCCAAAGAACCAGGGTATTCTTTTTCCATCCCTAGCCATTCTGGATCTTGTGACCCTCCATGCCAACCAG
CTTCCCTACTCCTACCCTGGCCCTTTTATACTAGGACTCCTTAGGAGGAGTGAGACAGGTGATAATGGATCCTTAACAGATGAACTATCC
ACAGAAGGAAGAGGGATCCGTCTCTTAAGTAATTGGTTAGTTAACACTGAATTTTGGAGGCAAAGGAGGGTTGGCCTGAGTTAGGAAACA
AAATGGGATCTTTCTGACACACTTAGGGCAGAAGTGAATGCCTGTCACGGAGGGATTGATCTTCAGGGCTGTTTTTGTTCCTGCCTTTAG
AGTTCCATGAACACCATACCTTTGCTACTACTATGTGCAGGAACCCTTGGTCACATGTGACATGTCTGTGGGAAGCTCCCAGAGTTTGGT
TTGGTCCCTGGTTTTCAGTCTTGCTGAGACTCTGTCTGGATTTGCCTGCAGAGTTTGGATAAAAAATGGCAGGTTGGGTAACCCTCCCTG
TTCATCCCATGTTAGCTCCAAAGCATTTCCCACCCTCCATCTACCCCTTCCAGAAGCAAAAACAAACCATGACTGAGGCAGGCATGGAGT
TGGGCGTTAGGGGCAGGCAGAGGGCCTTTGCTACACTGCTGACAGCTATAGGGAGCCCCAGGTAATGGCATGAGATAGCTGGTGTTAGGG
CTATCTCAGGCAATATGGCCACACCTGGGTCTTTATGCATGAAGATAATGTAAAGGTTTTTATTAAAAAATATATATATGTATAAATAAA

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_8782nt
GCTGGCCCGGGAGGGGGCGCGGGGCACGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCC
TTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGG
TGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCTTATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTA
CAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCTGCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCA
AGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGTCCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCC
CCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTTCTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGAT
TCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATAGAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTAT
GAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAACAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCA
TTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAAAGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCA
GCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAATTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGT
ACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAG
TCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCG
TTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGA
GCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAA
GAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAG
GGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAG
TCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCT
AAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGG
AGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCA
AATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCA
AATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGT
GGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGA
AGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATG
TTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGT
AACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCA
TCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAAC
TCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAA
GAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCC
AGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCA
GTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCA
AAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAA
GATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCT
ACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCC
GCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTC
CCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCA
GCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGAT
GCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGC
CACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAA
GGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTG
CCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGT
GCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAG
GAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGT
GACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCC
CAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCT
AAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCT
GCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTA
GCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGT
GATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAG
CAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAAT
AAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAA
GAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTC
ACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACT
ATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGG
AAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTT
TGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCA
AGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAG
GATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACG
CCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTG
GACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCC
TCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGAT
ATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCC
CACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAA
GAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACA
ATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTAT
GGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGT
GGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTT
AAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAG
ACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATT
CATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGT
GAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTC
TCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGC
TACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTG
GGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTG
CGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGC
TCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACC
TCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACA
CCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGC
CAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAA
GCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATC
ATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGC
AGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGATAGCA
CTGTTTTGTGTAGAGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTC
AGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATC
CTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTG
AGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTTGGGAGCCTGTGAGCCCCAGGCACTTTGC
ATCACAGTCACATGCCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGGCACTGTTTGCCATTCTCTGGGTTGGCTGTGGCA
TCTACCCTCCCTCCCTGCTGCCAGAAGCAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATACTGAACGTAGCATAAGGGCTTCTGGAAC
CCAGAAGAGGAGACAGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAAAATGGTCAATAAAGCTCCTTTGGCAGAATCCCC
CAAAGAACCAGGGTATTCTTTTTCCATCCCTAGCCATTCTGGATCTTGTGACCCTCCATGCCAACCAGCTTCCCTACTCCTACCCTGGCC
CTTTTATACTAGGACTCCTTAGGAGGAGTGAGACAGGTGATAATGGATCCTTAACAGATGAACTATCCACAGAAGGAAGAGGGATCCGTC
TCTTAAGTAATTGGTTAGTTAACACTGAATTTTGGAGGCAAAGGAGGGTTGGCCTGAGTTAGGAAACAAAATGGGATCTTTCTGACACAC
TTAGGGCAGAAGTGAATGCCTGTCACGGAGGGATTGATCTTCAGGGCTGTTTTTGTTCCTGCCTTTAGAGTTCCATGAACACCATACCTT
TGCTACTACTATGTGCAGGAACCCTTGGTCACATGTGACATGTCTGTGGGAAGCTCCCAGAGTTTGGTTTGGTCCCTGGTTTTCAGTCTT
GCTGAGACTCTGTCTGGATTTGCCTGCAGAGTTTGGATAAAAAATGGCAGGTTGGGTAACCCTCCCTGTTCATCCCATGTTAGCTCCAAA
GCATTTCCCACCCTCCATCTACCCCTTCCAGAAGCAAAAACAAACCATGACTGAGGCAGGCATGGAGTTGGGCGTTAGGGGCAGGCAGAG
GGCCTTTGCTACACTGCTGACAGCTATAGGGAGCCCCAGGTAATGGCATGAGATAGCTGGTGTTAGGGCTATCTCAGGCAATATGGCCAC
ACCTGGGTCTTTATGCATGAAGATAATGTAAAGGTTTTTATTAAAAAATATATATATGTATAAATAAATGATCTAGATATTTTCCTCTTT

