FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24907

FusionGeneSummary for NSD1_NCKIPSD

check button Fusion gene summary
Fusion gene informationFusion gene name: NSD1_NCKIPSD
Fusion gene ID: 24907
HgeneTgene
Gene symbol

NSD1

NCKIPSD

Gene ID

64324

51517

Gene namenuclear receptor binding SET domain protein 1NCK interacting protein with SH3 domain
SynonymsARA267|KMT3B|SOTOS|SOTOS1|STOAF3P21|DIP|DIP1|ORF1|SPIN90|VIP54|WASLBP|WISH
Cytomap

5q35.3

3p21.31

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specificH3-K36-HMTaseH4-K20-HMTaseNR-binding SET domain-containing proteinandrogen receptor coactivator 267 kDa proteinandrogen receptor-associated coregulator 267androgen receptor-asNCK-interacting protein with SH3 domain54 kDa VacA-interacting protein54 kDa vimentin-interacting protein90 kDa SH3 protein interacting with NckSH3 adapter protein SPIN90SH3 protein interacting with Nck, 90 kDaWASP-interacting SH3-domain proteindia
Modification date2018051920180522
UniProtAcc

Q96L73

Q9NZQ3

Ensembl transtripts involved in fusion geneENST00000354179, ENST00000439151, 
ENST00000347982, ENST00000361032, 
ENST00000511258, 
ENST00000341520, 
ENST00000416649, ENST00000294129, 
Fusion gene scores* DoF score17 X 10 X 13=22103 X 3 X 2=18
# samples 203
** MAII scorelog2(20/2210*10)=-3.46597446450407
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: NSD1 [Title/Abstract] AND NCKIPSD [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNSD1

GO:0045893

positive regulation of transcription, DNA-templated

11509567


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-29-1784-01ANSD1chr5

176563031

+NCKIPSDchr3

48717662

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000354179ENST00000341520NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000354179ENST00000416649NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000354179ENST00000294129NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000439151ENST00000341520NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000439151ENST00000416649NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000439151ENST00000294129NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000347982ENST00000341520NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000347982ENST00000416649NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000347982ENST00000294129NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000361032ENST00000341520NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000361032ENST00000416649NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000361032ENST00000294129NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000511258ENST00000341520NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000511258ENST00000416649NSD1chr5

176563031

+NCKIPSDchr3

48717662

-
In-frameENST00000511258ENST00000294129NSD1chr5

176563031

+NCKIPSDchr3

48717662

-

Top

FusionProtFeatures for NSD1_NCKIPSD


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NSD1

Q96L73

NCKIPSD

Q9NZQ3

Histone methyltransferase. Preferentially methylates'Lys-36' of histone H3 and 'Lys-20' of histone H4 (in vitro).Transcriptional intermediary factor capable of both negatively orpositively influencing transcription, depending on the cellularcontext. {ECO:0000269|PubMed:21196496}. Has an important role in stress fiber formation inducedby active diaphanous protein homolog 1 (DRF1). Induces microspikeformation, in vivo (By similarity). In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42 (Bysimilarity). May play an important role in the maintenance ofsarcomeres and/or in the assembly of myofibrils into sarcomeres.Implicated in regulation of actin polymerization and celladhesion. Plays a role in angiogenesis. {ECO:0000250,ECO:0000269|PubMed:22419821}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000294129-413442_487364723Compositional biasNote=Leu-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000294129-413534_601364723Compositional biasNote=Leu-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000341520-413442_487364723Compositional biasNote=Leu-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000341520-413534_601364723Compositional biasNote=Leu-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000416649-413442_487357716Compositional biasNote=Leu-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000416649-413534_601357716Compositional biasNote=Leu-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3242207_2421402428Compositional biasNote=Pro-rich
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3242207_2421402428Compositional biasNote=Pro-rich
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1202207_24213092594Compositional biasNote=Pro-rich
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2232207_24213092697Compositional biasNote=Pro-rich
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3241756_1818402428DomainPWWP 2
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3241890_1940402428DomainAWS
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3241942_2059402428DomainSET
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3242066_2082402428DomainPost-SET
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+324323_388402428DomainPWWP 1
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3241756_1818402428DomainPWWP 2
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3241890_1940402428DomainAWS
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3241942_2059402428DomainSET
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3242066_2082402428DomainPost-SET
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+324323_388402428DomainPWWP 1
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1201756_18183092594DomainPWWP 2
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1201890_19403092594DomainAWS
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1201942_20593092594DomainSET
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1202066_20823092594DomainPost-SET
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+120323_3883092594DomainPWWP 1
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2231756_18183092697DomainPWWP 2
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2231890_19403092697DomainAWS
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2231942_20593092697DomainSET
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2232066_20823092697DomainPost-SET
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+223323_3883092697DomainPWWP 1
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3241952_1954402428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3241994_1997402428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3242020_2021402428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3242060_2066402428RegionNote=Inhibits enzyme activity in the absence of bound histone
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3241952_1954402428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3241994_1997402428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3242020_2021402428RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3242060_2066402428RegionNote=Inhibits enzyme activity in the absence of bound histone
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1201952_19543092594RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1201994_19973092594RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1202020_20213092594RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1202060_20663092594RegionNote=Inhibits enzyme activity in the absence of bound histone
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2231952_19543092697RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2231994_19973092697RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2232020_20213092697RegionNote=S-adenosyl-L-methionine binding
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2232060_20663092697RegionNote=Inhibits enzyme activity in the absence of bound histone
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3241543_1589402428Zinc fingerPHD-type 1
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3241590_1646402428Zinc fingerPHD-type 2
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3241707_1751402428Zinc fingerPHD-type 3
HgeneNSD1chr5:176563031chr3:48717662ENST00000347982+3242118_2165402428Zinc fingerPHD-type 4%3B atypical
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3241543_1589402428Zinc fingerPHD-type 1
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3241590_1646402428Zinc fingerPHD-type 2
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3241707_1751402428Zinc fingerPHD-type 3
HgeneNSD1chr5:176563031chr3:48717662ENST00000354179+3242118_2165402428Zinc fingerPHD-type 4%3B atypical
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1201543_15893092594Zinc fingerPHD-type 1
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1201590_16463092594Zinc fingerPHD-type 2
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1201707_17513092594Zinc fingerPHD-type 3
HgeneNSD1chr5:176563031chr3:48717662ENST00000361032+1202118_21653092594Zinc fingerPHD-type 4%3B atypical
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2231543_15893092697Zinc fingerPHD-type 1
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2231590_16463092697Zinc fingerPHD-type 2
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2231707_17513092697Zinc fingerPHD-type 3
HgeneNSD1chr5:176563031chr3:48717662ENST00000439151+2232118_21653092697Zinc fingerPHD-type 4%3B atypical
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000294129-413171_275364723Compositional biasNote=Pro-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000294129-413197_240364723Compositional biasNote=Ser/Thr-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000341520-413171_275364723Compositional biasNote=Pro-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000341520-413197_240364723Compositional biasNote=Ser/Thr-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000416649-413171_275357716Compositional biasNote=Pro-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000416649-413197_240357716Compositional biasNote=Ser/Thr-rich
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000294129-4131_58364723DomainSH3
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000341520-4131_58364723DomainSH3
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000416649-4131_58357716DomainSH3
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000294129-413175_192364723MotifNuclear localization signal
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000341520-413175_192364723MotifNuclear localization signal
TgeneNCKIPSDchr5:176563031chr3:48717662ENST00000416649-413175_192357716MotifNuclear localization signal


Top

FusionGeneSequence for NSD1_NCKIPSD


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NSD1_ENST00000354179_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_399aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYL
EELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYS
ALILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLL
NRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKGPFGAGQRPWPGVPRLLEPGSTPSREPHP

>In-frame_NSD1_ENST00000354179_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_399aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYL
EELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYS
ALILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLL
NRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQ

>In-frame_NSD1_ENST00000354179_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_399aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYL
EELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYS
ALILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLL
NRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQ

>In-frame_NSD1_ENST00000439151_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_668aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNATGQDSPSCYIPLRRLQDLASMINVETLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNTETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYLE
ELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSA
LILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLN
RGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKGPFGAGQRPWPGVPRLLEPGSTPSREPHPV

>In-frame_NSD1_ENST00000439151_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_668aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNATGQDSPSCYIPLRRLQDLASMINVETLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNTETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYLE
ELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSA
LILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLN
RGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQA

>In-frame_NSD1_ENST00000439151_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_668aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNATGQDSPSCYIPLRRLQDLASMINVETLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNTETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYLE
ELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSA
LILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLN
RGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQA

>In-frame_NSD1_ENST00000347982_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_399aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYL
EELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYS
ALILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLL
NRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKGPFGAGQRPWPGVPRLLEPGSTPSREPHP

>In-frame_NSD1_ENST00000347982_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_399aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYL
EELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYS
ALILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLL
NRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQ

>In-frame_NSD1_ENST00000347982_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_399aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYL
EELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYS
ALILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLL
NRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQ

>In-frame_NSD1_ENST00000361032_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_668aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNATGQDSPSCYIPLRRLQDLASMINVETLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNTETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYLE
ELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSA
LILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLN
RGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKGPFGAGQRPWPGVPRLLEPGSTPSREPHPV

>In-frame_NSD1_ENST00000361032_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_668aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNATGQDSPSCYIPLRRLQDLASMINVETLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNTETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYLE
ELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSA
LILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLN
RGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQA

>In-frame_NSD1_ENST00000361032_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_668aa
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNATGQDSPSCYIPLRRLQDLASMINVETLNGS
ADGSESFQDPEKSDSRAQTPIVCTSLSPGGPTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNTETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQRNEVDGSNEKAALLPAPFSLGDTNITIEEQ
LNSINLSFQDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYLE
ELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSA
LILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLN
RGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQA

>In-frame_NSD1_ENST00000511258_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_399aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYL
EELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYS
ALILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLL
NRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKGPFGAGQRPWPGVPRLLEPGSTPSREPHP

>In-frame_NSD1_ENST00000511258_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_399aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYL
EELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYS
ALILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLL
NRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQ

>In-frame_NSD1_ENST00000511258_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_399aa
MPLKTRTALSDDPDSSTSTLGNMLELPGTSSSSTSQELPFDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALTEDEGVIRCYL
EELLHILTDADPEVCKKMCKRNEFESVLALVATYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYS
ALILAMVFSMGEAVPTAHTEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLL
NRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NSD1_ENST00000354179_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_1197nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTG
ATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTA
GAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTG
GTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATC
ATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCT
GCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTA
CTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCAC
CTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTG
AACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGC
CCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGAC
AAGGGACCGTTCGGGGCGGGCCAGAGGCCTTGGCCAGGAGTTCCTCGCCTGTTAGAACCAGGATCCACCCCATCGCGGGAGCCGCACCCT
GTGGAGCGTTCTGGGGTCCCGGCCCTGACCTCTTCCTGGGCTTCGGGATGCCCGCGTCCTCTGCACCCGGCGCTGCAGCTCGTTATCGAT

>In-frame_NSD1_ENST00000354179_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_1197nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTG
ATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTA
GAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTG
GTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATC
ATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCT
GCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTA
CTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCAC
CTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTG
AACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGC
CCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGAC
AAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAG
GCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTC

>In-frame_NSD1_ENST00000354179_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_1197nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTG
ATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTA
GAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTG
GTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATC
ATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCT
GCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTA
CTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCAC
CTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTG
AACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGC
CCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGAC
AAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAG
GCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTC

>In-frame_NSD1_ENST00000439151_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_2004nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATC
TTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAG
GAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTG
GCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATC
TCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCC
CTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTG
AACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTG
CCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAAC
AGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCG
GCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAG
GGACCGTTCGGGGCGGGCCAGAGGCCTTGGCCAGGAGTTCCTCGCCTGTTAGAACCAGGATCCACCCCATCGCGGGAGCCGCACCCTGTG
GAGCGTTCTGGGGTCCCGGCCCTGACCTCTTCCTGGGCTTCGGGATGCCCGCGTCCTCTGCACCCGGCGCTGCAGCTCGTTATCGATTCC