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_7974nt
GCTGGCCCGGGAGGGGGCGCGGGGCACGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCC
TTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGG
TGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCTTATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTA
CAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCTGCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCA
AGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGTCCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCC
CCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTTCTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGAT
TCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATAGAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTAT
GAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAACAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCA
TTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAAAGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCA
GCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAATTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGT
ACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAG
TCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCG
TTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGA
GCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAA
GAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAG
GGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAG
TCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCT
AAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGG
AGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCA
AATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCA
AATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGT
GGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGA
AGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATG
TTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGT
AACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCA
TCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAAC
TCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAA
GAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCC
AGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCA
GTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCA
AAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAA
GATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCT
ACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCC
GCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTC
CCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCA
GCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGAT
GCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGC
CACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAA
GGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTG
CCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGT
GCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAG
GAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGT
GACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCC
CAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCT
AAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCT
GCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTA
GCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGT
GATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAG
CAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAAT
AAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAA
GAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTC
ACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACT
ATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGG
AAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTT
TGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCA
AGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAG
GATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACG
CCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTG
GACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCC
TCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGAT
ATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCC
CACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAA
GAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACA
ATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTAT
GGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGT
GGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTT
AAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAG
ACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATT
CATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGT
GAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTC
TCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGC
TACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTG
GGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTG
CGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGC
TCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACC
TCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACA
CCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGC
CAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAA
GCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATC
ATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGC
AGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGAT
TGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGAT
CGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGAC
TCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAA
CTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTTGGGAGCCTGTGAGCCCCAGGCACTTTGCATCACAGTCACATGCCCATT
CACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGGCACTGTTTGCCATTCTCTGGGTTGGCTGTGGCATCTACCCTCCCTCCCTGCTG
CCAGAAGCAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATACTGAACGTAGCATAAGGGCTTCTGGAACCCAGAAGAGGAGACAGTTTA
CCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAAAATGGTCAATAAAGCTCCTTTGGCAGAATCCCCCAAAGAACCAGGGTATTCTT

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_6186nt
GCTGGCCCGGGAGGGGGCGCGGGGCACGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCC
TTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGG
TGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCTTATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTA
CAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCTGCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCA
AGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGTCCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCC
CCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTTCTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGAT
TCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATAGAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTAT
GAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAACAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCA
TTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAAAGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCA
GCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAATTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGT
ACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAG
TCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCG
TTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGA
GCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAA
GAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAG
GGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAG
TCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCT
AAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGG
AGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCA
AATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCA
AATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGT
GGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGA
AGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATG
TTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGT
AACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCA
TCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAAC
TCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAA
GAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCC
AGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCA
GTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCA
AAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAA
GATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCT
ACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCC
GCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTC
CCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCA
GCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGAT
GCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGC
CACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAA
GGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTG
CCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGT
GCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAG
GAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGT
GACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCC
CAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCT
AAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCT
GCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTA
GCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGT
GATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAG
CAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAAT
AAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAA
GAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTC
ACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACT
ATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGG
AAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTT
TGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCA
AGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAG
GATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACG
CCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGGTAGAGAAAAAAGGACAGTGAATTTGAATGGAATCCGTGATACCG
AAGTTGAAAGCAAGTCATTCAGCTAATACAAAGCTGTTTTATGACCCTTGGAACTTTGAAGAGTACAAACATTGGCAATCACGTTGAAAC
AAGTGCAAGGGAGGGCGTGAGGTCTTGCAGGCATCTGTCTTTTTACTGGAGAGATTTAAAGAATTCTCTTGCTGTTTGGATTATTCCTCT
ACAGATTGTCATTTTTAAACCCTTTGTTCTCTCTCATTTGGACTTGCTGAATTCTCTGCTCAGTGATTAACTTAAGATTTGCTCATGTGG
GTTCATGCACAGTAAATTCTGCCTTTATTGACTACCTGATGTGCAGTTTAATCTTTTTCTTTACCTCCATGGTTTTTTAAAAGTTAAATT
AGCTTTCTGAAAGGGTTTTTAATCTCCATTTTTTTAAAGTTGTTTGCTTATACTTCGGGTAACCTTGATATTTGTATTTTAATAGTACAT
AATCTTTATGAAAAATAGTTTGGGAATGTAAATGAATTATTATTTGGCTTGGGGAGATTAGGGCCTACATTGTTTATCGCAATTACTTGT
ATCATTGATACGGGATTTCTTTGTAAAGCATCCTCTACCTCTCAGCTGCTGAAAGCTAGACCTTTGGTATTTTCCATGCTATAATTCTTA
TGGCTGCTGAAATGTGTGGTTTTTATGATTTATTAAATAATCTCTTAGGAGGCATTTCTGGAGAATGTGTGTATATACATGTTTGCGCGT
ACAGGGGAGGGGAGGGTATGATAAATGTGGGAAACTGGAAATATATTGACTTTTATGTTTATAATCTTGGTAGCATTTAGAATGCCCCTA
AGAAATCTCCATTGACAAATGAAATGCTATAGACTTGGTTTTCCAGTTATCCATATTCATTTTGTCTGTCATATGCTTTGTATCATCTCC

>In-frame_NSD1_ENST00000439151_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_5904nt
GCTGGCCCGGGAGGGGGCGCGGGGCACGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCC
TTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGG
TGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCTTATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTA
CAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCTGCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCA
AGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGTCCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCC
CCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTTCTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGAT
TCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATAGAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTAT
GAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAACAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCA
TTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAAAGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCA
GCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAATTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGT
ACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAG
TCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCG
TTGATTAACACACATTCAAAAATGAAAGTTTCCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGA
GCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAA
GAAAAAGGATATAGGCATAAGGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAG
GGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAG
TCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCT
AAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGG
AGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCA
AATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCA
AATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGT
GGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGA
AGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATG
TTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGT
AACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCA
TCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAAC
TCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAA
GAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCC
AGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCA
GTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCA
AAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAA
GATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCT
ACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCC
GCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTC
CCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCA
GCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGAT
GCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGC
CACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAA
GGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTG
CCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGT
GCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAG
GAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGT
GACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCC
CAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCT
AAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCT
GCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTA
GCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGT
GATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAG
CAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAAT
AAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAA
GAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTC
ACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACT
ATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGG
AAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTT
TGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCA
AGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAG
GATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACG
CCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGGTAGAGAAAAAAGGACAGTGAATTTGAATGGAATCCGTGATACCG
AAGTTGAAAGCAAGTCATTCAGCTAATACAAAGCTGTTTTATGACCCTTGGAACTTTGAAGAGTACAAACATTGGCAATCACGTTGAAAC
AAGTGCAAGGGAGGGCGTGAGGTCTTGCAGGCATCTGTCTTTTTACTGGAGAGATTTAAAGAATTCTCTTGCTGTTTGGATTATTCCTCT
ACAGATTGTCATTTTTAAACCCTTTGTTCTCTCTCATTTGGACTTGCTGAATTCTCTGCTCAGTGATTAACTTAAGATTTGCTCATGTGG
GTTCATGCACAGTAAATTCTGCCTTTATTGACTACCTGATGTGCAGTTTAATCTTTTTCTTTACCTCCATGGTTTTTTAAAAGTTAAATT
AGCTTTCTGAAAGGGTTTTTAATCTCCATTTTTTTAAAGTTGTTTGCTTATACTTCGGGTAACCTTGATATTTGTATTTTAATAGTACAT
AATCTTTATGAAAAATAGTTTGGGAATGTAAATGAATTATTATTTGGCTTGGGGAGATTAGGGCCTACATTGTTTATCGCAATTACTTGT
ATCATTGATACGGGATTTCTTTGTAAAGCATCCTCTACCTCTCAGCTGCTGAAAGCTAGACCTTTGGTATTTTCCATGCTATAATTCTTA

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_8234nt
CCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCC
AGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTAC
CTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATC
TCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTT
CCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGT
TTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGA
AAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTT
CAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTT
TGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATC
CAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAA
ACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAG
GAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGG
GTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAG
CAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCT
CAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGT
ATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTA
CTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATT
TTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAG
CTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTA
TAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTC
TAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGG
AACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTC
AGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGC
GGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTT
TGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTG
CATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTG
TTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTA
AAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAG
GTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTT
CTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAG
AGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAA
GGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTG
TGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACT
GCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTT
TGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATA
GTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAA
ATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAA
CAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCA
TTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAAT
ATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCAC
ATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATA
CCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGG
ATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTA
TGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATT
TTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACC
AAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAA
TAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACC
GGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGT
CTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTG
CACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGC
CAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTA
ATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGC
CTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTG
GGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAA
TGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGA
AAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCC
TATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAG
AAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTC
ACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCA
CTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCAT
CAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTG
ACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTC
AGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCT
GCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCA
TGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGG
TGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTC
CACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCAC
TTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAA
AACTCTACAGTGACAGACATTATGATCTCAACCAGCTGCTGGAGCCTCGAAGCATAACAGCAGATCCTTTGGACTACCGCCTAAGCTGGC
ACTTGTGGGAAGTGCTGAGGGCTCTTAACTACACCCATCTCTCAGCGCAGTGTGAAGGTGTGCTACAGGCCAGTTACGCTGGCCAGCTTG
AAAGTGAGGGGCTCTGGGAGTGGGCCATCTTTGTCCTCCTGCACATTGACAACTCAGGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTA
CCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCC
ACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCC
ACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTC
CAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATAC
AGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACA
GTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATA
GAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATG
CCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTTGGGAGCCTGTGAGCCCCAGGCACTTTGCATCACAGTC
ACATGCCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGGCACTGTTTGCCATTCTCTGGGTTGGCTGTGGCATCTACCCTC
CCTCCCTGCTGCCAGAAGCAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATACTGAACGTAGCATAAGGGCTTCTGGAACCCAGAAGAG
GAGACAGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAAAATGGTCAATAAAGCTCCTTTGGCAGAATCCCCCAAAGAACC
AGGGTATTCTTTTTCCATCCCTAGCCATTCTGGATCTTGTGACCCTCCATGCCAACCAGCTTCCCTACTCCTACCCTGGCCCTTTTATAC
TAGGACTCCTTAGGAGGAGTGAGACAGGTGATAATGGATCCTTAACAGATGAACTATCCACAGAAGGAAGAGGGATCCGTCTCTTAAGTA
ATTGGTTAGTTAACACTGAATTTTGGAGGCAAAGGAGGGTTGGCCTGAGTTAGGAAACAAAATGGGATCTTTCTGACACACTTAGGGCAG
AAGTGAATGCCTGTCACGGAGGGATTGATCTTCAGGGCTGTTTTTGTTCCTGCCTTTAGAGTTCCATGAACACCATACCTTTGCTACTAC
TATGTGCAGGAACCCTTGGTCACATGTGACATGTCTGTGGGAAGCTCCCAGAGTTTGGTTTGGTCCCTGGTTTTCAGTCTTGCTGAGACT
CTGTCTGGATTTGCCTGCAGAGTTTGGATAAAAAATGGCAGGTTGGGTAACCCTCCCTGTTCATCCCATGTTAGCTCCAAAGCATTTCCC
ACCCTCCATCTACCCCTTCCAGAAGCAAAAACAAACCATGACTGAGGCAGGCATGGAGTTGGGCGTTAGGGGCAGGCAGAGGGCCTTTGC
TACACTGCTGACAGCTATAGGGAGCCCCAGGTAATGGCATGAGATAGCTGGTGTTAGGGCTATCTCAGGCAATATGGCCACACCTGGGTC
TTTATGCATGAAGATAATGTAAAGGTTTTTATTAAAAAATATATATATGTATAAATAAATGATCTAGATATTTTCCTCTTTTTCTGAAGC