>In-frame_NSD1_ENST00000439151_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_2004nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATC
TTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAG
GAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTG
GCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATC
TCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCC
CTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTG
AACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTG
CCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAAC
AGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCG
GCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAG
CTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCC
ATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTG

>In-frame_NSD1_ENST00000439151_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_2004nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATC
TTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAG
GAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTG
GCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATC
TCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCC
CTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTG
AACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTG
CCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAAC
AGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCG
GCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAG
CTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCC
ATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTG

>In-frame_NSD1_ENST00000347982_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_1197nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTG
ATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTA
GAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTG
GTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATC
ATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCT
GCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTA
CTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCAC
CTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTG
AACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGC
CCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGAC
AAGGGACCGTTCGGGGCGGGCCAGAGGCCTTGGCCAGGAGTTCCTCGCCTGTTAGAACCAGGATCCACCCCATCGCGGGAGCCGCACCCT
GTGGAGCGTTCTGGGGTCCCGGCCCTGACCTCTTCCTGGGCTTCGGGATGCCCGCGTCCTCTGCACCCGGCGCTGCAGCTCGTTATCGAT

>In-frame_NSD1_ENST00000347982_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_1197nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTG
ATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTA
GAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTG
GTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATC
ATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCT
GCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTA
CTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCAC
CTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTG
AACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGC
CCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGAC
AAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAG
GCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTC

>In-frame_NSD1_ENST00000347982_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_1197nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTG
ATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTA
GAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTG
GTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATC
ATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCT
GCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTA
CTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCAC
CTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTG
AACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGC
CCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGAC
AAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAG
GCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTC

>In-frame_NSD1_ENST00000361032_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_2004nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATC
TTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAG
GAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTG
GCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATC
TCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCC
CTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTG
AACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTG
CCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAAC
AGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCG
GCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAG
GGACCGTTCGGGGCGGGCCAGAGGCCTTGGCCAGGAGTTCCTCGCCTGTTAGAACCAGGATCCACCCCATCGCGGGAGCCGCACCCTGTG
GAGCGTTCTGGGGTCCCGGCCCTGACCTCTTCCTGGGCTTCGGGATGCCCGCGTCCTCTGCACCCGGCGCTGCAGCTCGTTATCGATTCC

>In-frame_NSD1_ENST00000361032_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_2004nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATC
TTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAG
GAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTG
GCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATC
TCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCC
CTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTG
AACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTG
CCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAAC
AGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCG
GCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAG
CTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCC
ATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTG

>In-frame_NSD1_ENST00000361032_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_2004nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATC
TTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAG
GAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTG
GCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATC
TCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCC
CTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTG
AACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTG
CCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAAC
AGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCG
GCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAG
CTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCC
ATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTG

>In-frame_NSD1_ENST00000511258_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_1197nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTG
ATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTA
GAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTG
GTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATC
ATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCT
GCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTA
CTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCAC
CTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTG
AACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGC
CCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGAC
AAGGGACCGTTCGGGGCGGGCCAGAGGCCTTGGCCAGGAGTTCCTCGCCTGTTAGAACCAGGATCCACCCCATCGCGGGAGCCGCACCCT
GTGGAGCGTTCTGGGGTCCCGGCCCTGACCTCTTCCTGGGCTTCGGGATGCCCGCGTCCTCTGCACCCGGCGCTGCAGCTCGTTATCGAT

>In-frame_NSD1_ENST00000511258_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_1197nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTG
ATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTA
GAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTG
GTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATC
ATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCT
GCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTA
CTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCAC
CTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTG
AACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGC
CCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGAC
AAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAG
GCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTC

>In-frame_NSD1_ENST00000511258_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_1197nt
ATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCA
TCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTG
ATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTA
GAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTG
GTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATC
ATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCT
GCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTA
CTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCAC
CTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTG
AACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGC
CCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGAC
AAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAG
GCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NSD1_ENST00000354179_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_1357nt
GGCCGGGTAGGGGGTTCGCCTGCGGCCGCGTCTGCTCGGGGCCTGAGGCCTCGAAGACCCCAGCCCAAGCCCCCAGGTTGATGCCGGCCC
AGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGAC
AGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGA
ATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATCTTTGCAGACCTGGCTCG
CCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAGGAGCTGCTGCATATTCT
GACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTGGCCTATTACCAAATGGA
ACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATCTCCACGCTTGTGTCATC
CGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCCCTCATCCTGGCCATGGT
CTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTGAACATCGTCGAGGATGG
GCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTGCCAGCTGCTGACCAGAA
TGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAACAGAGGGGATGACCCTGT
GCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCGGCCACAGCTGCCATCTT
CTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAGGGACCGTTCGGGGCGGG
CCAGAGGCCTTGGCCAGGAGTTCCTCGCCTGTTAGAACCAGGATCCACCCCATCGCGGGAGCCGCACCCTGTGGAGCGTTCTGGGGTCCC
GGCCCTGACCTCTTCCTGGGCTTCGGGATGCCCGCGTCCTCTGCACCCGGCGCTGCAGCTCGTTATCGATTCCGCCTTTGGAGGCCGGTC