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_8031nt
CCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCC
AGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTAC
CTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATC
TCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTT
CCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGT
TTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGA
AAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTT
CAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTT
TGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATC
CAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAA
ACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAG
GAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGG
GTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAG
CAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCT
CAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGT
ATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTA
CTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATT
TTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAG
CTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTA
TAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTC
TAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGG
AACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTC
AGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGC
GGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTT
TGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTG
CATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTG
TTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTA
AAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAG
GTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTT
CTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAG
AGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAA
GGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTG
TGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACT
GCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTT
TGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATA
GTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAA
ATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAA
CAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCA
TTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAAT
ATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCAC
ATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATA
CCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGG
ATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTA
TGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATT
TTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACC
AAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAA
TAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACC
GGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGT
CTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTG
CACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGC
CAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTA
ATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGC
CTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTG
GGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAA
TGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGA
AAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCC
TATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAG
AAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTC
ACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCA
CTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCAT
CAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTG
ACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTC
AGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCT
GCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCA
TGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGG
TGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTC
CACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCAC
TTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAA
AACTCTACAGTGACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTA
AAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGC
ACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTA
ATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGC
TTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGATAGCACTGTTTTGTGTAGAGTGGATTGCTCAGGTAA
TGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCA
GTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGA
CCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCT
TACCCAGTCCTATCTGCGAGAACTGGCTGTTGGGAGCCTGTGAGCCCCAGGCACTTTGCATCACAGTCACATGCCCATTCACACCACACA
GAGGTTCCCTGCCTTGTTTGGATTGGCACTGTTTGCCATTCTCTGGGTTGGCTGTGGCATCTACCCTCCCTCCCTGCTGCCAGAAGCAGC
ATCCTCCACTTGTTCAGGGCTTTTCTTAATACTGAACGTAGCATAAGGGCTTCTGGAACCCAGAAGAGGAGACAGTTTACCATCCTCAAG
ATCATTCAGTGTTTTTCCTTTAAAAAAATGGTCAATAAAGCTCCTTTGGCAGAATCCCCCAAAGAACCAGGGTATTCTTTTTCCATCCCT
AGCCATTCTGGATCTTGTGACCCTCCATGCCAACCAGCTTCCCTACTCCTACCCTGGCCCTTTTATACTAGGACTCCTTAGGAGGAGTGA
GACAGGTGATAATGGATCCTTAACAGATGAACTATCCACAGAAGGAAGAGGGATCCGTCTCTTAAGTAATTGGTTAGTTAACACTGAATT
TTGGAGGCAAAGGAGGGTTGGCCTGAGTTAGGAAACAAAATGGGATCTTTCTGACACACTTAGGGCAGAAGTGAATGCCTGTCACGGAGG
GATTGATCTTCAGGGCTGTTTTTGTTCCTGCCTTTAGAGTTCCATGAACACCATACCTTTGCTACTACTATGTGCAGGAACCCTTGGTCA
CATGTGACATGTCTGTGGGAAGCTCCCAGAGTTTGGTTTGGTCCCTGGTTTTCAGTCTTGCTGAGACTCTGTCTGGATTTGCCTGCAGAG
TTTGGATAAAAAATGGCAGGTTGGGTAACCCTCCCTGTTCATCCCATGTTAGCTCCAAAGCATTTCCCACCCTCCATCTACCCCTTCCAG
AAGCAAAAACAAACCATGACTGAGGCAGGCATGGAGTTGGGCGTTAGGGGCAGGCAGAGGGCCTTTGCTACACTGCTGACAGCTATAGGG
AGCCCCAGGTAATGGCATGAGATAGCTGGTGTTAGGGCTATCTCAGGCAATATGGCCACACCTGGGTCTTTATGCATGAAGATAATGTAA
AGGTTTTTATTAAAAAATATATATATGTATAAATAAATGATCTAGATATTTTCCTCTTTTTCTGAAGCTACTTTCTTAAAAAATAAATAA

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_7223nt
CCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCC
AGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTAC
CTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATC
TCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTT
CCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGT
TTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGA
AAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTT
CAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTT
TGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATC
CAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAA
ACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAG
GAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGG
GTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAG
CAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCT
CAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGT
ATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTA
CTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATT
TTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAG
CTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTA
TAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTC
TAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGG
AACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTC
AGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGC
GGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTT
TGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTG
CATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTG
TTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTA
AAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAG
GTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTT
CTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAG
AGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAA
GGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTG
TGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACT
GCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTT
TGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATA
GTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAA
ATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAA
CAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCA
TTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAAT
ATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCAC
ATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATA
CCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGG
ATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTA
TGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATT
TTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACC
AAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAA
TAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACC
GGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGT
CTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTG
CACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGC
CAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTTCACTGGGAATTA
ATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGC
CTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTG
GGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAA
TGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGA
AAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCC
TATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAG
AAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTC
ACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAATTAAAACACAGCA
CTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCAT
CAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTG
ACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTC
AGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCT
GCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCA
TGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGG
TGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTC
CACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATGCCTGCTCCCCAC
TTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAA
AACTCTACAGTGACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTA
AAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGC
ACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTA
ATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGC
TTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACA
TCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTG
TAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGC
GCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAG
AACTGGCTGTTGGGAGCCTGTGAGCCCCAGGCACTTTGCATCACAGTCACATGCCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTG
GATTGGCACTGTTTGCCATTCTCTGGGTTGGCTGTGGCATCTACCCTCCCTCCCTGCTGCCAGAAGCAGCATCCTCCACTTGTTCAGGGC
TTTTCTTAATACTGAACGTAGCATAAGGGCTTCTGGAACCCAGAAGAGGAGACAGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTT
TAAAAAAATGGTCAATAAAGCTCCTTTGGCAGAATCCCCCAAAGAACCAGGGTATTCTTTTTCCATCCCTAGCCATTCTGGATCTTGTGA

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_5435nt
CCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCC
AGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTAC
CTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATC
TCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTT
CCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGT
TTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGA
AAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTT
CAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTT
TGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATC
CAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAA
ACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAG
GAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGG
GTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAG
CAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCT
CAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGT
ATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTA
CTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATT
TTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAG
CTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTA
TAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTC
TAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGG
AACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTC
AGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGC
GGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTT
TGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTG
CATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTG
TTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTA
AAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAG
GTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTT
CTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAG
AGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAA
GGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTG
TGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACT
GCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTT
TGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATA
GTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAA
ATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAA
CAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCA
TTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAAT
ATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCAC
ATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATA
CCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGG
ATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTA
TGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATT
TTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACC
AAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAA
TAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACC
GGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGT
CTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTG
CACCTCCACCTCAGGTAGAGAAAAAAGGACAGTGAATTTGAATGGAATCCGTGATACCGAAGTTGAAAGCAAGTCATTCAGCTAATACAA
AGCTGTTTTATGACCCTTGGAACTTTGAAGAGTACAAACATTGGCAATCACGTTGAAACAAGTGCAAGGGAGGGCGTGAGGTCTTGCAGG
CATCTGTCTTTTTACTGGAGAGATTTAAAGAATTCTCTTGCTGTTTGGATTATTCCTCTACAGATTGTCATTTTTAAACCCTTTGTTCTC
TCTCATTTGGACTTGCTGAATTCTCTGCTCAGTGATTAACTTAAGATTTGCTCATGTGGGTTCATGCACAGTAAATTCTGCCTTTATTGA
CTACCTGATGTGCAGTTTAATCTTTTTCTTTACCTCCATGGTTTTTTAAAAGTTAAATTAGCTTTCTGAAAGGGTTTTTAATCTCCATTT
TTTTAAAGTTGTTTGCTTATACTTCGGGTAACCTTGATATTTGTATTTTAATAGTACATAATCTTTATGAAAAATAGTTTGGGAATGTAA
ATGAATTATTATTTGGCTTGGGGAGATTAGGGCCTACATTGTTTATCGCAATTACTTGTATCATTGATACGGGATTTCTTTGTAAAGCAT
CCTCTACCTCTCAGCTGCTGAAAGCTAGACCTTTGGTATTTTCCATGCTATAATTCTTATGGCTGCTGAAATGTGTGGTTTTTATGATTT
ATTAAATAATCTCTTAGGAGGCATTTCTGGAGAATGTGTGTATATACATGTTTGCGCGTACAGGGGAGGGGAGGGTATGATAAATGTGGG
AAACTGGAAATATATTGACTTTTATGTTTATAATCTTGGTAGCATTTAGAATGCCCCTAAGAAATCTCCATTGACAAATGAAATGCTATA
GACTTGGTTTTCCAGTTATCCATATTCATTTTGTCTGTCATATGCTTTGTATCATCTCCTTCTTTCCTAATTTTTTATAACCTTATATAT

>In-frame_NSD1_ENST00000347982_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_5153nt
CCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCC
AGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTAC
CTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAAAAGTCTACGCCACTGAAGTATGAAGTTGGAGATC
TCATCTGGGCAAAATTCAAGAGACGCCCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAAGTTT
CCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAGAGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGT
TTGAAGGCAGACATCAATTCGAAGAGCTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCTCAGA
AAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTT
CAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTT
TGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATC
CAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAA
ACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAG
GAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGG
GTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAG
CAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACACAGCT
CAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAACATGTTATCTATGCAGAAAAATGAAAAGATAAAGT
ATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGTTGTA
CTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATT
TTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAG
CTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTA
TAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTC
TAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGG
AACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTC
AGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGC
GGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTT
TGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTG
CATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTG
TTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTA
AAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAG
GTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTT
CTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAG
AGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAA
GGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTG
TGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTTGAGGAACCACTGACAGAGCAAAATCATGCTGACT
GCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTT
TGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATA
GTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAA
ATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAA
CAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCA
TTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTTCACCATCTGAAT
ATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCAC
ATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACAGTGTGGATGATA
CCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGG
ATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATACTATTCCATCTA
TGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATT
TTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACC
AAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAA
TAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACC
GGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGT
CTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTG
CACCTCCACCTCAGGTAGAGAAAAAAGGACAGTGAATTTGAATGGAATCCGTGATACCGAAGTTGAAAGCAAGTCATTCAGCTAATACAA
AGCTGTTTTATGACCCTTGGAACTTTGAAGAGTACAAACATTGGCAATCACGTTGAAACAAGTGCAAGGGAGGGCGTGAGGTCTTGCAGG
CATCTGTCTTTTTACTGGAGAGATTTAAAGAATTCTCTTGCTGTTTGGATTATTCCTCTACAGATTGTCATTTTTAAACCCTTTGTTCTC
TCTCATTTGGACTTGCTGAATTCTCTGCTCAGTGATTAACTTAAGATTTGCTCATGTGGGTTCATGCACAGTAAATTCTGCCTTTATTGA
CTACCTGATGTGCAGTTTAATCTTTTTCTTTACCTCCATGGTTTTTTAAAAGTTAAATTAGCTTTCTGAAAGGGTTTTTAATCTCCATTT
TTTTAAAGTTGTTTGCTTATACTTCGGGTAACCTTGATATTTGTATTTTAATAGTACATAATCTTTATGAAAAATAGTTTGGGAATGTAA
ATGAATTATTATTTGGCTTGGGGAGATTAGGGCCTACATTGTTTATCGCAATTACTTGTATCATTGATACGGGATTTCTTTGTAAAGCAT
CCTCTACCTCTCAGCTGCTGAAAGCTAGACCTTTGGTATTTTCCATGCTATAATTCTTATGGCTGCTGAAATGTGTGGTTTTTATGATTT