>In-frame_NSD1_ENST00000354179_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_2057nt
GGCCGGGTAGGGGGTTCGCCTGCGGCCGCGTCTGCTCGGGGCCTGAGGCCTCGAAGACCCCAGCCCAAGCCCCCAGGTTGATGCCGGCCC
AGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGAC
AGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGA
ATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATCTTTGCAGACCTGGCTCG
CCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAGGAGCTGCTGCATATTCT
GACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTGGCCTATTACCAAATGGA
ACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATCTCCACGCTTGTGTCATC
CGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCCCTCATCCTGGCCATGGT
CTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTGAACATCGTCGAGGATGG
GCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTGCCAGCTGCTGACCAGAA
TGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAACAGAGGGGATGACCCTGT
GCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCGGCCACAGCTGCCATCTT
CTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAGCTGCGCATGGAGTACCT
CTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCCATACTGCGACGCATCCT
GAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTGGTGCTGGGGGAGGCTCC
CAGCTAGCACCTTGCTGTCCTCCCTTCCCTGCAGCTCCAGTCAGTGTGCAGGGGACTCAGGGGCTTGGCCCTAAGAATGTTTTGCACTGA
CAGTGGGAGGGGATAAGGTGGCAGAAGGAACCTGAGCAGGACCCCCACCTGAAGTAGAACTTAAGAGAGGGGCCAAGTGTAGGATTGGGG
ACCATGGTCTGGGAGCTGTTCTGGGGCAGGGGGAATATGCAAGCTAAAGCCCCTCTATACCCTGGTAGGCTTCCTCTTCAGCATGCCCCC
CTCTTCACCCCACACCCATGTGTACACTCAGAGTCCTGCTGCCGCTCCAGGCTGGACCAGACCCCCATCCCCACCCCTCCTGGTCTGTAT
CCTGGGCCTCAGCAAGCCATGCCCCTGGGGTGAGGGGAGGCATCTCCCACCAGCTCTATTCTTTGCCTTAGCTTTGCAGTGAGTGCTGCT
CATGTCCTCCCCTCCACCCGCACATGGGGGTCGCTGCCCTTCACTCCTACCCCCAGAGGCCTTGGCCAAGCTGCTGCTTTGAAAGCGGGA
TCTTGGAGACAGGCCATCCATCCTGGAGCCTCATGGAACAGGATGATGGCACTGAGAAAGCCAATGACCGAATCTCTTTTCTCTGTAAAA

>In-frame_NSD1_ENST00000354179_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_2057nt
GGCCGGGTAGGGGGTTCGCCTGCGGCCGCGTCTGCTCGGGGCCTGAGGCCTCGAAGACCCCAGCCCAAGCCCCCAGGTTGATGCCGGCCC
AGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGAC
AGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGA
ATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATCTTTGCAGACCTGGCTCG
CCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAGGAGCTGCTGCATATTCT
GACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTGGCCTATTACCAAATGGA
ACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATCTCCACGCTTGTGTCATC
CGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCCCTCATCCTGGCCATGGT
CTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTGAACATCGTCGAGGATGG
GCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTGCCAGCTGCTGACCAGAA
TGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAACAGAGGGGATGACCCTGT
GCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCGGCCACAGCTGCCATCTT
CTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAGCTGCGCATGGAGTACCT
CTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCCATACTGCGACGCATCCT
GAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTGGTGCTGGGGGAGGCTCC
CAGCTAGCACCTTGCTGTCCTCCCTTCCCTGCAGCTCCAGTCAGTGTGCAGGGGACTCAGGGGCTTGGCCCTAAGAATGTTTTGCACTGA
CAGTGGGAGGGGATAAGGTGGCAGAAGGAACCTGAGCAGGACCCCCACCTGAAGTAGAACTTAAGAGAGGGGCCAAGTGTAGGATTGGGG
ACCATGGTCTGGGAGCTGTTCTGGGGCAGGGGGAATATGCAAGCTAAAGCCCCTCTATACCCTGGTAGGCTTCCTCTTCAGCATGCCCCC
CTCTTCACCCCACACCCATGTGTACACTCAGAGTCCTGCTGCCGCTCCAGGCTGGACCAGACCCCCATCCCCACCCCTCCTGGTCTGTAT
CCTGGGCCTCAGCAAGCCATGCCCCTGGGGTGAGGGGAGGCATCTCCCACCAGCTCTATTCTTTGCCTTAGCTTTGCAGTGAGTGCTGCT
CATGTCCTCCCCTCCACCCGCACATGGGGGTCGCTGCCCTTCACTCCTACCCCCAGAGGCCTTGGCCAAGCTGCTGCTTTGAAAGCGGGA
TCTTGGAGACAGGCCATCCATCCTGGAGCCTCATGGAACAGGATGATGGCACTGAGAAAGCCAATGACCGAATCTCTTTTCTCTGTAAAA

>In-frame_NSD1_ENST00000439151_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_2049nt
GCTGGCCCGGGAGGGGGCGCGGGGCACGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCC
TTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGG
TGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCTTATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTA
CAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCTGCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCA
AGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGTCCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCC
CCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTTCTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGAT
TCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATAGAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTAT
GAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAACAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCA
TTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAAAGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCA
GCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAATTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGT
ACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTG
CCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGT
TGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAG
AAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTC
CTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGAC
ATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTAT
GCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTG
CCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACAC
GCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCA
CCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATT
GACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAGGGACCGTTCGGGGCGGGCCAGAGGCCTTGGCCAGGAGTTCCTCGC
CTGTTAGAACCAGGATCCACCCCATCGCGGGAGCCGCACCCTGTGGAGCGTTCTGGGGTCCCGGCCCTGACCTCTTCCTGGGCTTCGGGA

>In-frame_NSD1_ENST00000439151_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_2749nt
GCTGGCCCGGGAGGGGGCGCGGGGCACGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCC
TTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGG
TGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCTTATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTA
CAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCTGCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCA
AGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGTCCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCC
CCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTTCTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGAT
TCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATAGAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTAT
GAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAACAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCA
TTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAAAGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCA
GCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAATTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGT
ACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTG
CCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGT
TGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAG
AAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTC
CTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGAC
ATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTAT
GCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTG
CCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACAC
GCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCA
CCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATT
GACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACC
ACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGC
CAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTGGTGCTGGGGGAGGCTCCCAGCTAGCACCTTGCTGTCCTCCCTTCC
CTGCAGCTCCAGTCAGTGTGCAGGGGACTCAGGGGCTTGGCCCTAAGAATGTTTTGCACTGACAGTGGGAGGGGATAAGGTGGCAGAAGG
AACCTGAGCAGGACCCCCACCTGAAGTAGAACTTAAGAGAGGGGCCAAGTGTAGGATTGGGGACCATGGTCTGGGAGCTGTTCTGGGGCA
GGGGGAATATGCAAGCTAAAGCCCCTCTATACCCTGGTAGGCTTCCTCTTCAGCATGCCCCCCTCTTCACCCCACACCCATGTGTACACT
CAGAGTCCTGCTGCCGCTCCAGGCTGGACCAGACCCCCATCCCCACCCCTCCTGGTCTGTATCCTGGGCCTCAGCAAGCCATGCCCCTGG
GGTGAGGGGAGGCATCTCCCACCAGCTCTATTCTTTGCCTTAGCTTTGCAGTGAGTGCTGCTCATGTCCTCCCCTCCACCCGCACATGGG
GGTCGCTGCCCTTCACTCCTACCCCCAGAGGCCTTGGCCAAGCTGCTGCTTTGAAAGCGGGATCTTGGAGACAGGCCATCCATCCTGGAG
CCTCATGGAACAGGATGATGGCACTGAGAAAGCCAATGACCGAATCTCTTTTCTCTGTAAAAATGTAGACTGAAAAGCCATGTGTATTTT

>In-frame_NSD1_ENST00000439151_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_2749nt
GCTGGCCCGGGAGGGGGCGCGGGGCACGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCC
TTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGG
TGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCTTATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTA
CAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCTGCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCA
AGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGTCCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCC
CCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTTCTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGAT
TCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATAGAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTAT
GAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAACAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCA
TTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAAAGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCA
GCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAATTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGT
ACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTG
CCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGT
TGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAG
AAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTC
CTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGAC
ATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTAT
GCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTG
CCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACAC
GCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCA
CCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATT
GACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACC
ACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGC
CAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTGGTGCTGGGGGAGGCTCCCAGCTAGCACCTTGCTGTCCTCCCTTCC
CTGCAGCTCCAGTCAGTGTGCAGGGGACTCAGGGGCTTGGCCCTAAGAATGTTTTGCACTGACAGTGGGAGGGGATAAGGTGGCAGAAGG
AACCTGAGCAGGACCCCCACCTGAAGTAGAACTTAAGAGAGGGGCCAAGTGTAGGATTGGGGACCATGGTCTGGGAGCTGTTCTGGGGCA
GGGGGAATATGCAAGCTAAAGCCCCTCTATACCCTGGTAGGCTTCCTCTTCAGCATGCCCCCCTCTTCACCCCACACCCATGTGTACACT
CAGAGTCCTGCTGCCGCTCCAGGCTGGACCAGACCCCCATCCCCACCCCTCCTGGTCTGTATCCTGGGCCTCAGCAAGCCATGCCCCTGG
GGTGAGGGGAGGCATCTCCCACCAGCTCTATTCTTTGCCTTAGCTTTGCAGTGAGTGCTGCTCATGTCCTCCCCTCCACCCGCACATGGG
GGTCGCTGCCCTTCACTCCTACCCCCAGAGGCCTTGGCCAAGCTGCTGCTTTGAAAGCGGGATCTTGGAGACAGGCCATCCATCCTGGAG
CCTCATGGAACAGGATGATGGCACTGAGAAAGCCAATGACCGAATCTCTTTTCTCTGTAAAAATGTAGACTGAAAAGCCATGTGTATTTT

>In-frame_NSD1_ENST00000347982_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_1298nt
CCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCC
AGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTAC
CTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGA
GGCTGGAGGTGATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCC
GCTGCTACCTAGAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTG
TCCTGGCCTTGGTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGG
ATGCAGCCATCATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAAC
TCTGTTACTCTGCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCG
CCCAGTTCCTACTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTC
TCAACCTGCACCTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGT
TGTTGCTCCTGAACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACG
TGTTTGGCAGCCCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGT
CACCAGGAGACAAGGGACCGTTCGGGGCGGGCCAGAGGCCTTGGCCAGGAGTTCCTCGCCTGTTAGAACCAGGATCCACCCCATCGCGGG
AGCCGCACCCTGTGGAGCGTTCTGGGGTCCCGGCCCTGACCTCTTCCTGGGCTTCGGGATGCCCGCGTCCTCTGCACCCGGCGCTGCAGC

>In-frame_NSD1_ENST00000347982_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_1998nt
CCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCC
AGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTAC
CTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGA
GGCTGGAGGTGATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCC
GCTGCTACCTAGAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTG
TCCTGGCCTTGGTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGG
ATGCAGCCATCATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAAC
TCTGTTACTCTGCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCG
CCCAGTTCCTACTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTC
TCAACCTGCACCTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGT
TGTTGCTCCTGAACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACG
TGTTTGGCAGCCCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGT
CACCAGGAGACAAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTAC
CCGACCTGCAGGCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGT
GCAAGGAATTCCTGGTGCTGGGGGAGGCTCCCAGCTAGCACCTTGCTGTCCTCCCTTCCCTGCAGCTCCAGTCAGTGTGCAGGGGACTCA
GGGGCTTGGCCCTAAGAATGTTTTGCACTGACAGTGGGAGGGGATAAGGTGGCAGAAGGAACCTGAGCAGGACCCCCACCTGAAGTAGAA
CTTAAGAGAGGGGCCAAGTGTAGGATTGGGGACCATGGTCTGGGAGCTGTTCTGGGGCAGGGGGAATATGCAAGCTAAAGCCCCTCTATA
CCCTGGTAGGCTTCCTCTTCAGCATGCCCCCCTCTTCACCCCACACCCATGTGTACACTCAGAGTCCTGCTGCCGCTCCAGGCTGGACCA
GACCCCCATCCCCACCCCTCCTGGTCTGTATCCTGGGCCTCAGCAAGCCATGCCCCTGGGGTGAGGGGAGGCATCTCCCACCAGCTCTAT
TCTTTGCCTTAGCTTTGCAGTGAGTGCTGCTCATGTCCTCCCCTCCACCCGCACATGGGGGTCGCTGCCCTTCACTCCTACCCCCAGAGG
CCTTGGCCAAGCTGCTGCTTTGAAAGCGGGATCTTGGAGACAGGCCATCCATCCTGGAGCCTCATGGAACAGGATGATGGCACTGAGAAA
GCCAATGACCGAATCTCTTTTCTCTGTAAAAATGTAGACTGAAAAGCCATGTGTATTTTCCTATGTGCTGTAGCTCTCCTTTGGAAATAA