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000324932_chr11_3756554_-_8631nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG
ACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTG
GAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTG
TCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGAT
GTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCA
GCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCT
GTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTG
TTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTC
ACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCT
AATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTA
GCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTA
TATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCT
GTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACA
CTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGA
GCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTA
TTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAG
TTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAG
AGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGG
AAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAG
AATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCA
CAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGACATTATGATCTCAACCAGCTGCTGGAGCCTCGAAGC
ATAACAGCAGATCCTTTGGACTACCGCCTAAGCTGGCACTTGTGGGAAGTGCTGAGGGCTCTTAACTACACCCATCTCTCAGCGCAGTGT
GAAGGTGTGCTACAGGCCAGTTACGCTGGCCAGCTTGAAAGTGAGGGGCTCTGGGAGTGGGCCATCTTTGTCCTCCTGCACATTGACAAC
TCAGGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTC
CTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCC
CTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTAT
GACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTG
GACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACT
TCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTG
CTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCT
CCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTT
GGGAGCCTGTGAGCCCCAGGCACTTTGCATCACAGTCACATGCCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGGCACTG
TTTGCCATTCTCTGGGTTGGCTGTGGCATCTACCCTCCCTCCCTGCTGCCAGAAGCAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATA
CTGAACGTAGCATAAGGGCTTCTGGAACCCAGAAGAGGAGACAGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAAAATGG
TCAATAAAGCTCCTTTGGCAGAATCCCCCAAAGAACCAGGGTATTCTTTTTCCATCCCTAGCCATTCTGGATCTTGTGACCCTCCATGCC
AACCAGCTTCCCTACTCCTACCCTGGCCCTTTTATACTAGGACTCCTTAGGAGGAGTGAGACAGGTGATAATGGATCCTTAACAGATGAA
CTATCCACAGAAGGAAGAGGGATCCGTCTCTTAAGTAATTGGTTAGTTAACACTGAATTTTGGAGGCAAAGGAGGGTTGGCCTGAGTTAG
GAAACAAAATGGGATCTTTCTGACACACTTAGGGCAGAAGTGAATGCCTGTCACGGAGGGATTGATCTTCAGGGCTGTTTTTGTTCCTGC
CTTTAGAGTTCCATGAACACCATACCTTTGCTACTACTATGTGCAGGAACCCTTGGTCACATGTGACATGTCTGTGGGAAGCTCCCAGAG
TTTGGTTTGGTCCCTGGTTTTCAGTCTTGCTGAGACTCTGTCTGGATTTGCCTGCAGAGTTTGGATAAAAAATGGCAGGTTGGGTAACCC
TCCCTGTTCATCCCATGTTAGCTCCAAAGCATTTCCCACCCTCCATCTACCCCTTCCAGAAGCAAAAACAAACCATGACTGAGGCAGGCA
TGGAGTTGGGCGTTAGGGGCAGGCAGAGGGCCTTTGCTACACTGCTGACAGCTATAGGGAGCCCCAGGTAATGGCATGAGATAGCTGGTG
TTAGGGCTATCTCAGGCAATATGGCCACACCTGGGTCTTTATGCATGAAGATAATGTAAAGGTTTTTATTAAAAAATATATATATGTATA

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000359171_chr11_3756554_-_8428nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG
ACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTG
GAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTG
TCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGAT
GTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCA
GCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCT
GTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTG
TTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTC
ACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCT
AATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTA
GCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTA
TATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCT
GTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACA
CTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGA
GCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTA
TTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAG
TTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAG
AGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGG
AAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAG
AATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCA
CAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGG
CACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAG
GCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAG
CTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAG
CGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAG
ATAGCACTGTTTTGTGTAGAGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGC
AGATTCAGTGTTACAGTGCTAAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGC
ATCATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCA
TGCCTGAGGACTATGCCATGGACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTTGGGAGCCTGTGAGCCCCAGGCA
CTTTGCATCACAGTCACATGCCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGGCACTGTTTGCCATTCTCTGGGTTGGCT
GTGGCATCTACCCTCCCTCCCTGCTGCCAGAAGCAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATACTGAACGTAGCATAAGGGCTTC
TGGAACCCAGAAGAGGAGACAGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAAAATGGTCAATAAAGCTCCTTTGGCAGA
ATCCCCCAAAGAACCAGGGTATTCTTTTTCCATCCCTAGCCATTCTGGATCTTGTGACCCTCCATGCCAACCAGCTTCCCTACTCCTACC
CTGGCCCTTTTATACTAGGACTCCTTAGGAGGAGTGAGACAGGTGATAATGGATCCTTAACAGATGAACTATCCACAGAAGGAAGAGGGA
TCCGTCTCTTAAGTAATTGGTTAGTTAACACTGAATTTTGGAGGCAAAGGAGGGTTGGCCTGAGTTAGGAAACAAAATGGGATCTTTCTG
ACACACTTAGGGCAGAAGTGAATGCCTGTCACGGAGGGATTGATCTTCAGGGCTGTTTTTGTTCCTGCCTTTAGAGTTCCATGAACACCA
TACCTTTGCTACTACTATGTGCAGGAACCCTTGGTCACATGTGACATGTCTGTGGGAAGCTCCCAGAGTTTGGTTTGGTCCCTGGTTTTC
AGTCTTGCTGAGACTCTGTCTGGATTTGCCTGCAGAGTTTGGATAAAAAATGGCAGGTTGGGTAACCCTCCCTGTTCATCCCATGTTAGC
TCCAAAGCATTTCCCACCCTCCATCTACCCCTTCCAGAAGCAAAAACAAACCATGACTGAGGCAGGCATGGAGTTGGGCGTTAGGGGCAG
GCAGAGGGCCTTTGCTACACTGCTGACAGCTATAGGGAGCCCCAGGTAATGGCATGAGATAGCTGGTGTTAGGGCTATCTCAGGCAATAT
GGCCACACCTGGGTCTTTATGCATGAAGATAATGTAAAGGTTTTTATTAAAAAATATATATATGTATAAATAAATGATCTAGATATTTTC