>In-frame_NSD1_ENST00000347982_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_1998nt
CCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCC
AGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTAC
CTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGA
GGCTGGAGGTGATCTTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCC
GCTGCTACCTAGAGGAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTG
TCCTGGCCTTGGTGGCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGG
ATGCAGCCATCATCTCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAAC
TCTGTTACTCTGCCCTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCG
CCCAGTTCCTACTGAACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTC
TCAACCTGCACCTGCCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGT
TGTTGCTCCTGAACAGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACG
TGTTTGGCAGCCCGGCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGT
CACCAGGAGACAAGCTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTAC
CCGACCTGCAGGCCATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGT
GCAAGGAATTCCTGGTGCTGGGGGAGGCTCCCAGCTAGCACCTTGCTGTCCTCCCTTCCCTGCAGCTCCAGTCAGTGTGCAGGGGACTCA
GGGGCTTGGCCCTAAGAATGTTTTGCACTGACAGTGGGAGGGGATAAGGTGGCAGAAGGAACCTGAGCAGGACCCCCACCTGAAGTAGAA
CTTAAGAGAGGGGCCAAGTGTAGGATTGGGGACCATGGTCTGGGAGCTGTTCTGGGGCAGGGGGAATATGCAAGCTAAAGCCCCTCTATA
CCCTGGTAGGCTTCCTCTTCAGCATGCCCCCCTCTTCACCCCACACCCATGTGTACACTCAGAGTCCTGCTGCCGCTCCAGGCTGGACCA
GACCCCCATCCCCACCCCTCCTGGTCTGTATCCTGGGCCTCAGCAAGCCATGCCCCTGGGGTGAGGGGAGGCATCTCCCACCAGCTCTAT
TCTTTGCCTTAGCTTTGCAGTGAGTGCTGCTCATGTCCTCCCCTCCACCCGCACATGGGGGTCGCTGCCCTTCACTCCTACCCCCAGAGG
CCTTGGCCAAGCTGCTGCTTTGAAAGCGGGATCTTGGAGACAGGCCATCCATCCTGGAGCCTCATGGAACAGGATGATGGCACTGAGAAA
GCCAATGACCGAATCTCTTTTCTCTGTAAAAATGTAGACTGAAAAGCCATGTGTATTTTCCTATGTGCTGTAGCTCTCCTTTGGAAATAA

>In-frame_NSD1_ENST00000361032_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_2004nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATC
TTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAG
GAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTG
GCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATC
TCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCC
CTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTG
AACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTG
CCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAAC
AGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCG
GCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAG
GGACCGTTCGGGGCGGGCCAGAGGCCTTGGCCAGGAGTTCCTCGCCTGTTAGAACCAGGATCCACCCCATCGCGGGAGCCGCACCCTGTG
GAGCGTTCTGGGGTCCCGGCCCTGACCTCTTCCTGGGCTTCGGGATGCCCGCGTCCTCTGCACCCGGCGCTGCAGCTCGTTATCGATTCC

>In-frame_NSD1_ENST00000361032_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_2704nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATC
TTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAG
GAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTG
GCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATC
TCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCC
CTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTG
AACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTG
CCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAAC
AGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCG
GCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAG
CTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCC
ATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTG
GTGCTGGGGGAGGCTCCCAGCTAGCACCTTGCTGTCCTCCCTTCCCTGCAGCTCCAGTCAGTGTGCAGGGGACTCAGGGGCTTGGCCCTA
AGAATGTTTTGCACTGACAGTGGGAGGGGATAAGGTGGCAGAAGGAACCTGAGCAGGACCCCCACCTGAAGTAGAACTTAAGAGAGGGGC
CAAGTGTAGGATTGGGGACCATGGTCTGGGAGCTGTTCTGGGGCAGGGGGAATATGCAAGCTAAAGCCCCTCTATACCCTGGTAGGCTTC
CTCTTCAGCATGCCCCCCTCTTCACCCCACACCCATGTGTACACTCAGAGTCCTGCTGCCGCTCCAGGCTGGACCAGACCCCCATCCCCA
CCCCTCCTGGTCTGTATCCTGGGCCTCAGCAAGCCATGCCCCTGGGGTGAGGGGAGGCATCTCCCACCAGCTCTATTCTTTGCCTTAGCT
TTGCAGTGAGTGCTGCTCATGTCCTCCCCTCCACCCGCACATGGGGGTCGCTGCCCTTCACTCCTACCCCCAGAGGCCTTGGCCAAGCTG
CTGCTTTGAAAGCGGGATCTTGGAGACAGGCCATCCATCCTGGAGCCTCATGGAACAGGATGATGGCACTGAGAAAGCCAATGACCGAAT
CTCTTTTCTCTGTAAAAATGTAGACTGAAAAGCCATGTGTATTTTCCTATGTGCTGTAGCTCTCCTTTGGAAATAAATCACAGGCATCTG

>In-frame_NSD1_ENST00000361032_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_2704nt
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGTAATGGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGTGGAACATCCCAAAATGCT
TATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGACTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCT
GCTGATGGATCAGAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACTTCCTTGAGTCCTGGTGGT
CCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAACTCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTT
CTGCACTTTGAGAATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTCACAGAGGATGAGAGTATA
GAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAATTATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAA
CAAGACAGCACACCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAAACACAGAAAAATAAGCAA
AGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTCCCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAA
TTAAACTCAATAAATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCA
TCATCTACTTCACAGGAATTGCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATC
TTTGCAGACCTGGCTCGCCGGAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAG
GAGCTGCTGCATATTCTGACTGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTG
GCCTATTACCAAATGGAACACCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATC
TCCACGCTTGTGTCATCCGTGCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCC
CTCATCCTGGCCATGGTCTTCTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTG
AACATCGTCGAGGATGGGCTGCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTG
CCAGCTGCTGACCAGAATGTCATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAAC
AGAGGGGATGACCCTGTGCGCATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCG
GCCACAGCTGCCATCTTCTACCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAG
CTGCGCATGGAGTACCTCTCCCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCC
ATACTGCGACGCATCCTGAATGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTG
GTGCTGGGGGAGGCTCCCAGCTAGCACCTTGCTGTCCTCCCTTCCCTGCAGCTCCAGTCAGTGTGCAGGGGACTCAGGGGCTTGGCCCTA
AGAATGTTTTGCACTGACAGTGGGAGGGGATAAGGTGGCAGAAGGAACCTGAGCAGGACCCCCACCTGAAGTAGAACTTAAGAGAGGGGC
CAAGTGTAGGATTGGGGACCATGGTCTGGGAGCTGTTCTGGGGCAGGGGGAATATGCAAGCTAAAGCCCCTCTATACCCTGGTAGGCTTC
CTCTTCAGCATGCCCCCCTCTTCACCCCACACCCATGTGTACACTCAGAGTCCTGCTGCCGCTCCAGGCTGGACCAGACCCCCATCCCCA
CCCCTCCTGGTCTGTATCCTGGGCCTCAGCAAGCCATGCCCCTGGGGTGAGGGGAGGCATCTCCCACCAGCTCTATTCTTTGCCTTAGCT
TTGCAGTGAGTGCTGCTCATGTCCTCCCCTCCACCCGCACATGGGGGTCGCTGCCCTTCACTCCTACCCCCAGAGGCCTTGGCCAAGCTG
CTGCTTTGAAAGCGGGATCTTGGAGACAGGCCATCCATCCTGGAGCCTCATGGAACAGGATGATGGCACTGAGAAAGCCAATGACCGAAT
CTCTTTTCTCTGTAAAAATGTAGACTGAAAAGCCATGTGTATTTTCCTATGTGCTGTAGCTCTCCTTTGGAAATAAATCACAGGCATCTG

>In-frame_NSD1_ENST00000511258_chr5_176563031_+_NCKIPSD_ENST00000341520_chr3_48717662_-_1354nt
CGCGAACTTCCTCCCGGCGCGGCCCGTGCCCCGCCGGCCGCCTGCGAACACCTCGGCCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGG
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATT
GCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATCTTTGCAGACCTGGCTCGCCG
GAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAGGAGCTGCTGCATATTCTGAC
TGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTGGCCTATTACCAAATGGAACA
CCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATCTCCACGCTTGTGTCATCCGT
GCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCCCTCATCCTGGCCATGGTCTT
CTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTGAACATCGTCGAGGATGGGCT
GCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTGCCAGCTGCTGACCAGAATGT
CATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAACAGAGGGGATGACCCTGTGCG
CATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCGGCCACAGCTGCCATCTTCTA
CCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAGGGACCGTTCGGGGCGGGCCA
GAGGCCTTGGCCAGGAGTTCCTCGCCTGTTAGAACCAGGATCCACCCCATCGCGGGAGCCGCACCCTGTGGAGCGTTCTGGGGTCCCGGC
CCTGACCTCTTCCTGGGCTTCGGGATGCCCGCGTCCTCTGCACCCGGCGCTGCAGCTCGTTATCGATTCCGCCTTTGGAGGCCGGTCCGT

>In-frame_NSD1_ENST00000511258_chr5_176563031_+_NCKIPSD_ENST00000416649_chr3_48717662_-_2054nt
CGCGAACTTCCTCCCGGCGCGGCCCGTGCCCCGCCGGCCGCCTGCGAACACCTCGGCCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGG
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATT
GCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATCTTTGCAGACCTGGCTCGCCG
GAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAGGAGCTGCTGCATATTCTGAC
TGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTGGCCTATTACCAAATGGAACA
CCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATCTCCACGCTTGTGTCATCCGT
GCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCCCTCATCCTGGCCATGGTCTT
CTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTGAACATCGTCGAGGATGGGCT
GCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTGCCAGCTGCTGACCAGAATGT
CATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAACAGAGGGGATGACCCTGTGCG
CATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCGGCCACAGCTGCCATCTTCTA
CCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAGCTGCGCATGGAGTACCTCTC
CCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCCATACTGCGACGCATCCTGAA
TGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTGGTGCTGGGGGAGGCTCCCAG
CTAGCACCTTGCTGTCCTCCCTTCCCTGCAGCTCCAGTCAGTGTGCAGGGGACTCAGGGGCTTGGCCCTAAGAATGTTTTGCACTGACAG
TGGGAGGGGATAAGGTGGCAGAAGGAACCTGAGCAGGACCCCCACCTGAAGTAGAACTTAAGAGAGGGGCCAAGTGTAGGATTGGGGACC
ATGGTCTGGGAGCTGTTCTGGGGCAGGGGGAATATGCAAGCTAAAGCCCCTCTATACCCTGGTAGGCTTCCTCTTCAGCATGCCCCCCTC
TTCACCCCACACCCATGTGTACACTCAGAGTCCTGCTGCCGCTCCAGGCTGGACCAGACCCCCATCCCCACCCCTCCTGGTCTGTATCCT
GGGCCTCAGCAAGCCATGCCCCTGGGGTGAGGGGAGGCATCTCCCACCAGCTCTATTCTTTGCCTTAGCTTTGCAGTGAGTGCTGCTCAT
GTCCTCCCCTCCACCCGCACATGGGGGTCGCTGCCCTTCACTCCTACCCCCAGAGGCCTTGGCCAAGCTGCTGCTTTGAAAGCGGGATCT
TGGAGACAGGCCATCCATCCTGGAGCCTCATGGAACAGGATGATGGCACTGAGAAAGCCAATGACCGAATCTCTTTTCTCTGTAAAAATG