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000355260_chr11_3756554_-_7620nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG
ACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGGTTGTG
GAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGTTAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTG
TCTGCCTCAACACATATTGCATCTTCACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAGAAGAT
GTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTTCTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCA
GCATCCCACTCGTCGAAAACTCGTTCACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTGTCTCT
GTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACATCCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTG
TTCACAATGCCCAGCCCAGCCCCTGAGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGTCTGTC
ACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCATTTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCT
AATAGTGGAGAACAGCTGAATGGCTCTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATCCAGTA
GCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTTTGAGACAAAGAAAGCCAGATGAAGACATGAAATTA
TATCAGACACCTCTGGAGCTCAAATTAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAGTTGCT
GTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAGCACAAATTGTGAAGCACTGGAGCCTGACATGGACA
CTATGTGAAGCCCTATGGGGCCACCTGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAAGAAGA
GCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCTCCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTA
TTCAGCTACCTCACAGGCAAAAGGATCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTATCTCAG
TTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGCATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAG
AGACTGCGCATCTTTGCTCTGTTGGCTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGGATTGG
AAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTTCTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAG
AATACCTCTGACAGTGACAGATATGCCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAAACTCA
CAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGCATACGTGAGAAGGCTGTTCGAGAGCTGCTTACCCGG
CACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGACTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAG
GCCAAAGCTGTGCGAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACTGGAACCGCTGCCACAAG
CTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGAACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAG
CGCAGCAGCCTAATTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGCTCCGCCATATACAGCAG
GTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAGTGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCT
AAAGATCGCCTGGCTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATCATCCTCCTGATAGAACC
TCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCTTGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATG
GACGAACTGCGCAGCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTTGGGAGCCTGTGAGCCCCAGGCACTTTGCATCACAGTCACATG
CCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGGCACTGTTTGCCATTCTCTGGGTTGGCTGTGGCATCTACCCTCCCTCC
CTGCTGCCAGAAGCAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATACTGAACGTAGCATAAGGGCTTCTGGAACCCAGAAGAGGAGAC
AGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAAAATGGTCAATAAAGCTCCTTTGGCAGAATCCCCCAAAGAACCAGGGT

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000397004_chr11_3756554_-_5832nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG
ACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGGTAGAGAAAAAAGGACAGTGAATTTGAATGGAATCCGTG
ATACCGAAGTTGAAAGCAAGTCATTCAGCTAATACAAAGCTGTTTTATGACCCTTGGAACTTTGAAGAGTACAAACATTGGCAATCACGT
TGAAACAAGTGCAAGGGAGGGCGTGAGGTCTTGCAGGCATCTGTCTTTTTACTGGAGAGATTTAAAGAATTCTCTTGCTGTTTGGATTAT
TCCTCTACAGATTGTCATTTTTAAACCCTTTGTTCTCTCTCATTTGGACTTGCTGAATTCTCTGCTCAGTGATTAACTTAAGATTTGCTC
ATGTGGGTTCATGCACAGTAAATTCTGCCTTTATTGACTACCTGATGTGCAGTTTAATCTTTTTCTTTACCTCCATGGTTTTTTAAAAGT
TAAATTAGCTTTCTGAAAGGGTTTTTAATCTCCATTTTTTTAAAGTTGTTTGCTTATACTTCGGGTAACCTTGATATTTGTATTTTAATA
GTACATAATCTTTATGAAAAATAGTTTGGGAATGTAAATGAATTATTATTTGGCTTGGGGAGATTAGGGCCTACATTGTTTATCGCAATT
ACTTGTATCATTGATACGGGATTTCTTTGTAAAGCATCCTCTACCTCTCAGCTGCTGAAAGCTAGACCTTTGGTATTTTCCATGCTATAA
TTCTTATGGCTGCTGAAATGTGTGGTTTTTATGATTTATTAAATAATCTCTTAGGAGGCATTTCTGGAGAATGTGTGTATATACATGTTT
GCGCGTACAGGGGAGGGGAGGGTATGATAAATGTGGGAAACTGGAAATATATTGACTTTTATGTTTATAATCTTGGTAGCATTTAGAATG
CCCCTAAGAAATCTCCATTGACAAATGAAATGCTATAGACTTGGTTTTCCAGTTATCCATATTCATTTTGTCTGTCATATGCTTTGTATC