>In-frame_NSD1_ENST00000511258_chr5_176563031_+_NCKIPSD_ENST00000294129_chr3_48717662_-_2054nt
CGCGAACTTCCTCCCGGCGCGGCCCGTGCCCCGCCGGCCGCCTGCGAACACCTCGGCCTCCGCCTCCCCTCAGGTTGATGCCGGCCCAGG
ATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTGCCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGC
CCTTTCGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAATTACCTGGAACTTCATCATCATCTACTTCACAGGAATT
GCCATTTGACCTCAGCATGGCCCTGCCCTCAGGGCAGGTCTGCCACGACCAGCAGAGGCTGGAGGTGATCTTTGCAGACCTGGCTCGCCG
GAAGGACGACGCCCAGCAGCGCAGTTGGGCACTATATGAGGATGAGGGTGTCATCCGCTGCTACCTAGAGGAGCTGCTGCATATTCTGAC
TGATGCAGACCCTGAAGTTTGCAAGAAAATGTGCAAGAGAAACGAGTTCGAGTCTGTCCTGGCCTTGGTGGCCTATTACCAAATGGAACA
CCGAGCATCACTGCGGCTGCTGCTCCTCAAGTGCTTTGGCGCCATGTGCAGCCTGGATGCAGCCATCATCTCCACGCTTGTGTCATCCGT
GCTGCCTGTAGAGCTGGCGAGGGACATGCAGACAGACACGCAGGACCACCAGAAACTCTGTTACTCTGCCCTCATCCTGGCCATGGTCTT
CTCCATGGGAGAGGCAGTGCCCTATGCACACTATGAGCACCTGGGCACGCCTTTCGCCCAGTTCCTACTGAACATCGTCGAGGATGGGCT
GCCCTTGGACACCACAGAGCAGCTGCCGGACCTCTGCGTGAACCTGCTTCTGGCTCTCAACCTGCACCTGCCAGCTGCTGACCAGAATGT
CATCATGGCTGCCCTGAGCAAACACGCCAATGTCAAGATCTTCTCCGAGAAGCTGTTGTTGCTCCTGAACAGAGGGGATGACCCTGTGCG
CATCTTCAAACATGAGCCACAGCCACCACACTCTGTCCTCAAGTTCCTGCAGGACGTGTTTGGCAGCCCGGCCACAGCTGCCATCTTCTA
CCACACAGACATGATGGCTCTCATTGACATCACTGTGCGGCACATCGCAGACCTGTCACCAGGAGACAAGCTGCGCATGGAGTACCTCTC
CCTGATGCATGCTATAGTCCGCACCACACCCTACCTGCAGCACCGCCACCGGCTACCCGACCTGCAGGCCATACTGCGACGCATCCTGAA
TGAGGAGGAGACCTCACCCCAGTGCCAGATGGACCGCATGATTGTCCGAGAGATGTGCAAGGAATTCCTGGTGCTGGGGGAGGCTCCCAG
CTAGCACCTTGCTGTCCTCCCTTCCCTGCAGCTCCAGTCAGTGTGCAGGGGACTCAGGGGCTTGGCCCTAAGAATGTTTTGCACTGACAG
TGGGAGGGGATAAGGTGGCAGAAGGAACCTGAGCAGGACCCCCACCTGAAGTAGAACTTAAGAGAGGGGCCAAGTGTAGGATTGGGGACC
ATGGTCTGGGAGCTGTTCTGGGGCAGGGGGAATATGCAAGCTAAAGCCCCTCTATACCCTGGTAGGCTTCCTCTTCAGCATGCCCCCCTC
TTCACCCCACACCCATGTGTACACTCAGAGTCCTGCTGCCGCTCCAGGCTGGACCAGACCCCCATCCCCACCCCTCCTGGTCTGTATCCT
GGGCCTCAGCAAGCCATGCCCCTGGGGTGAGGGGAGGCATCTCCCACCAGCTCTATTCTTTGCCTTAGCTTTGCAGTGAGTGCTGCTCAT
GTCCTCCCCTCCACCCGCACATGGGGGTCGCTGCCCTTCACTCCTACCCCCAGAGGCCTTGGCCAAGCTGCTGCTTTGAAAGCGGGATCT
TGGAGACAGGCCATCCATCCTGGAGCCTCATGGAACAGGATGATGGCACTGAGAAAGCCAATGACCGAATCTCTTTTCTCTGTAAAAATG


Top

FusionGenePPI for NSD1_NCKIPSD


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NSD1ZNF496, AR, RELA, AFF1, SIRT7, HIST4H4, TNFRSF21, RARA, RXRA, ESR1, PPARG, VDR, THRB, RORA, RORB, HNF4G, NR2F6, ESRRA, NR5A2, NR6A1, NR2F1, NR2F2, NR2E1, HIST3H3, HIST1H1B, ATRX, SNORD3A, HIST1H1D, HIST1H1C, GAR1, HIST1H3A, HIST1H4A, POLR2A, ZFY, ZBTB48, ZNF692, MECP2, TRIM25NCKIPSDDMRTB1, BAIAP2, NCK2, DIAPH3, GRB2, NCK1, STAC, KHDRBS1, FASLG, CRK, YWHAB, PSMD9, SORBS3, HSPB1, CNTROB, XPO1, CAPZA2, CSNK2A2, IQGAP1, FGFR1OP, LRIF1, SMC6, FCHSD1, ITSN2, PALLD, GAS7, ARHGEF6, GIT1, GIT2, ARHGEF7, ZFYVE9, PLCG1, ITSN1, RAB11FIP5, EPS15L1, GEMIN8, SNX33, RBM15, USP9Y, RBM15B, DACH1, GEMIN6, GEMIN2, CSNK1A1, JUN, ARMC8, PDCD2L, FBXO28


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NSD1_NCKIPSD


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NSD1_NCKIPSD


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNSD1C0175695Sotos' syndrome14CTD_human;ORPHANET;UNIPROT
HgeneNSD1C0004352Autistic Disorder1CTD_human
HgeneNSD1C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneNSD1C0265210Weaver syndrome1CTD_human;ORPHANET
HgeneNSD1C3714756Intellectual Disability1CTD_human