>In-frame_NSD1_ENST00000361032_chr5_176639196_+_NUP98_ENST00000397007_chr11_3756554_-_5550nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGTTCCTCAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTT
CCCAAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGATATGCCATTTGAAGACTGCACAAATGAT
CCTGAGTCAGAACATGACCTGTTGCTTAATGGCTGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCT
TGCGCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGCCACATACAATTTGAAGCACATAAAGAT
GAACGGAGGGGAAAGATTCCAGAGAACCTTGGCCTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGG
ATAGCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGAAAAAACACTGCAAAGAAAGAATTTGAG
ACTTCAAATGGTGACTCTTTATTGGGCTTGCCTGAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTG
GTGTGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGATTCCATTAGTATCTGTACCACTTCTGAT
GATGGAAGCAGTGACCTGGATCCCATAGAACACAGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAG
AACATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACTAGGGTAAAAGCAAAACAGAAGCCTCTC
ATTAGTAACTCACATACAGACCACTTAATGGGTTGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTG
AAGGCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAATTCAACCTGTCATCAAGCATATCCAGT
GAGAACTCGTTAATAAAGGGTGGGGCAGCAAATCAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAA
CACAAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGCTGCTCTTCTGATACCAAAGGCTCTCCT
TTGGCCAGCATTTCTAAAAGTGGGAAAGTGGATGGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAA
ACAGCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAGGATGTCAGTGACTCTGGAACATCAAAG
CCATCAAAACCATTACTTTTCTCTTCTGCTTCTAGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATG
TTGAAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTCTCTTACCGGAGTCCTGGTCGTGGGGAC
TGTTCTACTAATAGTCCTGTAGGAGTCTCTAAGGTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAG
AACTCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCCCTACCTGGCTTACTGTCCGACAAGAGA
GACCTCCCTGCTTCTGGTAAAAGTCGTTCAGACTGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCT
TTTTCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGAAAACTGAATCAGCTTCCAAGTGTGACT
CTTGATGCTGTACTGCAGGGAGACCGAGAACGTGGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATA
ATGGGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTTAAGCAATCTGATCCTGGTAAAATTTCT
GAAAAAGGACTCTCTTTTGAAAACGGAAAAGGCCCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAA
GTGGTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATGAACAGATTTAAAGAGAAAGAAAACTCT
GAGTGTGCCTTTAGGGTCTTACTTCCTAGTGACCCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATA
CTTGAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTAAATGTTTGTGATAAATCCAGTGCCAGC
ATTGGTGACATGGAAAAGGAGCCAGGAATTCCCAGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTTTGACAGATCCAAATGCTTCT
GCTGCCCAGCAGGCTGTTCTCCAGCAGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGATGTCA
GACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGGCTCTTACTACACCTACTCATTATAAACTGACACCC
CGCCCTGCCACTAGAGTCCGGCCAAAGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATGAACCA
TCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGAAGAACCTTAATAATAGCAATCTCTTTTCTCCTGTT
AATCGTGATTCAGAAAATCTAGCTTCACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATGAGAAT
CACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTATTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCT
GGAAATAAACACAGCAACAGCAACAGTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAGGAAGC
AGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAGAAAATAATTCTTACCATATGCACCCAGCAGGTATT
ATTCTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCTCTGAT
TTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAATTTGGATGATATTGTGCATATC
CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGAT
GGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCA
GTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGC
CTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGAAGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAG
ACTACGCCCTTGCAGATGGCTCTTAATGGCAAACCTGCACCTCCACCTCAGGTAGAGAAAAAAGGACAGTGAATTTGAATGGAATCCGTG
ATACCGAAGTTGAAAGCAAGTCATTCAGCTAATACAAAGCTGTTTTATGACCCTTGGAACTTTGAAGAGTACAAACATTGGCAATCACGT
TGAAACAAGTGCAAGGGAGGGCGTGAGGTCTTGCAGGCATCTGTCTTTTTACTGGAGAGATTTAAAGAATTCTCTTGCTGTTTGGATTAT
TCCTCTACAGATTGTCATTTTTAAACCCTTTGTTCTCTCTCATTTGGACTTGCTGAATTCTCTGCTCAGTGATTAACTTAAGATTTGCTC
ATGTGGGTTCATGCACAGTAAATTCTGCCTTTATTGACTACCTGATGTGCAGTTTAATCTTTTTCTTTACCTCCATGGTTTTTTAAAAGT
TAAATTAGCTTTCTGAAAGGGTTTTTAATCTCCATTTTTTTAAAGTTGTTTGCTTATACTTCGGGTAACCTTGATATTTGTATTTTAATA
GTACATAATCTTTATGAAAAATAGTTTGGGAATGTAAATGAATTATTATTTGGCTTGGGGAGATTAGGGCCTACATTGTTTATCGCAATT
ACTTGTATCATTGATACGGGATTTCTTTGTAAAGCATCCTCTACCTCTCAGCTGCTGAAAGCTAGACCTTTGGTATTTTCCATGCTATAA


Top

FusionGenePPI for NSD1_NUP98


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NSD1ZNF496, AR, RELA, AFF1, SIRT7, HIST4H4, TNFRSF21, RARA, RXRA, ESR1, PPARG, VDR, THRB, RORA, RORB, HNF4G, NR2F6, ESRRA, NR5A2, NR6A1, NR2F1, NR2F2, NR2E1, HIST3H3, HIST1H1B, ATRX, SNORD3A, HIST1H1D, HIST1H1C, GAR1, HIST1H3A, HIST1H4A, POLR2A, ZFY, ZBTB48, ZNF692, MECP2, TRIM25NUP98MOB1A, PARP11, QRICH2, TPR, NUP88, CREBBP, EP300, NUP133, KPNB1, RAE1, TNPO2, NXF1, TNPO1, USP7, NPM1, PTTG1, APC, HDAC1, SIRT7, NUP107, CTNNB1, RAPGEF3, NUMA1, ECT2, CSNK2A1, HNRNPUL1, LMNA, HDAC8, HDAC11, FBXO6, ARFGEF2, CDC73, PAF1, CDC37, CUL7, OBSL1, EED, MAPK8, COMTD1, SEC13, PNKD, NUP43, CLEC11A, RNF166, UNK, NUP54, NUP85, SEH1L, XPO5, KRAS, IFI16, NUP160, NUP35, B9D2, UBE2I, NUPL1, NUP153, PIM2, NUDT21, NCBP2, CHMP4B, GTF2H5, FOXI2, FOXL1, FOXQ1, FAF1, C11orf30, DUSP13, SPAST, FAM136A, UXS1, CD70, VASN, TRIM25, G3BP1, CDC27, ANAPC4, ANAPC10, MAD2L1, CDC20, FZR1, PIN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NSD1_NUP98


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NSD1_NUP98


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNSD1C0175695Sotos' syndrome14CTD_human;ORPHANET;UNIPROT
HgeneNSD1C0004352Autistic Disorder1CTD_human
HgeneNSD1C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneNSD1C0265210Weaver syndrome1CTD_human;ORPHANET
HgeneNSD1C3714756Intellectual Disability1CTD_human
TgeneNUP98C0023467Leukemia, Myelocytic, Acute1CTD_human